RPSBLAST alignment of GI: 254780238 and protein with PDBid: 3bbn

>3bbn_K Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 140
 Score =  136 bits (344), Expect = 1e-33
 Identities = 51/124 (41%), Positives = 74/124 (59%)

Query: 6   SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQV 65
           S  ++   + I  G  HV ++FNNT +T+TD  G  ++W+S    GF G+++ +PFAAQ 
Sbjct: 17  SSRKSASARKIPKGVIHVQASFNNTIVTVTDVRGRVVSWASAGTCGFRGTKRGTPFAAQT 76

Query: 66  ATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRK 125
           A  +        GM   EV + G G GRD+ALRA+R  G  +  + DVT + HNGCRP K
Sbjct: 77  AAGNAIRTVVEQGMQRAEVMIKGPGLGRDAALRAIRRSGILLSFVRDVTPMPHNGCRPPK 136

Query: 126 RRRI 129
           +RR+
Sbjct: 137 KRRV 140