PSIBLAST alignment of GI: 254780238 and protein with PDB id: 3bbn

>gi|188036212|pdb|3BBN|K Chain K, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 140
 Score =  148 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/126 (40%), Positives = 74/126 (58%)

Query: 4   SPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63
             S  ++   + I  G  HV ++FNNT +T+TD  G  ++W+S    GF G+++ +PFAA
Sbjct: 15  RISSRKSASARKIPKGVIHVQASFNNTIVTVTDVRGRVVSWASAGTCGFRGTKRGTPFAA 74

Query: 64  QVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP 123
           Q A  +        GM   EV + G G GRD+ALRA+R  G  +  + DVT + HNGCRP
Sbjct: 75  QTAAGNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGCRP 134

Query: 124 RKRRRI 129
            K+RR+
Sbjct: 135 PKKRRV 140