RPSBLAST alignment of GI: 254780238 and protein with PDBid: 1s1h

>1s1h_K RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1 Length = 136
 Score =  118 bits (298), Expect = 3e-28
 Identities = 38/132 (28%), Positives = 62/132 (46%), Gaps = 9/132 (6%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSR-KNSPFAAQ 64
           S +      + V G A + ++FN+T + +TD  G          +     R ++SP+AA 
Sbjct: 1   SNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAM 60

Query: 65  VATDDCSAKAQNHGMSSLEVKVSGL--------GAGRDSALRALRAIGFTIVSICDVTMI 116
           +A  D +AK +  G++++ VK+           G G  +ALRAL   G  I  I DVT +
Sbjct: 61  LAAQDVAAKCREVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPV 120

Query: 117 AHNGCRPRKRRR 128
             +  R +  RR
Sbjct: 121 PSDSTRKKGGRR 132