RPSBLAST alignment for GI: 254780238 and conserved domain: KOG0407

>gnl|CDD|35628 KOG0407, KOG0407, KOG0407, 40S ribosomal protein S14 [Translation, ribosomal structure and biogenesis]. Length = 139
 Score = 53.5 bits (128), Expect = 2e-08
 Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 9/122 (7%)

Query: 16  IVSGRAHVVSTFNNTRITITDPHGN-TIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74
            V G AH+ ++FN+T + +TD  G  TI   +  +   +   ++SP+AA +A  D +AK 
Sbjct: 14  QVFGVAHIFASFNDTFVHVTDLSGKETIVRVTGGMKVKADRDESSPYAAMLAAQDVAAKC 73

Query: 75  QNHGMSSLEVKVSG--------LGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126
           +  G+++L +K+           G G  SALRAL   G  I  I DVT I  +  R +  
Sbjct: 74  KELGITALHIKLRATGGTKTKTPGPGAQSALRALARSGMRIGRIEDVTPIPSDSTRRKGG 133

Query: 127 RR 128
           RR
Sbjct: 134 RR 135