BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780238|ref|YP_003064651.1| 30S ribosomal protein S11
[Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780238|ref|YP_003064651.1| 30S ribosomal protein S11 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 129

 Score =  262 bits (669), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP
Sbjct: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG
Sbjct: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRRI
Sbjct: 121 CRPRKRRRI 129


>gi|254780893|ref|YP_003065306.1| two component response regulator [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 236

 Score = 24.3 bits (51), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 78 GMSSLEVKVSGLGAGRDSAL 97
          GMSS+E KV GL +G D  +
Sbjct: 80 GMSSIEDKVRGLQSGADDYI 99


>gi|254780148|ref|YP_003064561.1| transcription antitermination protein NusG [Candidatus
          Liberibacter asiaticus str. psy62]
          Length = 177

 Score = 22.3 bits (46), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 33 TITDPHGNTIAWSSPKVVGFSGSRKN 58
           +TD   +TI   +PKV+GF G+ +N
Sbjct: 70 VMTDKVYHTIK-DTPKVIGFLGTGEN 94


>gi|255764496|ref|YP_003065012.2| excinuclease ABC subunit C [Candidatus Liberibacter asiaticus
          str. psy62]
          Length = 616

 Score = 21.9 bits (45), Expect = 4.2,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%)

Query: 7  RIRNRERKNIVSGR-AHVVSTFNNTRITIT 35
          RI++    N  + R  H++S  NN R T+T
Sbjct: 34 RIKSYMHSNNHTHRITHMISQINNIRFTVT 63


>gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 805

 Score = 21.9 bits (45), Expect = 4.5,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 66  ATDDCSAKAQNHG------MSSLEVKVSGLGAGRDSALRALRAIGFTIV 108
           A+D C A+   +       M+S   ++SG+    + +LR L  +GF+++
Sbjct: 388 ASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVI 436


>gi|254780248|ref|YP_003064661.1| 30S ribosomal protein S14 [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 101

 Score = 21.6 bits (44), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 1  MPKSPSRIRNRERKNIVSGRAH-VVSTFNNTRITITDPHG 39
          +P+  SR+R R R  I SGR+  V   F  +R+ + +  G
Sbjct: 51 LPRDGSRVRVRNRCEI-SGRSRGVYRDFRLSRLALRELGG 89


>gi|254780261|ref|YP_003064674.1| 50S ribosomal protein L3 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 221

 Score = 21.6 bits (44), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 14/28 (50%)

Query: 51  GFSGSRKNSPFAAQVATDDCSAKAQNHG 78
           GFSG+ K   F    AT   S   ++HG
Sbjct: 119 GFSGAMKRHNFGGLRATHGVSISHRSHG 146


>gi|254780903|ref|YP_003065316.1| two-component sensor histidine kinase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 766

 Score = 21.6 bits (44), Expect = 5.6,   Method: Composition-based stats.
 Identities = 9/25 (36%), Positives = 15/25 (60%)

Query: 104 GFTIVSICDVTMIAHNGCRPRKRRR 128
           G TI    D+T++ HN  + R+ +R
Sbjct: 475 GGTISVGTDITLLKHNQAQLRESKR 499


>gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 290

 Score = 21.2 bits (43), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 13/23 (56%)

Query: 28  NNTRITITDPHGNTIAWSSPKVV 50
           N T   I DP+ +TI  S P V+
Sbjct: 95  NETENHIDDPYNSTIFTSIPTVL 117


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.319    0.130    0.385 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 78,442
Number of Sequences: 1233
Number of extensions: 2678
Number of successful extensions: 10
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 9
length of query: 129
length of database: 328,796
effective HSP length: 65
effective length of query: 64
effective length of database: 248,651
effective search space: 15913664
effective search space used: 15913664
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 33 (17.3 bits)