RPSBLAST alignment for GI: 254780238 and conserved domain: KOG0408

>gnl|CDD|35629 KOG0408, KOG0408, KOG0408, Mitochondrial/chloroplast ribosomal protein S11 [Translation, ribosomal structure and biogenesis]. Length = 190
 Score =  100 bits (251), Expect = 9e-23
 Identities = 53/109 (48%), Positives = 71/109 (65%)

Query: 21  AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS 80
            H+ ++FNNT +T+TD  G  I+WSS    GF  +RK +P AAQ A      +A + GM 
Sbjct: 82  IHIRASFNNTIVTVTDVKGEVISWSSCGTEGFRNTRKGTPIAAQTAAVAAIRRAVDQGMQ 141

Query: 81  SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
           ++ V+V GLG GR SAL+ LR  G  +VSI D T + HNGCRPRK+RR+
Sbjct: 142 TVRVRVKGLGPGRMSALKGLRMGGLLVVSITDNTPMPHNGCRPRKKRRL 190