BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780240|ref|YP_003064653.1| adenylate kinase [Candidatus Liberibacter asiaticus str. psy62] (201 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780240|ref|YP_003064653.1| adenylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 405 bits (1040), Expect = e-115, Method: Compositional matrix adjust. Identities = 201/201 (100%), Positives = 201/201 (100%) Query: 1 MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60 MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS Sbjct: 1 MRIIFLGPPGSGKGTQACRLSQKLNVPQLSTGDMLRAEVDRNTLLGKQVKGSMESGSLIS 60 Query: 61 DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120 DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM Sbjct: 61 DAIVNQVVCDRIRLPDCDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASM 120 Query: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM Sbjct: 121 FKRIQVRVLEAIASEKSVRSDDKYDVFLKRIENYRKTILPLSSYYRDMGCLYIIDGMLDM 180 Query: 181 DEVSRSIDSLLVSVRKKCSSS 201 DEVSRSIDSLLVSVRKKCSSS Sbjct: 181 DEVSRSIDSLLVSVRKKCSSS 201 >gi|254780552|ref|YP_003064965.1| Holliday junction DNA helicase RuvB [Candidatus Liberibacter asiaticus str. psy62] Length = 334 Score = 28.5 bits (62), Expect = 0.078, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 20/30 (66%) Query: 2 RIIFLGPPGSGKGTQACRLSQKLNVPQLST 31 ++F+GPPG GK T A ++++L V ST Sbjct: 56 HVLFVGPPGLGKTTLAQVVARELGVNFRST 85 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 27.3 bits (59), Expect = 0.18, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 17/25 (68%) Query: 3 IIFLGPPGSGKGTQACRLSQKLNVP 27 ++ +GPPG+GK A ++ + NVP Sbjct: 184 VLLVGPPGTGKTLLARAVAGEANVP 208 >gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 24.3 bits (51), Expect = 1.5, Method: Compositional matrix adjust. Identities = 9/14 (64%), Positives = 11/14 (78%) Query: 2 RIIFLGPPGSGKGT 15 RI+ LGP G+GK T Sbjct: 27 RIVILGPSGAGKST 40 >gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Score = 23.9 bits (50), Expect = 2.1, Method: Compositional matrix adjust. Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 2 RIIFLGPPGSGKGT 15 R+I GP GSGK T Sbjct: 45 RVIIAGPSGSGKST 58 >gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Score = 23.5 bits (49), Expect = 2.4, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 3 IIFLGPPGSGKGTQACRLSQKLNVPQLSTGDML 35 + +GP GSGK T + LS + +++ GD+L Sbjct: 32 VAIMGPNGSGKSTLSYLLSGHKDY-EITAGDIL 63 >gi|254780532|ref|YP_003064945.1| aminodeoxychorismate lyase [Candidatus Liberibacter asiaticus str. psy62] Length = 325 Score = 23.5 bits (49), Expect = 2.5, Method: Compositional matrix adjust. Identities = 17/82 (20%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Query: 77 CDSGFILDGYPRTVDQAKSLHAFISNMDCAIDAVIELRVEDASMFKRIQVRVLEAIASEK 136 C S + +P +++ L+ + +D V E+R D + + + +L +I ++ Sbjct: 144 CPSTY---NFPLGTHRSEILNQAMLKQKQVVDEVWEIRDVDHPIKSKEDLVILASIVEKE 200 Query: 137 SVRSDDKYDVFLKRIENYRKTI 158 + R+D++ V I + K+I Sbjct: 201 TSRADERAHVASVFINRFSKSI 222 >gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 3 IIFLGPPGSGKGTQACRLSQKLNVP 27 I+ +GP G GK A L++ ++VP Sbjct: 116 ILLVGPTGCGKTYLAQTLARIIDVP 140 >gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 23.1 bits (48), Expect = 3.8, Method: Compositional matrix adjust. Identities = 8/31 (25%), Positives = 18/31 (58%) Query: 100 ISNMDCAIDAVIELRVEDASMFKRIQVRVLE 130 + N ID ++E+ ++ AS+F ++ R+ Sbjct: 116 LGNNKADIDQIVEMSLKKASLFNEVKDRLFH 146 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.137 0.386 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 119,838 Number of Sequences: 1233 Number of extensions: 4526 Number of successful extensions: 25 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 11 length of query: 201 length of database: 328,796 effective HSP length: 70 effective length of query: 131 effective length of database: 242,486 effective search space: 31765666 effective search space used: 31765666 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)