HHsearch alignment of GI: 254780241 and MMDB domain: 3din_C_1-183

>3din_C (C:1-183) Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8}
Probab=100.00  E-value=0  Score=348.75  Aligned_cols=172  Identities=41%  Similarity=0.794  Sum_probs=161.0

Q ss_pred             CHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHC-----CCCHHHHHHHHCCCCHHHHHHHHHCCH
Q ss_conf             889883587889999999999999985067989873988999987303-----553788998642770222046873547
Q gi|254780241|r   13 NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK-----SAGIFGLFNMFSGGAVERMAVFSLGIM   87 (444)
Q Consensus        13 ~~~~~~~~~el~~Kil~Tl~il~iyrlg~~IPlPGid~~~~~~~~~~~-----~~~~~~~l~~~sGga~~~~sif~LGI~   87 (444)
                      .+++.||++|+|+|++||++++++||+|++||+||+|.+++.+.++++     +++++++++.++|||++|+|+|+|||+
T Consensus         4 ~~~~~~~~~~l~~Kil~Tl~il~iyr~g~~IplpGv~~~~~~~~~~~~~~~~~~~~~~~~~~~~sGga~~~~sif~LGI~   83 (183)
T 3din_C            4 AFKNAFKIPELRDRIIFTFLALIVFRMGIYIPVPGLNLEAWGEIFRRIAETAGVAGILSFYDVFTGGALSRFSVFTMSVT   83 (183)
T ss_dssp             ----CCSCSCCSSHHHHHHHHHHHHHHHHSCSSCCCCC--------------------CTTHHHHCSSSSCCCSSSSSHH
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHCCHHHHHHH
T ss_conf             89999757899999999999999999725288998598999999997540244201888998751422420509986348


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC---CCCCCCCCCHHHHHHHHH
Q ss_conf             89999999999985215478641146368999998869999999999999999723556---762258750479999999
Q gi|254780241|r   88 PYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNG---QGIVSDSDYFFVFSTIIT  164 (444)
Q Consensus        88 PyItASIi~QLL~~~~P~l~~l~kege~gr~ki~~~tr~ltl~~a~iQs~~~~~~l~~~---~~~~~~~~~~~~~~~il~  164 (444)
                      |||||||+||+|+..+|+++|+|||||+||+|+|++|||+|+++|++||++++.++++.   .+...+++..+++.++++
T Consensus        84 P~ItAsIi~QlL~~~~p~l~~l~~~~~~gr~k~~~~tr~ltl~~a~iQa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (183)
T 3din_C           84 PYITASIILQLLASVMPSLKEMLREGEEGRKKFAKYTRRLTLLIGGFQAFFVSFSLARSNPDMVAPGVNVLQFTVLSTMS  163 (183)
T ss_dssp             HHHHHHHHHHHHHHHSCSSSSCSCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSCCCCCCCSSHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             99999999999985214343113446466899999999999999999999999998606987446657416899999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCC
Q ss_conf             99999999999998740889
Q gi|254780241|r  165 LLGGTMFLVWLGEQITMRGI  184 (444)
Q Consensus       165 L~aGs~il~wl~e~It~~GI  184 (444)
                      |++||++++|+||+||||||
T Consensus       164 lv~Gs~il~wL~e~It~~GI  183 (183)
T 3din_C          164 MLAGTMFLLWLGERITEKGI  183 (183)
T ss_dssp             HHHHHHHHHHHHHHHTTTTC
T ss_pred             HHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999888742