>TIGR01351 adk adenylate kinases; InterPro: IPR006259 Most members of this family are known or believed to be adenylate kinase. Adenylate kinase (ADK) 2.7.4.3 from EC converts ATP + AMP to ADP + ADP, that is, it uses ATP as a phosphate donor for AMP. Two ADK isozymes have been identified in mammalian cells. These specifically bind AMP and favour binding to ATP over other nucleotide triphosphates (AK1 is cytosolic and AK2 is located in the mitochondria). However, some members accept other nucleotide triphosphates as donors, and may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (2.7.4.10 from EC) is Q9UIJ7 from SWISSPROT, a GTP:AMP phosphotransferase that has been identified in bovine heart and human cells and derived from mitrochondrail GTP AMP that is specific for the phosphorylation of AMP, but can only use GTP or ITP as a substrate .This family is designated subfamily rather than equivalog for this reason. ADK has also been identified in different bacterial species and in yeast . Two further enzymes are known to be related to the ADK family, i.e. yeast uridine monophosphokinase and slime mold UMP-CMP kinase. Within the ADK family there are several conserved regions, including the ATP-binding domains. One of the most conserved areas includes an Arg residue, whose modification inactivates the enzyme, together with an Asp that resides in the catalytic cleft of the enzyme and participates in a salt bridge. ; GO: 0005524 ATP binding, 0016776 phosphotransferase activity phosphate group as acceptor, 0019201 nucleotide kinase activity, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.

Probab=100.00 E-value=0 Score=435.55 Aligned_cols=191 Identities=49% Similarity=0.778 Sum_probs=180.1 Q ss_pred EEEEECCCCCCHHHHHHHHHHHHCCCEECHHHHHHHHHHHHHHHHHHHHH--HHHCCCCCCCHHHHHHHHHHHCC-CCC- Q ss_conf 69998788999678999999971894895789999999600145666677--64134455410356655542023-222- Q gi|254780240|r 2 RIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKG--SMESGSLISDAIVNQVVCDRIRL-PDC- 77 (201) Q Consensus 2 ~I~i~G~PGsGK~T~a~~la~~~~~~~is~gdllR~~~~~~s~~g~~i~~--~l~~G~lvpd~ii~~li~~~l~~-~~~- 77 (201) T Consensus 1 ~~~~lGpPGsGKGTQa~~i~~~~gl~HISTGDllR~~~~~~T~LG~~~k~y~y~~~G~LVPD~~v~~lv~~rl~~~~~~~ 80 (232) T TIGR01351 1 RLILLGPPGSGKGTQAKRIAEKLGLPHISTGDLLRAAVKAGTPLGKKAKEYNYMDKGELVPDEIVNQLVKERLQQNPDCV 80 (232) T ss_pred CEEEECCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCE T ss_conf 94675598987667999999860885020258999998707977898732672003775778999999999974560001 Q ss_pred ----CCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH-HHHHHHHHHHCCCCCCC------------------ Q ss_conf ----5317863801112457888766653125222103555422-12566423311232333------------------ Q gi|254780240|r 78 ----DSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVED-ASMFKRIQVRVLEAIAS------------------ 134 (201) Q Consensus 78 ----~~g~ilDGFPRt~~Qa~~l~~~l~~~~~~~~~vi~L~~~~-~~~~~R~~~R~~~~~~~------------------ 134 (201) T Consensus 81 ~~~~~~GfILDGfPRT~~QAeaL~~~l~~~g~~~d~V~~L~vp~~e~l~~R~~gR~~cp~cG~~Yh~~f~pPk~~gG~~~ 160 (232) T TIGR01351 81 SLKSENGFILDGFPRTLSQAEALDAMLKELGLPIDAVIELDVPDLEELVERITGRRICPSCGRVYHIKFNPPKVPGGENL 160 (232) T ss_pred EEEECCCEEECCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCCCC T ss_conf 10106862663888878999999999986189841788853587999999773273306778556102278867876798 Q ss_pred ------CCC-CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEE-------ECCCCCHHHHHHHHHHHHH Q ss_conf ------455-656789899999999999975699999996797999-------9389988999999999999 Q gi|254780240|r 135 ------EKS-VRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYI-------IDGMLDMDEVSRSIDSLLV 192 (201) Q Consensus 135 ------~~~-~R~DD~~e~i~~Rl~~y~~~~~pv~~~y~~~~~l~~-------Idg~~~~~eV~~~I~~~l~ 192 (201) T Consensus 161 cD~~~~~~l~qR~DD~~evv~~RL~~Y~~~t~Pli~yY~~~g~l~~f~~~y~~id~~~~~~~v~~~~~~~l~ 232 (232) T TIGR01351 161 CDDCGGELLIQREDDTEEVVKKRLEVYKEQTEPLIDYYRKKGILVTFEGIYQTIDGNGPIDEVWKRILEALK 232 (232) T ss_pred CCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCHHHHHHHHCCEEEECCCCEEECCCCCCHHHHHHHHHHHHC T ss_conf 864457502770699889999999998885200899998469136568632200378888889999999729

HHsearch alignment for GI: 254780240 and conserved domain: TIGR01351