RPSBLAST alignment of GI: 254780238 and protein with PDBid: 2vqe

>2vqe_K 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1gix_N* 1hnw_K* 1hnx_K* 1hnz_K* 1hr0_K 1ibk_K* 1ibl_K* 1ibm_K 1j5e_K 1jgo_N* 1jgp_N* 1jgq_N* 1ml5_N* 1n32_K* 1n33_K* 1n34_K 1n36_K 1xmo_K* 1xmq_K* 1xnq_K* ... Length = 129
 Score =  142 bits (360), Expect = 2e-35
 Identities = 64/128 (50%), Positives = 91/128 (71%), Gaps = 2/128 (1%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K PS+   + ++ + SGRA++ +++NNT +TITDP GN I WSS  V+G+ GSRK +P
Sbjct: 1   MAKKPSK--KKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTP 58

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           +AAQ+A  D + KA  +GM S++V V G GAGR+ A+RAL+A G  + SI D T + HNG
Sbjct: 59  YAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNG 118

Query: 121 CRPRKRRR 128
           CRP+K+ R
Sbjct: 119 CRPKKKFR 126