RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780238|ref|YP_003064651.1| 30S ribosomal protein S11 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|30449 COG0100, RpsK, Ribosomal protein S11 [Translation, ribosomal structure and biogenesis]. Length = 129 Score = 149 bits (378), Expect = 2e-37 Identities = 69/129 (53%), Positives = 93/129 (72%) Query: 1 MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60 M K+ +R + + +KNI G AH+ ++FNNT +TITD GN I W+S +GF GSRK++P Sbjct: 1 MAKAKARKKKKVKKNIADGVAHIHASFNNTIVTITDLTGNVIIWASSGGMGFKGSRKSTP 60 Query: 61 FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120 +AAQ+A +D + KA+ HG+ S+EVKV G G GR++A+RAL A G I I DVT I HNG Sbjct: 61 YAAQLAAEDAAKKAKEHGIKSVEVKVKGPGPGREAAIRALAAAGLKITRIEDVTPIPHNG 120 Query: 121 CRPRKRRRI 129 CRP KRRR+ Sbjct: 121 CRPPKRRRV 129 >gnl|CDD|144124 pfam00411, Ribosomal_S11, Ribosomal protein S11. Length = 109 Score = 127 bits (321), Expect = 8e-31 Identities = 56/109 (51%), Positives = 75/109 (68%) Query: 19 GRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHG 78 G AH+ ++FNNT +T+TD G ++WSS GF GSRK++P+AAQ A ++ + A+ G Sbjct: 1 GIAHIQASFNNTIVTVTDVIGRVVSWSSAGGCGFKGSRKSTPYAAQTAAENAAKIAKEQG 60 Query: 79 MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRR 127 + +LEVK+ G G GR+SALRAL G I I DVT I HNGCRP K+R Sbjct: 61 IKALEVKIKGPGPGRESALRALARSGLRIGRIRDVTPIPHNGCRPPKKR 109 >gnl|CDD|176982 CHL00041, rps11, ribosomal protein S11. Length = 116 Score = 126 bits (318), Expect = 2e-30 Identities = 50/112 (44%), Positives = 69/112 (61%) Query: 10 NRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDD 69 + ++ I G H+ ++FNNT +T+TD G I+WSS GF G+RK +PFAAQ A ++ Sbjct: 5 RKSKRKIPKGVIHIQASFNNTIVTVTDVRGRVISWSSAGACGFKGARKGTPFAAQTAAEN 64 Query: 70 CSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGC 121 + GM EV + G G GRD+ALRA+R G + SI DVT + HNGC Sbjct: 65 AIRTVIDQGMKRAEVMIKGPGLGRDTALRAIRRSGLKLSSIRDVTPMPHNGC 116 >gnl|CDD|35629 KOG0408, KOG0408, KOG0408, Mitochondrial/chloroplast ribosomal protein S11 [Translation, ribosomal structure and biogenesis]. Length = 190 Score = 100 bits (251), Expect = 9e-23 Identities = 53/109 (48%), Positives = 71/109 (65%) Query: 21 AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS 80 H+ ++FNNT +T+TD G I+WSS GF +RK +P AAQ A +A + GM Sbjct: 82 IHIRASFNNTIVTVTDVKGEVISWSSCGTEGFRNTRKGTPIAAQTAAVAAIRRAVDQGMQ 141 Query: 81 SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129 ++ V+V GLG GR SAL+ LR G +VSI D T + HNGCRPRK+RR+ Sbjct: 142 TVRVRVKGLGPGRMSALKGLRMGGLLVVSITDNTPMPHNGCRPRKKRRL 190 >gnl|CDD|35628 KOG0407, KOG0407, KOG0407, 40S ribosomal protein S14 [Translation, ribosomal structure and biogenesis]. Length = 139 Score = 53.5 bits (128), Expect = 2e-08 Identities = 41/122 (33%), Positives = 63/122 (51%), Gaps = 9/122 (7%) Query: 16 IVSGRAHVVSTFNNTRITITDPHGN-TIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKA 74 V G AH+ ++FN+T + +TD G TI + + + ++SP+AA +A D +AK Sbjct: 14 QVFGVAHIFASFNDTFVHVTDLSGKETIVRVTGGMKVKADRDESSPYAAMLAAQDVAAKC 73 Query: 75 QNHGMSSLEVKVSG--------LGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKR 126 + G+++L +K+ G G SALRAL G I I DVT I + R + Sbjct: 74 KELGITALHIKLRATGGTKTKTPGPGAQSALRALARSGMRIGRIEDVTPIPSDSTRRKGG 133 Query: 127 RR 128 RR Sbjct: 134 RR 135 >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activation. In addition, Itk contains the Tec homology (TH) domain containing one proline-rich region and a zinc-binding region. Tec kinases are expressed mainly by haematopoietic cells. Itk is expressed in T-cells and mast cells, and is important in their development and differentiation. Of the three Tec kinases expressed in T-cells, Itk plays the predominant role in T-cell receptor (TCR) signaling. It is activated by phosphorylation upon TCR crosslinking and is involved in the pathway resulting in phospholipase C-gamma1 activation and actin polymerization. It also plays a role in the downstream signaling of the T-cell costimulatory receptor CD28, the T-cell surface receptor CD2, and the chemokine receptor CXCR4. In addition, Itk is crucial for the development of T-helper(Th)2 effector responses. Length = 256 Score = 28.4 bits (63), Expect = 0.61 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 8/53 (15%) Query: 9 RNRERKNIVSGRAHVV--STFNNTRITITDPHGNT------IAWSSPKVVGFS 53 R+ +N + G VV S F TR + D + ++ + WSSP+V FS Sbjct: 124 RDLAARNCLVGENQVVKVSDFGMTRFVLDDQYTSSTGTKFPVKWSSPEVFSFS 176 >gnl|CDD|36838 KOG1625, KOG1625, KOG1625, DNA polymerase alpha-primase complex, polymerase-associated subunit B [Replication, recombination and repair]. Length = 600 Score = 27.6 bits (61), Expect = 0.92 Identities = 15/75 (20%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Query: 2 PKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRK-NSP 60 P SPS + K VV+TF ++ G+ + KV F ++K + Sbjct: 145 PSSPSS--EKFEKRASVNPGEVVTTFGGEKLKDVSSKGSVGPSTQLKVTNFIDAKKPSYR 202 Query: 61 FAAQVATDDCSAKAQ 75 + +D Sbjct: 203 YMYDKLSDRSEVLRD 217 >gnl|CDD|145615 pfam02570, CbiC, Precorrin-8X methylmutase. This is a family Precorrin-8X methylmutases also known as Precorrin isomerase, CbiC/CobH, EC:5.4.1.2. This enzyme catalyses the reaction: Precorrin-8X <=> hydrogenobyrinate. This enzyme is part of the Cobalamin (vitamin B12) biosynthetic pathway and catalyses a methyl rearrangement. Length = 198 Score = 27.0 bits (61), Expect = 1.7 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Query: 94 DSALRALRAIGFTIVSICDVTMIAH 118 ++ AL+A G I+ DVTM+A Sbjct: 51 EAGRAALKA-GAPIL--TDVTMVAA 72 >gnl|CDD|33151 COG3342, COG3342, Uncharacterized conserved protein [Function unknown]. Length = 265 Score = 26.1 bits (57), Expect = 3.1 Identities = 14/74 (18%), Positives = 26/74 (35%), Gaps = 8/74 (10%) Query: 31 RITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQ--VATDDCSAKAQNHGMSSLEVKVSG 88 ++ + D G A++ + ++G R + Q + +A M+ G Sbjct: 82 QVGVVDQKGRAAAFTGRECYEYAGHRAGENYTVQGNLLAGPEVVEA----MAKAFESAKG 137 Query: 89 LGAGRDSALRALRA 102 R L AL A Sbjct: 138 WLVER--LLAALAA 149 >gnl|CDD|31205 COG1001, AdeC, Adenine deaminase [Nucleotide transport and metabolism]. Length = 584 Score = 26.0 bits (57), Expect = 3.3 Identities = 14/62 (22%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Query: 8 IRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVAT 67 + V V + +I + + HG T + V GF K A+ VA Sbjct: 414 TEELRERLPVEDGKVVPLERDILKIAVLERHGKTGNVGNGFVKGF--GLKEGAIASTVAH 471 Query: 68 DD 69 D Sbjct: 472 DS 473 >gnl|CDD|58177 cd03511, Rhizopine-oxygenase-like, This CD includes the putative hydrocarbon oxygenase, MocD, a bacterial rhizopine (3-O-methyl-scyllo-inosamine, 3-O-MSI) oxygenase, and other related proteins. It has been proposed that MocD, MocE (Rieske-like ferredoxin), and MocF (ferredoxin reductase) under the regulation of MocR, act in concert to form a ferredoxin oxygenase system that demethylates 3-O-MSI to form scyllo-inosamine. This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.. Length = 285 Score = 25.6 bits (56), Expect = 4.1 Identities = 9/30 (30%), Positives = 14/30 (46%) Query: 18 SGRAHVVSTFNNTRITITDPHGNTIAWSSP 47 G + NTR T+T+P + W+ P Sbjct: 217 GGCPEDANDLRNTRTTLTNPPLRFLYWNMP 246 >gnl|CDD|112483 pfam03668, ATP_bind_2, P-loop ATPase protein family. This family contains an ATP-binding site and could be an ATPase (personal obs:C Yeats). Length = 284 Score = 25.5 bits (56), Expect = 4.1 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 84 VKVSGL-GAGRDSALRALRAIGFTIV 108 V ++G GAG+ ALRAL +G+ V Sbjct: 4 VIITGRSGAGKSVALRALEDLGYYCV 29 >gnl|CDD|133321 cd04121, Rab40, Rab40 subfamily. This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous. In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle. Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components. Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Length = 189 Score = 25.3 bits (55), Expect = 4.6 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Query: 47 PKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEV 84 PK++ G+R + F QVAT+ A A+ +GM+ EV Sbjct: 112 PKIL--VGNRLHLAFKRQVATEQAQAYAERNGMTFFEV 147 >gnl|CDD|133271 cd01868, Rab11_like, Rab11-like. Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation. Length = 165 Score = 25.2 bits (56), Expect = 5.3 Identities = 7/20 (35%), Positives = 13/20 (65%) Query: 64 QVATDDCSAKAQNHGMSSLE 83 V T++ A A+ +G+S +E Sbjct: 125 AVPTEEAKAFAEKNGLSFIE 144 >gnl|CDD|31846 COG1660, COG1660, Predicted P-loop-containing kinase [General function prediction only]. Length = 286 Score = 25.1 bits (55), Expect = 5.4 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query: 84 VKVSGL-GAGRDSALRALRAIGFTIV 108 V V+GL GAG+ ALR L +G+ V Sbjct: 4 VIVTGLSGAGKSVALRVLEDLGYYCV 29 >gnl|CDD|145912 pfam03014, SP2, Structural protein 2. This family represents structural protein 2 of the hepatitis E virus. The high basic amino acid content of this protein has lead to the suggestion of a role in viral genomic RNA encapsidation. Length = 639 Score = 25.1 bits (54), Expect = 5.6 Identities = 14/39 (35%), Positives = 16/39 (41%) Query: 90 GAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR 128 G RDS AL I T DV + G RP + R Sbjct: 3 GDRRDSQPFALPYIHPTNPFAADVFSQSGAGARPGQPPR 41 >gnl|CDD|73031 cd03272, ABC_SMC3_euk, Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18).. Length = 243 Score = 24.8 bits (54), Expect = 7.9 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 7/36 (19%) Query: 28 NNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAA 63 + T I P N + VG +GS K++ FAA Sbjct: 14 DQTVIEPFSPKHNVV-------VGRNGSGKSNFFAA 42 >gnl|CDD|145559 pfam02481, DNA_processg_A, DNA recombination-mediator protein A. The SMF family, of DNA processing chain A, dprA, are a group of bacterial proteins. In H. pylori, dprA is required for natural chromosomal and plasmid transformation. It has now been shown that DprA is found to bind cooperatively to single-stranded DNA (ssDNA) and to interact with RecA. In the process, DprA-RecA-ssDNA filaments are produced and these filaments catalyse the homology-dependent formation of joint molecules. While the E.coli SSB protein limits access of RecA to ssDNA, DprA alleviates this barrier. It is proposed that DprA is a new member of the recombination-mediator protein family, dedicated to natural bacterial transformation. Length = 210 Score = 24.4 bits (54), Expect = 9.0 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 15/60 (25%) Query: 54 GSRKNSP----FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDS-ALR-ALRAIGFTI 107 G+RK S A ++A + VSGL G D+ A R AL A G TI Sbjct: 49 GTRKPSAYGLRVARKLAAELAERGI---------TIVSGLARGIDTAAHRAALEAGGRTI 99 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.130 0.385 Gapped Lambda K H 0.267 0.0637 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,491,713 Number of extensions: 66018 Number of successful extensions: 176 Number of sequences better than 10.0: 1 Number of HSP's gapped: 174 Number of HSP's successfully gapped: 20 Length of query: 129 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,470,190 Effective search space: 205628740 Effective search space used: 205628740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.0 bits)