RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780239|ref|YP_003064652.1| 30S ribosomal protein S13 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >gnl|CDD|179955 PRK05179, rpsM, 30S ribosomal protein S13; Validated. Length = 122 Score = 197 bits (503), Expect = 7e-52 Identities = 74/111 (66%), Positives = 90/111 (81%) Query: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 MARIAGV+IPR KRVV AL YI+GIG +++I I P+ RV L + E+ +IR+ I Sbjct: 1 MARIAGVDIPRNKRVVIALTYIYGIGRTRAKEILAAAGIDPDTRVKDLTDEELDKIREEI 60 Query: 61 EQDYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRK 111 +++Y+VEGDLRR V+MNIKRLMD+GCYRGLRHRRGLPVRGQRT TNARTRK Sbjct: 61 DKNYKVEGDLRREVSMNIKRLMDIGCYRGLRHRRGLPVRGQRTKTNARTRK 111 >gnl|CDD|163364 TIGR03631, bact_S13, 30S ribosomal protein S13. This model describes bacterial ribosomal protein S13, to the exclusion of the homologous archaeal S13P and eukaryotic ribosomal protein S18. This model identifies some (but not all) instances of chloroplast and mitochondrial S13, which is of bacterial type. Length = 113 Score = 178 bits (453), Expect = 4e-46 Identities = 72/109 (66%), Positives = 84/109 (77%) Query: 3 RIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAIEQ 62 RIAGV+IP KRV AL YI+GIG ++ I K I P++RV L E E+ IR+ IE Sbjct: 1 RIAGVDIPNNKRVEIALTYIYGIGRTRARKILEKAGIDPDKRVKDLTEEELNAIREEIEA 60 Query: 63 DYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRK 111 Y+VEGDLRR V++NIKRLMD+GCYRGLRHRRGLPVRGQRT TNARTRK Sbjct: 61 KYKVEGDLRREVSLNIKRLMDIGCYRGLRHRRGLPVRGQRTKTNARTRK 109 >gnl|CDD|179731 PRK04053, rps13p, 30S ribosomal protein S13P; Reviewed. Length = 149 Score = 77.2 bits (191), Expect = 9e-16 Identities = 47/142 (33%), Positives = 70/142 (49%), Gaps = 25/142 (17%) Query: 3 RIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAIEQ 62 RIAG ++ K V AL I GIG ++++ I KL + P ++ L + E+ +I +A+E Sbjct: 11 RIAGTDLDGTKPVEYALTGIKGIGRRTARAIARKLGLDPNAKLGYLSDEEIEKIEEALED 70 Query: 63 DYQ----------------------VEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRG 100 + + DL TV +I R+ + YRG+RH GL VRG Sbjct: 71 PAEEGIPSWMLNRRKDYETGEDLHLIGSDLILTVREDINRMKKIRSYRGIRHELGLKVRG 130 Query: 101 QRTHTNARTRKKFGKGGVARKR 122 QRT + RT G GV+RK+ Sbjct: 131 QRTRSTGRTG---GTVGVSRKK 149 >gnl|CDD|132668 TIGR03629, arch_S13P, archaeal ribosomal protein S13P. This model describes exclusively the archaeal ribosomal protein S13P. It excludes the homologous eukaryotic 40S ribosomal protein S18 and bacterial 30S ribosomal protein S13. Length = 144 Score = 76.5 bits (189), Expect = 2e-15 Identities = 45/143 (31%), Positives = 70/143 (48%), Gaps = 24/143 (16%) Query: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 + RIA ++ K V AL I GIG + ++ I KL + P ++ L + E+ ++ +A+ Sbjct: 5 IVRIADTDLDGNKPVEYALTGIKGIGRRFARAIARKLGVDPNAKLGYLDDEEIEKLEEAV 64 Query: 61 E--------------QDYQ-------VEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVR 99 E +DY+ + DL TV +I R+ + YRG+RH GL VR Sbjct: 65 ENYEYGIPSWLLNRRKDYETGEDLHLIGSDLDMTVREDINRMKKIRSYRGIRHELGLKVR 124 Query: 100 GQRTHTNARTRKKFGKGGVARKR 122 GQRT + R GV+RK+ Sbjct: 125 GQRTKSTGRRG---RTVGVSRKK 144 >gnl|CDD|185469 PTZ00134, PTZ00134, 40S ribosomal protein S18; Provisional. Length = 154 Score = 46.6 bits (111), Expect = 2e-06 Identities = 39/144 (27%), Positives = 63/144 (43%), Gaps = 25/144 (17%) Query: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 + RI N+ ++V AL I GIG + + +C K I +R +L E+ +I + I Sbjct: 14 ILRILNTNVDGKRKVPYALTAIKGIGRRFAYLVCKKAGIDVTKRAGELTAEEIEKIVEII 73 Query: 61 E---------------------QDYQV-EGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPV 98 ++ + L + +++RL + +RGLRH GL V Sbjct: 74 ANPLQFKIPDWFLNRQRDPKDGKNSHLTSNMLDTKLREDLERLKKIRLHRGLRHHWGLRV 133 Query: 99 RGQRTHTNARTRKKFGKGGVARKR 122 RGQ T T R + GV+RK+ Sbjct: 134 RGQHTKTTGRRGRTV---GVSRKK 154 >gnl|CDD|131167 TIGR02112, cyd_oper_ybgE, cyd operon protein YbgE. This model describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria. Length = 93 Score = 30.0 bits (68), Expect = 0.14 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Query: 2 ARIAGVNIPRAKRVVRALC--YIHGIGFK 28 A I G N A ++ A+C +IHG+GF+ Sbjct: 37 AAIGGFNAVLALLMIWAVCILWIHGVGFR 65 >gnl|CDD|150308 pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria. Length = 82 Score = 27.6 bits (62), Expect = 0.92 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Query: 2 ARIAGVNIPRAKRVVRALC--YIHGIGFK 28 A I G N A ++ A+C IHG+GF+ Sbjct: 26 AAIGGFNPLLAPLLIWAVCAGMIHGVGFR 54 >gnl|CDD|179652 PRK03815, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 401 Score = 26.9 bits (60), Expect = 1.5 Identities = 5/19 (26%), Positives = 10/19 (52%) Query: 25 IGFKSSQDICNKLAIPPER 43 I ++ +D+ K I E+ Sbjct: 208 IFYEDEEDLAEKFGIDSEK 226 >gnl|CDD|162152 TIGR00998, 8a0101, efflux pump membrane protein (multidrug resistance protein A). Length = 334 Score = 26.7 bits (59), Expect = 1.5 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Query: 42 ERRVHQL---VESEVIQIRQAIEQDYQVEGDLRRTVAM 76 E V QL VES I++ QA E+ Q E DLRR V + Sbjct: 100 EITVQQLQAKVESLKIKLEQAREKLLQAELDLRRRVPL 137 >gnl|CDD|140257 PTZ00230, PTZ00230, variable surface protein Vir7; Provisional. Length = 364 Score = 26.4 bits (58), Expect = 1.8 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Query: 14 RVVRALCYIHGIGFKSSQD--ICNKL 37 ++++ALCY++ SS D ICN L Sbjct: 54 KILKALCYVYRESSSSSFDSNICNFL 79 >gnl|CDD|161725 TIGR00129, fdhD_narQ, formate dehydrogenase family accessory protein FdhD. FdhD in E. coli and NarQ in B. subtilis are required for the activity of formate dehydrogenase. The gene name in B. subtilis reflects the requirement of the neighboring gene narA for nitrate assimilation, for which NarQ is not required. In some species, the gene is associated not with a known formate dehydrogenase but with a related putative molybdopterin-binding oxidoreductase. A reasonable hypothesis is that this protein helps prepare a required cofactor for assembly into the holoenzyme. Length = 237 Score = 26.3 bits (58), Expect = 2.3 Identities = 18/74 (24%), Positives = 28/74 (37%), Gaps = 11/74 (14%) Query: 25 IGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAIEQDYQVEGDLRRTVAMNIKRLMDL 84 +GF S+ I N + E I+I I + Q++ RR + + R Sbjct: 35 VGFLLSEGIINSPD-----------DIEGIEIDDNINIEVQIDLSSRRFMILKENRTGCS 83 Query: 85 GCYRGLRHRRGLPV 98 GC R +R V Sbjct: 84 GCGRERLNRIPKMV 97 >gnl|CDD|179773 PRK04184, PRK04184, DNA topoisomerase VI subunit B; Validated. Length = 535 Score = 25.2 bits (56), Expect = 3.9 Identities = 8/39 (20%), Positives = 22/39 (56%) Query: 24 GIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAIEQ 62 +G K++ +I K + P ++ +L E+ ++ +A ++ Sbjct: 268 RVGDKTADEILEKAGLDPNKKPKELTREELERLVEAFKK 306 >gnl|CDD|179062 PRK00553, PRK00553, ribose-phosphate pyrophosphokinase; Provisional. Length = 332 Score = 25.3 bits (55), Expect = 4.2 Identities = 13/51 (25%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Query: 7 VNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIR 57 ++I ++ V+ +L K IC KL++ P V Q IR Sbjct: 3 LSIDKSNHVIFSLSKAK----KLVDSICRKLSMKPGEIVIQKFADGETYIR 49 >gnl|CDD|183384 PRK11924, PRK11924, RNA polymerase sigma factor; Provisional. Length = 179 Score = 24.9 bits (55), Expect = 5.1 Identities = 10/31 (32%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Query: 10 PRAKRVVRALCYIHGIGFKSSQDICNKLAIP 40 P +R V L Y+ G S ++I L +P Sbjct: 127 PVKQREVFLLRYVEG---LSYREIAEILGVP 154 >gnl|CDD|132354 TIGR03311, Se_dep_Molyb_1, selenium-dependent molybdenum hydroxylase 1. Members of this protein family show full length homology to the molybdenum-containing aldehyde oxido-reductase of Desulfovibrio gigas. Members, however, are found only within species that have, and near those genes that encode, a set of predicted accessory proteins for selenium-dependent molybdenum hydroxylases. The best known examples of such enzymes are forms of xanthine dehydrogenase and purine hydroxylase; this family appears to be another such enzyme. Length = 848 Score = 24.8 bits (54), Expect = 5.3 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 12/55 (21%) Query: 6 GVNIP---RAKRVVR---------ALCYIHGIGFKSSQDICNKLAIPPERRVHQL 48 GV IP R V A C G+G +Q +C +PPE V +L Sbjct: 588 GVGIPDTGRCNLAVEDGKVHIRTSAACIGQGLGTVLTQIVCETTGLPPEVIVCEL 642 >gnl|CDD|129401 TIGR00300, TIGR00300, conserved hypothetical protein TIGR00300. All members of the family come from genome projects. A partial length search brings in two plant lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzymes hitting the N-terminal region of the family. Length = 407 Score = 24.4 bits (53), Expect = 7.2 Identities = 15/50 (30%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Query: 32 DICNKLAIPPERRVHQLVESEVIQ---IRQAIEQDYQVEGDLRRTVAMNI 78 DI + +P R H + V + IR A+EQ +G + V NI Sbjct: 256 DIQRGIPVPGGHRHHLKAINSVRRAGGIRDAVEQGIIKKGVMYECVKNNI 305 >gnl|CDD|162378 TIGR01472, gmd, GDP-mannose 4,6-dehydratase. Excluded from this model are members of the clade that score poorly because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase (PUBMED:11096116). Length = 343 Score = 24.4 bits (53), Expect = 7.3 Identities = 8/25 (32%), Positives = 17/25 (68%) Query: 60 IEQDYQVEGDLRRTVAMNIKRLMDL 84 +E+ Y+V G +RR+ + N +R+ + Sbjct: 21 LEKGYEVHGLIRRSSSFNTQRIEHI 45 >gnl|CDD|178551 PLN02967, PLN02967, kinase. Length = 581 Score = 24.6 bits (53), Expect = 7.4 Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 33 ICNKLAIPPERRVHQLVESEVIQIRQAIEQDYQ 65 + PP+ + VE + IR E++Y+ Sbjct: 529 LARTRGFPPKEDMEDEVEPDPNGIRSITEKEYR 561 >gnl|CDD|171521 PRK12467, PRK12467, peptide synthase; Provisional. Length = 3956 Score = 24.4 bits (53), Expect = 7.8 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 31 QDICNKLAIPP-ERRVHQLVESEVIQIRQAI 60 A P ER VHQL+E++V + +A Sbjct: 3082 HAWNATAAAYPSERLVHQLIEAQVARTPEAP 3112 Score = 24.0 bits (52), Expect = 9.4 Identities = 8/21 (38%), Positives = 12/21 (57%) Query: 40 PPERRVHQLVESEVIQIRQAI 60 P R VHQL+E + +A+ Sbjct: 1571 PLARLVHQLIEDQAAATPEAV 1591 >gnl|CDD|178741 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional. Length = 2102 Score = 24.3 bits (53), Expect = 8.6 Identities = 7/24 (29%), Positives = 15/24 (62%) Query: 97 PVRGQRTHTNARTRKKFGKGGVAR 120 P +GQ+ H + +++ FGK + + Sbjct: 2037 PPKGQKLHISCKSKNTFGKSSLGK 2060 >gnl|CDD|181885 PRK09470, cpxA, two-component sensor protein; Provisional. Length = 461 Score = 24.1 bits (53), Expect = 9.4 Identities = 12/42 (28%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Query: 43 RRVHQLVESEVIQ---IRQAIEQDYQVEGDLRRTVAMNIKRL 81 R++ +L++SE Q I Q IE + + M +RL Sbjct: 37 RQMTELLDSEQRQGLMIEQHIEAELANDPPNDL---MWWRRL 75 >gnl|CDD|182616 PRK10647, PRK10647, ferric iron reductase involved in ferric hydroximate transport; Provisional. Length = 262 Score = 23.9 bits (52), Expect = 9.7 Identities = 10/36 (27%), Positives = 19/36 (52%) Query: 35 NKLAIPPERRVHQLVESEVIQIRQAIEQDYQVEGDL 70 N + P+ R+ L+ +I + QA+E ++ G L Sbjct: 147 NATPLSPQERMETLISQALIPVVQALEATGEINGKL 182 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.141 0.416 Gapped Lambda K H 0.267 0.0836 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,044,759 Number of extensions: 119827 Number of successful extensions: 365 Number of sequences better than 10.0: 1 Number of HSP's gapped: 362 Number of HSP's successfully gapped: 32 Length of query: 122 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 40 Effective length of database: 4,222,617 Effective search space: 168904680 Effective search space used: 168904680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.2 bits)