BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780239|ref|YP_003064652.1| 30S ribosomal protein S13 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780239|ref|YP_003064652.1| 30S ribosomal protein S13 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 247 bits (630), Expect = 5e-68, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%) Query: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI Sbjct: 1 MARIAGVNIPRAKRVVRALCYIHGIGFKSSQDICNKLAIPPERRVHQLVESEVIQIRQAI 60 Query: 61 EQDYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKKFGKGGVAR 120 EQDYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKKFGKGGVAR Sbjct: 61 EQDYQVEGDLRRTVAMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKKFGKGGVAR 120 Query: 121 KR 122 KR Sbjct: 121 KR 122 >gi|254780598|ref|YP_003065011.1| outer membrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 23.5 bits (49), Expect = 1.2, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Query: 64 YQVEGDLRRTV---AMNIKRLMDLGCYRGLRHRRGLPVR 99 Y VEGD+R TV A NI L +G LR R G V Sbjct: 93 YGVEGDVRYTVPVLADNIHSLHGIG--GSLRIRGGYEVS 129 >gi|255764496|ref|YP_003065012.2| excinuclease ABC subunit C [Candidatus Liberibacter asiaticus str. psy62] Length = 616 Score = 22.3 bits (46), Expect = 3.0, Method: Composition-based stats. Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 30 SQDICNKLAIPPERRVHQLVESE 52 +QD C + + ERR QL+++E Sbjct: 424 TQDDCAMMRMVLERRFSQLIKNE 446 >gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 1386 Score = 22.3 bits (46), Expect = 3.0, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 105 TNARTRKKFGKGGVARKR 122 T+ R G+GGVAR R Sbjct: 536 THTRRLSALGQGGVARAR 553 >gi|254780351|ref|YP_003064764.1| MarR family transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 21.9 bits (45), Expect = 4.0, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 70 LRRTVAMNIKRLMDLGCYRGLRHR 93 L V+ N+K+L+DLG + R R Sbjct: 83 LGSNVSYNLKKLIDLGFIKHQRSR 106 >gi|254781100|ref|YP_003065513.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus Liberibacter asiaticus str. psy62] Length = 366 Score = 21.6 bits (44), Expect = 4.2, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 15/33 (45%) Query: 86 CYRGLRHRRGLPVRGQRTHTNARTRKKFGKGGV 118 C R L+ RG PVR +AR GG+ Sbjct: 46 CLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGI 78 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.141 0.416 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,256 Number of Sequences: 1233 Number of extensions: 2229 Number of successful extensions: 8 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 7 length of query: 122 length of database: 328,796 effective HSP length: 64 effective length of query: 58 effective length of database: 249,884 effective search space: 14493272 effective search space used: 14493272 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 33 (17.3 bits)