HHsearch results for GI: 254780241 and protein with PDBid: 3din_C

>3din_C Preprotein translocase subunit SECY; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8}
Probab=100.00  E-value=0  Score=868.25  Aligned_cols=421  Identities=37%  Similarity=0.745  Sum_probs=385.5

Q ss_pred             CCHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHH-----CCCCHHHHHHHHCCCCHHHHHHHHHCC
Q ss_conf             588988358788999999999999998506798987398899998730-----355378899864277022204687354
Q gi|254780241|r   12 LNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQS-----KSAGIFGLFNMFSGGAVERMAVFSLGI   86 (444)
Q Consensus        12 ~~~~~~~~~~el~~Kil~Tl~il~iyrlg~~IPlPGid~~~~~~~~~~-----~~~~~~~~l~~~sGga~~~~sif~LGI   86 (444)
                      .+|+|+||+||||||++||+++|++||+|++||+||+|++++.+.+++     +++++++++|+|+|||++|+|+|+|||
T Consensus         3 ~~~~~~~k~~eLr~ri~~Tl~iL~iyr~g~~IPlpGid~~~~~~~~~~~~~~~~~~~ll~~~~~fsGGa~~~~Sif~LGI   82 (431)
T 3din_C            3 QAFKNAFKIPELRDRIIFTFLALIVFRMGIYIPVPGLNLEAWGEIFRRIAETAGVAGILSFYDVFTGGALSRFSVFTMSV   82 (431)
T ss_dssp             -----CCSCSCCSSHHHHHHHHHHHHHHHHSCSSCCCCC--------------------CTTHHHHCSSSSCCCSSSSSH
T ss_pred             HHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHCHHHHHCH
T ss_conf             88999976788999999999999999973348999869899999999865124420288999986033341050988455


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC---CCCCCCCHHHHHHHH
Q ss_conf             78999999999998521547864114636899999886999999999999999972355676---225875047999999
Q gi|254780241|r   87 MPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQG---IVSDSDYFFVFSTII  163 (444)
Q Consensus        87 ~PyItASIi~QLL~~~~P~l~~l~kege~gr~ki~~~tr~ltl~~a~iQs~~~~~~l~~~~~---~~~~~~~~~~~~~il  163 (444)
                      +|||||||+||||++.+|.++|+|||||+||||++++||++|+++|++||++++.++.+...   ...++...+.+.+++
T Consensus        83 ~PyItAsII~QLL~~~~p~l~~~~~ege~gr~k~~~~tr~lti~la~iqs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (431)
T 3din_C           83 TPYITASIILQLLASVMPSLKEMLREGEEGRKKFAKYTRRLTLLIGGFQAFFVSFSLARSNPDMVAPGVNVLQFTVLSTM  162 (431)
T ss_dssp             HHHHHHHHHHHHHHHHSCSSSSCSCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSCCCCCCCSSHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             89999999999999755508874000265689999999999999999999999999861688512678615899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999874088987520362101465767887433332001232158999999999999999998865332
Q gi|254780241|r  164 TLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQR  243 (444)
Q Consensus       164 ~L~aGs~il~wl~e~It~~GIGnG~SLiI~~gIi~~lp~~l~~~~~~~~~~~~~~~~~l~~~~~~l~vi~~iV~v~~~~r  243 (444)
                      +|++||+++||+||+|||||+|||+|++|++||++++|+.+.+.+.    +..........+...++++.++|++++++|
T Consensus       163 ~L~~Gt~~l~Wl~e~it~~GiGnGiSliI~~gI~~~lp~~~~~~~~----~~~~~~~~~~~~~~~l~~i~~~V~v~~~~r  238 (431)
T 3din_C          163 SMLAGTMFLLWLGERITEKGIGNGISILIFAGIVARYPSYIRQAYL----GGLNLLEWIFLIAVALITIFGIILVQQAER  238 (431)
T ss_dssp             HHHHHHHHHHHHHHHHTTTTCTTHHHHHHHHHHHHHSTTSSSCCSS----CCSCTHHHHHHHHHHHHHHHHHTTTCCBCC
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHEE
T ss_conf             9999999999998787664317784034357676543599986431----000179999999999999999998764104


Q ss_pred             HHHHCCCHHHCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             32101101211664235643114442000023799999999986888887507777247999887530667631699999
Q gi|254780241|r  244 RLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYS  323 (444)
Q Consensus       244 rIPi~y~~~~~~~~~~~~~~sylPiKin~aGvmPiIfassll~~p~~i~~~~~~~~~~~~~~~~~~~~~~~~~~y~i~y~  323 (444)
                      |||+||+++.++++.++++++|+|+|+|||||||+||||+++++|++++++++....       .+.++++.++|.++|+
T Consensus       239 ripi~~~~~~~~~~~~~~~~~ylPiKln~aGvmPiIfassll~~p~~i~~~~~~~~~-------~~~~~~~~~~y~~~~~  311 (431)
T 3din_C          239 RITIQYARRVTGRRVYGGASTYLPIKVNQGGVIPIIFASAIVSIPSAIASITNNETL-------KNLFRAGGFLYLLIYG  311 (431)
T ss_dssp             CCCCCBTTTBCCCCCCCCCCCCCCCCCCCCCSSHHHHHHHHHHHHHHHTTSSTTCCC-------CCCSSTTHHHHHHHHH
T ss_pred             EEEEEEHHHHCCCCCCCCCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHCCCCC-------CCCCCCCCCHHHHHHH
T ss_conf             898775233325554588775054223142237999999999889999987166332-------3303688735599999


Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH
Q ss_conf             99999999998623798999999996388447627985799999999999999999999999999999999848841002
Q gi|254780241|r  324 VFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLS  403 (444)
Q Consensus       324 ilii~Fs~f~~~i~~~P~~iAe~L~k~g~~IpGiRPG~~T~~yL~~v~~rit~~Ga~~l~~la~~p~~~~~~~~~~~~~g  403 (444)
                      +++++|+|||+.+++||||+||||+|+|++|||+||||+|++||+|+++|+|++||+|++++|++|++++...+.+..+|
T Consensus       312 ~lii~fs~f~~~i~~~p~~iAe~L~k~G~~IpGiRpG~~T~~yL~~~i~rlt~~Gsi~l~~ia~lp~l~~~~~~~~~~~g  391 (431)
T 3din_C          312 LLVFFFTYFYSVVIFDPREISENIRKYGGYIPGLRPGRSTEQYLHRVLNRVTFIGAVFLVVIALLPYLVQGAIKVNVWIG  391 (431)
T ss_dssp             HHHHHHHHHHHTCTTHHHHHTTSCCCCBCSSCCCCCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSCCSCCTT
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99999999999976688999999998698657939986789999999999999989999999999999998548872444


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             5799999999999999999999998526564311016777
Q gi|254780241|r  404 GTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKN  443 (444)
Q Consensus       404 GTslLI~Vgv~l~~~~qi~a~~~~~~Y~~~~~~~~~~~~~  443 (444)
                      |||+||+|||++||+||+|||+.|||||+++||+|.|+|.
T Consensus       392 GTslLI~VgV~~~~~~qi~~~~~~~~Y~~~l~~~~~~~r~  431 (431)
T 3din_C          392 GTSALIAVGVALDIIQQMETHMVMRHYEGFIKKGKIRGRR  431 (431)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHCCCCCSSTTCC--------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             5778747999999999999999999878887535666799