RPSBLAST alignment for GI: 254780238 and conserved domain: TIGR03632

>gnl|CDD|163365 TIGR03632, bact_S11, 30S ribosomal protein S11. This model describes the bacterial 30S ribosomal protein S11. Cutoffs are set such that the model excludes archaeal and eukaryotic ribosomal proteins, but many chloroplast and mitochondrial equivalents of S11 are detected. Length = 108
 Score =  163 bits (414), Expect = 2e-41
 Identities = 61/108 (56%), Positives = 82/108 (75%)

Query: 19  GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           G AH+ +TFNNT +TITDP GN ++W+S   VGF GS+K++P+AAQ+A +D + KA+  G
Sbjct: 1   GVAHIHATFNNTIVTITDPQGNVLSWASAGAVGFKGSKKSTPYAAQLAAEDAAKKAKEFG 60

Query: 79  MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
           M +++V V G GAGR+SA+RAL+A G  + SI DVT I HNGCRP KR
Sbjct: 61  MKTVDVYVKGPGAGRESAIRALQAAGLEVTSIKDVTPIPHNGCRPPKR 108