BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780241|ref|YP_003064654.1| preprotein translocase subunit
SecY [Candidatus Liberibacter asiaticus str. psy62]
         (444 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780241|ref|YP_003064654.1| preprotein translocase subunit SecY [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039918|gb|ACT56714.1| preprotein translocase subunit SecY [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 444

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/444 (100%), Positives = 444/444 (100%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK
Sbjct: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI
Sbjct: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT
Sbjct: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
           MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER
Sbjct: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG
Sbjct: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ
Sbjct: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           IQGYLIAQQYEGVFKKSRSKKKNS
Sbjct: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444


>gi|315122798|ref|YP_004063287.1| preprotein translocase subunit SecY [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496200|gb|ADR52799.1| preprotein translocase subunit SecY [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 445

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/444 (81%), Positives = 411/444 (92%), Gaps = 2/444 (0%)

Query: 3   SAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSA 62
           SAVEQFVSNL+ +SFS+AKDLKSRIVFT+IA++VYR GT+IPLPSID ++Y+KAFQSKSA
Sbjct: 2   SAVEQFVSNLSISSFSKAKDLKSRIVFTLIAIVVYRLGTHIPLPSIDLVAYTKAFQSKSA 61

Query: 63  GIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQ 122
           GIFG+FNMFSGGAVERMAVF+LGIMPYISASIIVQLI A VPSLE+LK+EGEQGRK+INQ
Sbjct: 62  GIFGIFNMFSGGAVERMAVFALGIMPYISASIIVQLIVAMVPSLESLKQEGEQGRKIINQ 121

Query: 123 YTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMR 182
           YTRYATV LGI+QAYGIA+GLKNG+GIVSDSD FFVFST++TLLGGTMFLVWLGEQIT R
Sbjct: 122 YTRYATVFLGIIQAYGIAIGLKNGRGIVSDSDSFFVFSTVVTLLGGTMFLVWLGEQITSR 181

Query: 183 GIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQ 242
           GIGNG+SLIIFSGIVAGLPS+ + VLELGRVGSI+TPL+LL+F S + VIA V+FFERAQ
Sbjct: 182 GIGNGISLIIFSGIVAGLPSAFIGVLELGRVGSIATPLILLVFVSIILVIAFVVFFERAQ 241

Query: 243 RRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT 302
           RRLLIQYPKRQVGNR+F DDVSYLPLKLNTAGVVPSIFASSLLLLPATI+GF+DVSSSP 
Sbjct: 242 RRLLIQYPKRQVGNRIFPDDVSYLPLKLNTAGVVPSIFASSLLLLPATIVGFVDVSSSPE 301

Query: 303 WIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDR 362
           W++ LV +LGHG+  YMVLY+  IVFF+FFYTAIVFNP EAA+NLKK GGF+PGIRPGDR
Sbjct: 302 WVINLVGALGHGQLLYMVLYAASIVFFSFFYTAIVFNPIEAANNLKKQGGFLPGIRPGDR 361

Query: 363 TALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQ 422
           TA HIDYVLTRVTVVGA YLV VCI PE L++VTG+PVSLSGTS+LIIVSVVLDT++Q+Q
Sbjct: 362 TAEHIDYVLTRVTVVGALYLVFVCILPEILVSVTGIPVSLSGTSILIIVSVVLDTVMQVQ 421

Query: 423 GYLIAQQYEGVFKKS--RSKKKNS 444
           GYLIAQQYEG+ KKS  R++KK S
Sbjct: 422 GYLIAQQYEGLVKKSKLRNRKKGS 445


>gi|222148386|ref|YP_002549343.1| preprotein translocase subunit SecY [Agrobacterium vitis S4]
 gi|221735374|gb|ACM36337.1| Preprotein translocase SECY subunit [Agrobacterium vitis S4]
          Length = 446

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/438 (71%), Positives = 373/438 (85%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK RI FT+ AL+VYR GT+IPLP ++  +Y+ AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRIWFTLAALLVYRLGTHIPLPGLNPEAYAAAFKGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI GLFNMFSGGAV+RMA+F+LGIMPYISASIIVQL+ + VPSLENLKKEGEQGRK+I
Sbjct: 61  SGGILGLFNMFSGGAVQRMAIFALGIMPYISASIIVQLMTSVVPSLENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG LQAYGIAVGL++G G+V+D   FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLGTLQAYGIAVGLEHGNGLVTDPGLFFRLSTVVTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP++L   LELGR G++ST L+L +    + VIAL++FFER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPTALAGTLELGRTGALSTALILTVILVAIGVIALIVFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPAT  GF   S+ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATAAGFTGGSTL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++ +LGHG+  YMVLY++ I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PAWATTIISALGHGQPAYMVLYALLIGFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV VCI PE L++ TGVP+SL GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYLVFVCILPEILVSQTGVPLSLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           +QG+LIAQQYEG+ KKS+
Sbjct: 421 VQGHLIAQQYEGLIKKSK 438


>gi|150396227|ref|YP_001326694.1| preprotein translocase subunit SecY [Sinorhizobium medicae WSM419]
 gi|150027742|gb|ABR59859.1| preprotein translocase, SecY subunit [Sinorhizobium medicae WSM419]
          Length = 446

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/440 (71%), Positives = 373/440 (84%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GTYIPLP ++  ++++AFQ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLGALLVYRLGTYIPLPGLNPDAFAQAFQGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           SAGI GLFNMFSGGAVERMA+F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRKVI
Sbjct: 61  SAGILGLFNMFSGGAVERMAIFALGIMPYISASIIVQLMTSVVPALEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG +QAYGIAVGL++G G+V+D  +FF  ST+I+LLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLGAMQAYGIAVGLESGSGLVNDPGWFFRISTVISLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LPS+L   LELGR G++STPL+L I    VAVIAL++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAALPSALAGTLELGRTGALSTPLILAIIVMVVAVIALIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPAT+ GF + ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATLAGFANSATM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V +L HG+  YM LY   I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PGWATTIVGALAHGQPLYMFLYGAMIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YL+ VCI PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYLIFVCILPEILISQTGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQG+LIAQQYEG+ KKS+ +
Sbjct: 421 IQGHLIAQQYEGLIKKSKLR 440


>gi|15965129|ref|NP_385482.1| preprotein translocase subunit SecY [Sinorhizobium meliloti 1021]
 gi|307314379|ref|ZP_07593985.1| preprotein translocase, SecY subunit [Sinorhizobium meliloti
           BL225C]
 gi|307322091|ref|ZP_07601467.1| preprotein translocase, SecY subunit [Sinorhizobium meliloti AK83]
 gi|15074309|emb|CAC45955.1| Preprotein translocase subunit SecY [Sinorhizobium meliloti 1021]
 gi|306892273|gb|EFN23083.1| preprotein translocase, SecY subunit [Sinorhizobium meliloti AK83]
 gi|306899077|gb|EFN29719.1| preprotein translocase, SecY subunit [Sinorhizobium meliloti
           BL225C]
          Length = 446

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/440 (70%), Positives = 372/440 (84%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GTYIPLP ++  ++++AFQ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLGALLVYRLGTYIPLPGLNPDAFAQAFQGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI GLFNMFSGGAVERMA+F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRKVI
Sbjct: 61  SGGILGLFNMFSGGAVERMAIFALGIMPYISASIIVQLMTSVVPALEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG +QAYGIAVGL++G G+V+D  +FF  ST+I+LLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLGAMQAYGIAVGLESGSGLVNDPGWFFRISTVISLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LPS+L   LELGR G++STPL+L I    V VIAL++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAALPSALAGTLELGRTGALSTPLILAIIVMVVGVIALIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPAT+ GF + ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATLAGFANTATM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V +L HG+  YM+LY   I FFAFFYTAIVFNPK+ ADNLKKHGGF+PGIRPG
Sbjct: 301 PGWATAIVGALAHGQPLYMILYGAMIAFFAFFYTAIVFNPKDTADNLKKHGGFVPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TV+GA YLV VCI PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVIGAIYLVFVCILPEILISQTGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQG+LIAQQYEG+ KKS+ +
Sbjct: 421 IQGHLIAQQYEGLIKKSKLR 440


>gi|227821775|ref|YP_002825745.1| preprotein translocase subunit SecY [Sinorhizobium fredii NGR234]
 gi|227340774|gb|ACP24992.1| secretion protein SecY [Sinorhizobium fredii NGR234]
          Length = 446

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/440 (70%), Positives = 372/440 (84%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GTYIPLP ++  ++++AFQ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLGALLVYRLGTYIPLPGLNPAAFAQAFQGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMFSGGAVERMA+F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRKVI
Sbjct: 61  AGGILGLFNMFSGGAVERMAIFALGIMPYISASIIVQLMTSVVPALEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG LQAYGIAVGL++G G+V+D  +FF  ST+I+LLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLGALQAYGIAVGLESGNGLVNDPGWFFRISTVISLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LP++L   LELGR G++STPL+L I    VAVIAL++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAHLPTALAGTLELGRTGALSTPLILAIIIMVVAVIALIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPAT+ GF + ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATLAGFANAATL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V +L HG+  YM+ Y   I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PGWATTIVGALAHGQPLYMLFYGAMIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TV+GA YL+ VCI PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVIGAIYLIFVCILPEILISQTGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQG+LIAQQYEG+ KKS+ +
Sbjct: 421 IQGHLIAQQYEGLIKKSKLR 440


>gi|159184982|ref|NP_354903.2| preprotein translocase subunit SecY [Agrobacterium tumefaciens str.
           C58]
 gi|159140258|gb|AAK87688.2| Preprotein translocase SECY subunit [Agrobacterium tumefaciens str.
           C58]
          Length = 446

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/440 (70%), Positives = 370/440 (84%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMF+GGAVERMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  ANGILGLFNMFAGGAVERMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG LQAYGIAVGL++G G+V D   FF  ST+ITLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLGTLQAYGIAVGLESGNGLVVDPGMFFRVSTVITLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP +L   LELGR G++STPL+L++    + VIAL++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPKALAGTLELGRTGALSTPLILMVVIVAIGVIALIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P+IFASSLLLLPAT  GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPAIFASSLLLLPATAAGFAGNTNL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           PTW   ++ SL HG+  +M LY + I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PTWATSIIASLQHGQPLFMALYGLLIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV VCI PE LIA TG+P++L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYLVFVCILPETLIARTGIPLALGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQG+LIAQQYEG+ KKS+ +
Sbjct: 421 IQGHLIAQQYEGLIKKSKLR 440


>gi|325293316|ref|YP_004279180.1| Preprotein translocase subunit SecY [Agrobacterium sp. H13-3]
 gi|325061169|gb|ADY64860.1| Preprotein translocase subunit SecY [Agrobacterium sp. H13-3]
          Length = 446

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/440 (69%), Positives = 368/440 (83%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMF+GGAVERMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  ANGILGLFNMFAGGAVERMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG LQAYGIAVGL++G G+V D   FF  ST+ITLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLGTLQAYGIAVGLESGNGLVVDPGLFFRISTVITLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP +L   LELGR G++ST L+L++    + VIAL++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPKALAGTLELGRTGALSTTLILMVVIVAIGVIALIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P+IFASSLLLLPAT  GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPAIFASSLLLLPATAAGFAGNTNL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++ SL HG+  +M LY + I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PGWATSIIASLQHGQPLFMALYGLLIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV VCI PE LIA TG+P++L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAVYLVFVCILPETLIARTGIPLALGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQG+LIAQQYEG+ KKS+ +
Sbjct: 421 IQGHLIAQQYEGLIKKSKLR 440


>gi|190891375|ref|YP_001977917.1| protein-export translocase protein [Rhizobium etli CIAT 652]
 gi|190696654|gb|ACE90739.1| protein-export translocase protein [Rhizobium etli CIAT 652]
 gi|327189691|gb|EGE56838.1| protein-export translocase protein [Rhizobium etli CNPAF512]
          Length = 446

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/438 (69%), Positives = 374/438 (85%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMFSGGAV+RMA+F+LGIMPYISASIIVQL+ + VP+LENLKKEGEQGRK+I
Sbjct: 61  AGGILGLFNMFSGGAVQRMAIFALGIMPYISASIIVQLMTSVVPALENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+LG LQAYGIA GL++GQG+V D  +FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILGALQAYGIAAGLESGQGLVVDPGWFFRVSTVLTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP++L   LELGR G++STPL+LL+    + VI +++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPTALAGTLELGRTGALSTPLILLVIIVAIGVIGVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPATI GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATIAGFASTTAM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V +LGHGR  YMVLY+  I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PAWATSIVAALGHGRPLYMVLYAALIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+T++GA YLV VCI PE L++ TG+P+SL GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITLIGAIYLVFVCILPEILVSQTGIPLSLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+LIAQQYEG+ KKS+
Sbjct: 421 IQGHLIAQQYEGLIKKSK 438


>gi|218674115|ref|ZP_03523784.1| preprotein translocase subunit SecY [Rhizobium etli GR56]
          Length = 446

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/438 (70%), Positives = 373/438 (85%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMFSGGAVERMA+F+LGIMPYISASIIVQL+ + VP+LENLKKEGEQGRK+I
Sbjct: 61  AGGILGLFNMFSGGAVERMAIFALGIMPYISASIIVQLMTSVVPALENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+LG LQAYGIA GL++GQG+V +   FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILGALQAYGIAAGLESGQGLVVEPGLFFRVSTVLTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLPS+L   LELGR G++STPL+LL+    + VI +++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPSALAGTLELGRTGALSTPLILLVILVAIGVIGVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPATI GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATIAGFASTTAM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V +LGHG+  YMVLY+  I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PAWATSIVAALGHGQPLYMVLYAALIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TV+GA YLV VCI PE L++ TG+P+SL GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVIGAIYLVFVCILPEILVSQTGIPLSLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+LIAQQYEG+ KKS+
Sbjct: 421 IQGHLIAQQYEGLIKKSK 438


>gi|86357325|ref|YP_469217.1| preprotein translocase subunit SecY [Rhizobium etli CFN 42]
 gi|86281427|gb|ABC90490.1| protein-export translocase protein [Rhizobium etli CFN 42]
          Length = 446

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 305/438 (69%), Positives = 375/438 (85%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMFSGGAV+RMA+F+LGIMPYISASIIVQL+ + VP+LENLKKEGEQGRK+I
Sbjct: 61  AGGILGLFNMFSGGAVQRMAIFALGIMPYISASIIVQLMTSVVPTLENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+LG LQAYGIA GL++GQG+V D  +FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVVLGALQAYGIAAGLESGQGLVVDPGWFFRISTVLTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLPS+L   LELGR G++ST L+LL+    +AVI +++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPSALAGTLELGRTGALSTGLILLVIIVAIAVIGVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPAT+ GF + ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATVAGFANTTAM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V +LGHG+  YMVLY+  I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PAWATSIVAALGHGQPLYMVLYAALIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+T++GA YLV VCI PE L++ TG+P+SL GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITLIGAIYLVFVCILPEILVSQTGIPLSLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+LIAQQYEG+ KKS+
Sbjct: 421 IQGHLIAQQYEGLIKKSK 438


>gi|260468534|ref|ZP_05813701.1| preprotein translocase, SecY subunit [Mesorhizobium opportunistum
           WSM2075]
 gi|259028690|gb|EEW29999.1| preprotein translocase, SecY subunit [Mesorhizobium opportunistum
           WSM2075]
          Length = 446

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 309/444 (69%), Positives = 367/444 (82%), Gaps = 2/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK RI FTI AL+VYR GTYIPLP I+  ++++AF S+
Sbjct: 1   MASAAEQLASNLNFSAFAKAEDLKKRIWFTIGALLVYRLGTYIPLPGINPDAFAQAFSSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ G+FNMF+GGAV+RMA+F+LGIMPYISASII+QL+ + +PSLE LKKEGEQGRKVI
Sbjct: 61  SKGVLGMFNMFAGGAVQRMAIFALGIMPYISASIIMQLMTSVIPSLEALKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAYGI+VGL+NG GIVSD   FF  ST++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYGISVGLENGNGIVSDPGMFFRISTVVTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVAGLP ++   LELGR G++ST L+L I    + VIAL++FFER
Sbjct: 181 ARGIGNGISLIIFSGIVAGLPHAISGTLELGRTGALSTGLILAIIVLAIVVIALIVFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P IFASSLLLLPATI GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPPIFASSLLLLPATIAGFSQTTNM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++ SLGHG+  YM  Y+  IVFFAFFYTAIVFNPK+ AD LKKH GFIPG RPG
Sbjct: 301 PAWASTILASLGHGQPLYMAFYAAMIVFFAFFYTAIVFNPKDTADQLKKHSGFIPGYRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTADYIDYVLTRITVVGAIYLVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           IQG+LIA QYEG+ KKS  R  KK
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKK 444


>gi|13470571|ref|NP_102140.1| preprotein translocase subunit SecY [Mesorhizobium loti MAFF303099]
 gi|14021313|dbj|BAB47926.1| secretion protein; SecY [Mesorhizobium loti MAFF303099]
          Length = 446

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 308/444 (69%), Positives = 368/444 (82%), Gaps = 2/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK RI FTI AL+VYR GTYIPLP I+  ++++AF S+
Sbjct: 1   MASAAEQLASNLNFSAFAKAEDLKKRIWFTIGALLVYRLGTYIPLPGINPDAFAQAFSSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ G+FNMF+GGAV+RMA+F+LGIMPYISASII+QL+ + +PSLE+LKKEGEQGRKVI
Sbjct: 61  SKGVLGMFNMFAGGAVQRMAIFALGIMPYISASIIMQLMTSVIPSLESLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAYGI+VGL+NG GIV+D   FF  ST++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYGISVGLENGHGIVNDPGMFFRISTVVTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVAGLP ++   LELGR G++ST L+L I    + VIAL++FFER
Sbjct: 181 ARGIGNGISLIIFSGIVAGLPRAISGTLELGRTGALSTGLILAIIVLAIVVIALIVFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P IFASSLLLLPATI GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPPIFASSLLLLPATIAGFSQTTNM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++ SLGHG+  YM  Y+  IVFFAFFYTAIVFNPK+ AD LKKH GFIPG RPG
Sbjct: 301 PAWASTILASLGHGQPLYMAFYAAMIVFFAFFYTAIVFNPKDTADQLKKHSGFIPGYRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTADYIDYVLTRITVVGAIYLVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           IQG+LIA QYEG+ KKS  R  KK
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKK 444


>gi|241204185|ref|YP_002975281.1| preprotein translocase subunit SecY [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858075|gb|ACS55742.1| preprotein translocase, SecY subunit [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 446

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 304/438 (69%), Positives = 376/438 (85%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI GLFNMFSGGAV+RMA+F+LGIMPYISASIIVQL+ + VP+LENLKKEGEQGRK+I
Sbjct: 61  SGGILGLFNMFSGGAVQRMAIFALGIMPYISASIIVQLMTSVVPALENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+LG LQAYGIA GL++GQG+V ++ +FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILGALQAYGIAAGLESGQGLVVEAGWFFRVSTVLTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP++L   LELGR G++ST L+LL+    +AVI +++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPTALAGTLELGRTGALSTFLILLVIIVAIAVIGIIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPAT+ GF + S+ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATVAGFANTSAM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P+W+  +V +LGHG+  YM LY   I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PSWVTSIVAALGHGQPLYMALYGALIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TV+GA YLV VCI PE L++ TG+P++L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVIGALYLVFVCILPEILVSQTGIPLALGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+LIAQQYEG+ KKS+
Sbjct: 421 IQGHLIAQQYEGLIKKSK 438


>gi|209548955|ref|YP_002280872.1| preprotein translocase subunit SecY [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534711|gb|ACI54646.1| preprotein translocase, SecY subunit [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 446

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 304/438 (69%), Positives = 374/438 (85%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMFSGGAV+RMA+F+LGIMPYISASIIVQL+ + VP+LENLKKEGEQGRK+I
Sbjct: 61  AGGILGLFNMFSGGAVQRMAIFALGIMPYISASIIVQLMTSVVPALENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+LG LQAYGIA GL++GQG+V D   FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILGALQAYGIAAGLESGQGLVVDPGLFFRVSTVLTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP++L   LELGR G++ST L+LL+    + VI +++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPTALAGTLELGRTGALSTFLILLVIIVAIGVIGVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPAT+ GF + ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATLAGFANTTAM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P+W   +V +LGHG+  YMVLY+  I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PSWATSIVAALGHGQPLYMVLYAALIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TV+GA YLV VCI PE L++ TG+P+SL GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVIGAIYLVFVCILPEILVSQTGIPLSLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+LIAQQYEG+ KKS+
Sbjct: 421 IQGHLIAQQYEGLIKKSK 438


>gi|319783340|ref|YP_004142816.1| preprotein translocase, SecY subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169228|gb|ADV12766.1| preprotein translocase, SecY subunit [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 446

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 307/444 (69%), Positives = 367/444 (82%), Gaps = 2/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK RI FTI AL+VYR GTYIPLP I+  ++++AF S+
Sbjct: 1   MASAAEQLASNLNFSAFAKAEDLKKRIWFTIGALLVYRLGTYIPLPGINPDAFAQAFSSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ G+FNMF+GGAV+RMA+F+LGIMPYISASII+QL+ + +PSLE LKKEGEQGRKVI
Sbjct: 61  SKGVLGMFNMFAGGAVQRMAIFALGIMPYISASIIMQLMTSVIPSLEALKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAYGI+VGL+ G GIVSD   FF  ST++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYGISVGLEGGNGIVSDPGMFFRISTVVTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVAGLP ++   LELGR G++ST L+L I    + VIAL++FFER
Sbjct: 181 ARGIGNGISLIIFSGIVAGLPHAISGTLELGRTGALSTGLILAIIVLAIVVIALIVFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P IFASSLLLLPAT+ GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPPIFASSLLLLPATVAGFSQTTNL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++ SLGHG+  YM+ Y+  IVFFAFFYTAIVFNPK+ AD LKKH GFIPG RPG
Sbjct: 301 PAWASTVLASLGHGQPLYMLFYAAMIVFFAFFYTAIVFNPKDTADQLKKHSGFIPGYRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTADYIDYVLTRITVVGAIYLVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           IQG+LIA QYEG+ KKS  R  KK
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKK 444


>gi|116251560|ref|YP_767398.1| preprotein translocase subunit SecY [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115256208|emb|CAK07289.1| putative preprotein translocase SecY subunit [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 446

 Score =  627 bits (1616), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 309/438 (70%), Positives = 377/438 (86%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AF+ +
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLAALLVYRLGTHIPLPGLNPEAYAQAFRGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMFSGGAVERMA+F+LGIMPYISASIIVQL+ + VP+LENLKKEGEQGRK+I
Sbjct: 61  AGGILGLFNMFSGGAVERMAIFALGIMPYISASIIVQLMTSVVPALENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+LG LQAYGIA GL++GQG+V D  +FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILGALQAYGIAAGLESGQGLVVDPGWFFRVSTVLTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP++L   LELGR G++STPL+LL+    +AVIA+++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPTALAGTLELGRTGALSTPLILLVIIVAIAVIAIIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IFASSLLLLPATI GF   ++ 
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATIAGFASTTAM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P+W   +V +LGHG+  YMVLY+  I FFAFFYTAIVFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PSWATSIVAALGHGQPLYMVLYAALIAFFAFFYTAIVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           DRTA +IDYVLTR+TV+GA YLV VCI PE L++ TG+P++L GTSLLI+VSV LDT+ Q
Sbjct: 361 DRTAEYIDYVLTRITVIGALYLVFVCILPEILVSQTGIPLALGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+LIAQQYEG+ KKS+
Sbjct: 421 IQGHLIAQQYEGLIKKSK 438


>gi|17987060|ref|NP_539694.1| preprotein translocase subunit SecY [Brucella melitensis bv. 1 str.
           16M]
 gi|23502090|ref|NP_698217.1| preprotein translocase subunit SecY [Brucella suis 1330]
 gi|161619169|ref|YP_001593056.1| preprotein translocase subunit SecY [Brucella canis ATCC 23365]
 gi|225852710|ref|YP_002732943.1| preprotein translocase subunit SecY [Brucella melitensis ATCC
           23457]
 gi|254704498|ref|ZP_05166326.1| preprotein translocase subunit SecY [Brucella suis bv. 3 str. 686]
 gi|254706606|ref|ZP_05168434.1| preprotein translocase subunit SecY [Brucella pinnipedialis
           M163/99/10]
 gi|254714281|ref|ZP_05176092.1| preprotein translocase subunit SecY [Brucella ceti M644/93/1]
 gi|254717718|ref|ZP_05179529.1| preprotein translocase subunit SecY [Brucella ceti M13/05/1]
 gi|254719271|ref|ZP_05181082.1| preprotein translocase subunit SecY [Brucella sp. 83/13]
 gi|256044863|ref|ZP_05447767.1| preprotein translocase subunit SecY [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113767|ref|ZP_05454571.1| preprotein translocase subunit SecY [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263800|ref|ZP_05466332.1| C-5 cytosine-specific DNA methylase [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369637|ref|YP_003107147.1| preprotein translocase SecY [Brucella microti CCM 4915]
 gi|260168912|ref|ZP_05755723.1| preprotein translocase subunit SecY [Brucella sp. F5/99]
 gi|260565535|ref|ZP_05836019.1| C-5 cytosine-specific DNA methylase [Brucella melitensis bv. 1 str.
           16M]
 gi|260566258|ref|ZP_05836728.1| C-5 cytosine-specific DNA methylase [Brucella suis bv. 4 str. 40]
 gi|261219561|ref|ZP_05933842.1| preprotein translocase subunit SecY [Brucella ceti M13/05/1]
 gi|261314065|ref|ZP_05953262.1| preprotein translocase subunit SecY [Brucella pinnipedialis
           M163/99/10]
 gi|261322056|ref|ZP_05961253.1| preprotein translocase subunit SecY [Brucella ceti M644/93/1]
 gi|261755181|ref|ZP_05998890.1| preprotein translocase subunit SecY [Brucella suis bv. 3 str. 686]
 gi|261758405|ref|ZP_06002114.1| C-5 cytosine-specific DNA methylase [Brucella sp. F5/99]
 gi|265984271|ref|ZP_06097006.1| preprotein translocase subunit SecY [Brucella sp. 83/13]
 gi|265991290|ref|ZP_06103847.1| preprotein translocase subunit SecY [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995127|ref|ZP_06107684.1| preprotein translocase subunit SecY [Brucella melitensis bv. 3 str.
           Ether]
 gi|294852549|ref|ZP_06793222.1| preprotein translocase [Brucella sp. NVSL 07-0026]
 gi|306838023|ref|ZP_07470881.1| preprotein translocase, SecY subunit [Brucella sp. NF 2653]
 gi|306840321|ref|ZP_07473093.1| preprotein translocase, SecY subunit [Brucella sp. BO2]
 gi|306844117|ref|ZP_07476711.1| preprotein translocase, SecY subunit [Brucella sp. BO1]
 gi|17982717|gb|AAL51958.1| protein translocase subunit secy [Brucella melitensis bv. 1 str.
           16M]
 gi|23348049|gb|AAN30132.1| preprotein translocase, SecY subunit [Brucella suis 1330]
 gi|161335980|gb|ABX62285.1| Hypothetical protein BCAN_A1236 [Brucella canis ATCC 23365]
 gi|225641075|gb|ACO00989.1| preprotein translocase, SecY subunit [Brucella melitensis ATCC
           23457]
 gi|255999799|gb|ACU48198.1| preprotein translocase SecY [Brucella microti CCM 4915]
 gi|260151603|gb|EEW86697.1| C-5 cytosine-specific DNA methylase [Brucella melitensis bv. 1 str.
           16M]
 gi|260155776|gb|EEW90856.1| C-5 cytosine-specific DNA methylase [Brucella suis bv. 4 str. 40]
 gi|260924650|gb|EEX91218.1| preprotein translocase subunit SecY [Brucella ceti M13/05/1]
 gi|261294746|gb|EEX98242.1| preprotein translocase subunit SecY [Brucella ceti M644/93/1]
 gi|261303091|gb|EEY06588.1| preprotein translocase subunit SecY [Brucella pinnipedialis
           M163/99/10]
 gi|261738389|gb|EEY26385.1| C-5 cytosine-specific DNA methylase [Brucella sp. F5/99]
 gi|261744934|gb|EEY32860.1| preprotein translocase subunit SecY [Brucella suis bv. 3 str. 686]
 gi|262766240|gb|EEZ12029.1| preprotein translocase subunit SecY [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002074|gb|EEZ14649.1| preprotein translocase subunit SecY [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093928|gb|EEZ17862.1| C-5 cytosine-specific DNA methylase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264662863|gb|EEZ33124.1| preprotein translocase subunit SecY [Brucella sp. 83/13]
 gi|294821138|gb|EFG38137.1| preprotein translocase [Brucella sp. NVSL 07-0026]
 gi|306275560|gb|EFM57292.1| preprotein translocase, SecY subunit [Brucella sp. BO1]
 gi|306289720|gb|EFM60909.1| preprotein translocase, SecY subunit [Brucella sp. BO2]
 gi|306406947|gb|EFM63168.1| preprotein translocase, SecY subunit [Brucella sp. NF 2653]
 gi|326409235|gb|ADZ66300.1| preprotein translocase subunit SecY [Brucella melitensis M28]
 gi|326538943|gb|ADZ87158.1| preprotein translocase, SecY subunit [Brucella melitensis M5-90]
          Length = 446

 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/445 (67%), Positives = 366/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|254701954|ref|ZP_05163782.1| preprotein translocase subunit SecY [Brucella suis bv. 5 str. 513]
 gi|261752522|ref|ZP_05996231.1| preprotein translocase subunit SecY [Brucella suis bv. 5 str. 513]
 gi|261742275|gb|EEY30201.1| preprotein translocase subunit SecY [Brucella suis bv. 5 str. 513]
          Length = 446

 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/445 (67%), Positives = 366/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGALELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|254710284|ref|ZP_05172095.1| preprotein translocase subunit SecY [Brucella pinnipedialis B2/94]
 gi|256031778|ref|ZP_05445392.1| preprotein translocase subunit SecY [Brucella pinnipedialis
           M292/94/1]
 gi|261317847|ref|ZP_05957044.1| preprotein translocase subunit SecY [Brucella pinnipedialis B2/94]
 gi|265988876|ref|ZP_06101433.1| preprotein translocase subunit SecY [Brucella pinnipedialis
           M292/94/1]
 gi|261297070|gb|EEY00567.1| preprotein translocase subunit SecY [Brucella pinnipedialis B2/94]
 gi|264661073|gb|EEZ31334.1| preprotein translocase subunit SecY [Brucella pinnipedialis
           M292/94/1]
          Length = 446

 Score =  622 bits (1604), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/445 (67%), Positives = 365/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG   YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGHPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|163843479|ref|YP_001627883.1| preprotein translocase subunit SecY [Brucella suis ATCC 23445]
 gi|163674202|gb|ABY38313.1| preprotein translocase, SecY subunit [Brucella suis ATCC 23445]
          Length = 446

 Score =  622 bits (1603), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/445 (67%), Positives = 366/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATLAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|114704504|ref|ZP_01437412.1| preprotein translocase SecY [Fulvimarina pelagi HTCC2506]
 gi|114539289|gb|EAU42409.1| preprotein translocase SecY [Fulvimarina pelagi HTCC2506]
          Length = 446

 Score =  621 bits (1601), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 296/440 (67%), Positives = 359/440 (81%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF++FS+A+DLK RI FT+ ALIVYR GTYIP+P I+  + ++AFQ +
Sbjct: 1   MASAAEQLAANLNFSAFSKAEDLKKRIWFTLGALIVYRLGTYIPMPGINPDALAQAFQQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI GLFNMFSGGAV RMA+F+LGIMPYISASII+QL+ + +PSLE LKKEGEQGRKVI
Sbjct: 61  STGILGLFNMFSGGAVGRMAIFALGIMPYISASIIIQLMTSVIPSLEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL I+QAYGIA GL+    IV +  +FF  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLSIVQAYGIAAGLQTQANIVVNPGWFFTMSAVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LPS+L ++LELGR G++ST ++L+I    V  IA ++FFER
Sbjct: 181 ARGIGNGISLIIFAGIVANLPSALANLLELGRTGALSTAVILIIIVLAVVTIATIVFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P IFASSLLLLP T+  F +    
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPPIFASSLLLLPVTVANFSNTEEL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V SLGHG+  YM+ Y+  I FFAFFYTA+VFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PDWATAVVASLGHGQPLYMLFYAGLIAFFAFFYTAVVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID+VLTR+TVVGA YLV VC+ PE LI+  GVP  L GTSLLI+VSV +DT+ Q
Sbjct: 361 ERTAEYIDFVLTRITVVGAIYLVVVCLLPEFLISAAGVPFYLGGTSLLIVVSVTMDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           +QG+L+A QYEG+ KKS+ +
Sbjct: 421 VQGHLLAHQYEGLIKKSKLR 440


>gi|153009306|ref|YP_001370521.1| preprotein translocase subunit SecY [Ochrobactrum anthropi ATCC
           49188]
 gi|151561194|gb|ABS14692.1| preprotein translocase, SecY subunit [Ochrobactrum anthropi ATCC
           49188]
          Length = 446

 Score =  621 bits (1601), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 299/446 (67%), Positives = 365/446 (81%), Gaps = 2/446 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FFV S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFVVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    + +IA+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIILAIVLIAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKNS 444
           IQG+LIA QYEG+ KKS  R  K+N 
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRNK 446


>gi|148559716|ref|YP_001259133.1| preprotein translocase subunit SecY [Brucella ovis ATCC 25840]
 gi|148370973|gb|ABQ60952.1| preprotein translocase, SecY subunit [Brucella ovis ATCC 25840]
          Length = 446

 Score =  621 bits (1601), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 298/445 (66%), Positives = 365/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLK NTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKFNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|62290124|ref|YP_221917.1| preprotein translocase subunit SecY [Brucella abortus bv. 1 str.
           9-941]
 gi|82700047|ref|YP_414621.1| preprotein translocase subunit SecY [Brucella melitensis biovar
           Abortus 2308]
 gi|189024362|ref|YP_001935130.1| C-5 cytosine-specific DNA methylase [Brucella abortus S19]
 gi|237815632|ref|ZP_04594629.1| preprotein translocase, SecY subunit [Brucella abortus str. 2308 A]
 gi|254689433|ref|ZP_05152687.1| preprotein translocase subunit SecY [Brucella abortus bv. 6 str.
           870]
 gi|254693918|ref|ZP_05155746.1| preprotein translocase subunit SecY [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697568|ref|ZP_05159396.1| preprotein translocase subunit SecY [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730462|ref|ZP_05189040.1| preprotein translocase subunit SecY [Brucella abortus bv. 4 str.
           292]
 gi|256257679|ref|ZP_05463215.1| preprotein translocase subunit SecY [Brucella abortus bv. 9 str.
           C68]
 gi|260546672|ref|ZP_05822411.1| C-5 cytosine-specific DNA methylase [Brucella abortus NCTC 8038]
 gi|260754956|ref|ZP_05867304.1| preprotein translocase subunit SecY [Brucella abortus bv. 6 str.
           870]
 gi|260758172|ref|ZP_05870520.1| preprotein translocase subunit SecY [Brucella abortus bv. 4 str.
           292]
 gi|260761998|ref|ZP_05874341.1| preprotein translocase subunit SecY [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883965|ref|ZP_05895579.1| preprotein translocase subunit SecY [Brucella abortus bv. 9 str.
           C68]
 gi|261214210|ref|ZP_05928491.1| preprotein translocase subunit SecY [Brucella abortus bv. 3 str.
           Tulya]
 gi|297248519|ref|ZP_06932237.1| preprotein translocase, SecY subunit [Brucella abortus bv. 5 str.
           B3196]
 gi|62196256|gb|AAX74556.1| SecY, preprotein translocase [Brucella abortus bv. 1 str. 9-941]
 gi|82616148|emb|CAJ11191.1| C-5 cytosine-specific DNA methylase:SecY protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189019934|gb|ACD72656.1| C-5 cytosine-specific DNA methylase [Brucella abortus S19]
 gi|237788930|gb|EEP63141.1| preprotein translocase, SecY subunit [Brucella abortus str. 2308 A]
 gi|260095722|gb|EEW79599.1| C-5 cytosine-specific DNA methylase [Brucella abortus NCTC 8038]
 gi|260668490|gb|EEX55430.1| preprotein translocase subunit SecY [Brucella abortus bv. 4 str.
           292]
 gi|260672430|gb|EEX59251.1| preprotein translocase subunit SecY [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675064|gb|EEX61885.1| preprotein translocase subunit SecY [Brucella abortus bv. 6 str.
           870]
 gi|260873493|gb|EEX80562.1| preprotein translocase subunit SecY [Brucella abortus bv. 9 str.
           C68]
 gi|260915817|gb|EEX82678.1| preprotein translocase subunit SecY [Brucella abortus bv. 3 str.
           Tulya]
 gi|297175688|gb|EFH35035.1| preprotein translocase, SecY subunit [Brucella abortus bv. 5 str.
           B3196]
          Length = 446

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/445 (66%), Positives = 365/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LK EGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKNEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|256061293|ref|ZP_05451443.1| preprotein translocase subunit SecY [Brucella neotomae 5K33]
 gi|261325300|ref|ZP_05964497.1| preprotein translocase subunit SecY [Brucella neotomae 5K33]
 gi|261301280|gb|EEY04777.1| preprotein translocase subunit SecY [Brucella neotomae 5K33]
          Length = 446

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/445 (66%), Positives = 365/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           + TA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ESTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|256159948|ref|ZP_05457666.1| preprotein translocase subunit SecY [Brucella ceti M490/95/1]
 gi|256255179|ref|ZP_05460715.1| preprotein translocase subunit SecY [Brucella ceti B1/94]
 gi|261222375|ref|ZP_05936656.1| preprotein translocase subunit SecY [Brucella ceti B1/94]
 gi|265998340|ref|ZP_06110897.1| preprotein translocase subunit SecY [Brucella ceti M490/95/1]
 gi|260920959|gb|EEX87612.1| preprotein translocase subunit SecY [Brucella ceti B1/94]
 gi|262552808|gb|EEZ08798.1| preprotein translocase subunit SecY [Brucella ceti M490/95/1]
          Length = 446

 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/445 (66%), Positives = 365/445 (82%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV++   FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTNPGPFFIVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    VA++A+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIVLAVALVAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+  F + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVADFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTVLNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKN 443
           IQG+LIA QYEG+ KKS  R  K+N
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRN 445


>gi|222085695|ref|YP_002544225.1| protein-export translocase protein [Agrobacterium radiobacter K84]
 gi|221723143|gb|ACM26299.1| protein-export translocase protein [Agrobacterium radiobacter K84]
          Length = 446

 Score =  619 bits (1596), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 308/438 (70%), Positives = 375/438 (85%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK R+ FT+ AL+VYR GT+IPLP ++  +Y++AFQ++
Sbjct: 1   MASAAEQLASNLNFSTFAKAEDLKKRLWFTLGALLVYRLGTHIPLPGLNPAAYAQAFQNQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI GLFNMFSGGAV+RMA+F+LGIMPYISASIIVQL+ + VP+LENLKKEGEQGRK+I
Sbjct: 61  SGGILGLFNMFSGGAVQRMAIFALGIMPYISASIIVQLMTSVVPALENLKKEGEQGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG LQAYGIA+GL++G G+V D  +FF  ST+ITLLGGTMFL+WLGEQ+T
Sbjct: 121 NQYTRYGTVLLGALQAYGIAIGLEHGNGVVLDPGWFFRISTVITLLGGTMFLMWLGEQVT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GI AGLP++L   LELGR G++ST L+LL+    V VIAL++F ER
Sbjct: 181 SRGIGNGISLIIFAGIAAGLPTALAGTLELGRTGALSTGLILLVLVVAVLVIALIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVG RMFQ D S+LPLKLNT+GV+P+IFASSLLLLPATI G    ++ 
Sbjct: 241 AQRRLLIQYPKRQVGTRMFQGDTSHLPLKLNTSGVIPAIFASSLLLLPATIAGLGTNTAL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           PTW+  +V +LGHG+  YMVLY+  I FFAFFYTA+VFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PTWVTSIVAALGHGQPLYMVLYAALIAFFAFFYTALVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           DRTA +IDYVLTR+TV+GA YLV VCI PE L++ TG+P++L GTSLLI+VSV LDT+ Q
Sbjct: 361 DRTAEYIDYVLTRITVIGAIYLVFVCILPEILVSQTGIPLALGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+LIAQQYEG+ KKS+
Sbjct: 421 IQGHLIAQQYEGLIKKSK 438


>gi|239832102|ref|ZP_04680431.1| preprotein translocase, SecY subunit [Ochrobactrum intermedium LMG
           3301]
 gi|239824369|gb|EEQ95937.1| preprotein translocase, SecY subunit [Ochrobactrum intermedium LMG
           3301]
          Length = 446

 Score =  619 bits (1595), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/446 (66%), Positives = 364/446 (81%), Gaps = 2/446 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSNLNF++FS+A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AFQ  
Sbjct: 1   MASAAEQLVSNLNFSAFSKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFQQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  SQGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLMTSVVPSLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL ++QAY I+VGL++G GIV+    FF+ S++ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLALVQAYAISVGLQSGNGIVTSPGPFFMVSSVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVA LP ++   LELGR G++ST L+L +    + +IA+++F ER
Sbjct: 181 ARGIGNGISLIIFSGIVANLPHAISGTLELGRTGALSTGLILGVIILAIVLIAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF + +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTTEM 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   ++++LGHG+  YM+ Y+  + FF FFYTAIVFNPK+ AD LKKH GFIPGIRPG
Sbjct: 301 PAWATTILNALGHGQPLYMLFYAALMAFFCFFYTAIVFNPKDTADQLKKHSGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+V VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYIVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKS--RSKKKNS 444
           IQG+LIA QYEG+ KKS  R  K+N 
Sbjct: 421 IQGHLIAHQYEGLIKKSKLRGGKRNK 446


>gi|90417747|ref|ZP_01225659.1| preprotein translocase, SecY subunit [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337419|gb|EAS51070.1| preprotein translocase, SecY subunit [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 447

 Score =  610 bits (1573), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 295/440 (67%), Positives = 359/440 (81%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF++F++A+DLK RI FT+ AL+VYR GTYIP+P I+  + ++AFQ +
Sbjct: 1   MASAAEQLAANLNFSAFAKAEDLKKRIWFTLGALLVYRLGTYIPMPGINPDALAQAFQQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI GLFNMFSGGAV RMA+F+LGIMPYISASII+QL+ + +PSLE LKKEGEQGRKVI
Sbjct: 61  STGILGLFNMFSGGAVGRMAIFALGIMPYISASIIIQLMTSVIPSLEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL  +QAYGIA GL+   GIV D   FF  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATVQAYGIAAGLQTQPGIVVDPGIFFQVSAVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LPS++ ++LELGR G++ST ++LL+    VA IA+++FFER
Sbjct: 181 ARGIGNGISLIIFAGIVAHLPSAIANLLELGRTGALSTAVILLVIVVAVACIAVIVFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLP TI  F   +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPVTIANFTSTADL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W    + SLGHG+  YM +Y+  I FFAFFYTA+VFNPK+ ADNLKKHGGFIPGIRPG
Sbjct: 301 PGWASATIASLGHGQPLYMAMYAGLIAFFAFFYTAVVFNPKDTADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV +C+ PE LI+  GVP  L GTSLLI+VSV +DT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYLVIICLLPEFLISAVGVPFYLGGTSLLIVVSVTMDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           +QG+L+A QYEG+ KK++ +
Sbjct: 421 VQGHLLAHQYEGLVKKAKLR 440


>gi|118591161|ref|ZP_01548560.1| protein translocase subunit SecY [Stappia aggregata IAM 12614]
 gi|118436237|gb|EAV42879.1| protein translocase subunit SecY [Stappia aggregata IAM 12614]
          Length = 443

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 294/438 (67%), Positives = 358/438 (81%), Gaps = 1/438 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A++LK RI FT+ AL+VYR GTYIPLP I+  ++++AF   
Sbjct: 1   MASAAEQLASNLNFSAFAKAEELKKRIWFTLGALLVYRLGTYIPLPGINPDAFAQAFNQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +GI G+FNMF+GGAVERMA+F+LGIMPYISASII+QL+   VPSLE LKKEGEQGRKVI
Sbjct: 61  QSGIIGMFNMFAGGAVERMAIFALGIMPYISASIIMQLMTTVVPSLEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYGIAVGL+    +V+D  +FF  ST++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILAAFQAYGIAVGLEGAANVVADPGWFFRASTVLTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVAGLP +LV+VLELGR GS+ST L+L I    V VIAL++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAGLPVALVNVLELGRQGSMSTVLILGILILAVVVIALIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQ+GNRMF+ + S+LPLKLNTAGV+P IFASSLLL+PATI GF    S 
Sbjct: 241 AQRRLLIQYPKRQMGNRMFEGNTSFLPLKLNTAGVIPPIFASSLLLVPATIGGF-SQGSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
             W+  +  +LGHG+  +MV Y+  IVFF FFYTAIVFNP + ADNLKKHGGFIPGIRPG
Sbjct: 300 NEWLTYITAALGHGQPLFMVFYAAMIVFFCFFYTAIVFNPSDTADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+  VC+ PE LI+ TGVP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAQYIDYVLTRITVVGAIYITVVCLLPEFLISATGVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSR 438
           IQG+L+A QYEG+ KK++
Sbjct: 420 IQGHLLAHQYEGLVKKAK 437


>gi|328543378|ref|YP_004303487.1| Preprotein translocase, SecY subunit [Polymorphum gilvum
           SL003B-26A1]
 gi|326413123|gb|ADZ70186.1| Preprotein translocase, SecY subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 443

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/443 (64%), Positives = 361/443 (81%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF++F++A++LK RI FT+ AL+VYR GTYIPLP I+  ++++AF   
Sbjct: 1   MASAAEQLAANLNFSAFAKAEELKKRIWFTLGALLVYRLGTYIPLPGINPEAFAQAFGQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +GI G+FNMF+GGAVERMA+F+LGIMPYISASII+QL+ + VPSLE LKKEG+QGRK I
Sbjct: 61  QSGIIGMFNMFAGGAVERMAIFALGIMPYISASIIMQLMTSVVPSLEQLKKEGDQGRKTI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL  +QAYGIAVGL+    +V+D  +FF  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATMQAYGIAVGLEGATNVVADPGWFFRISAVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVAGLP+++VS LELGR G+++T ++L++    VAVI L++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAGLPAAIVSTLELGRQGALATWIILMVIVLAVAVIGLIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+ + S+LPLKLNTAGV+P IFASSLLL+PATI GF    + 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGNTSFLPLKLNTAGVIPPIFASSLLLVPATISGF-SSGTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W+  +   LGHG+  YM+ Y+  IVFF FFYTAIVFNP + ADNLK+HGGFIPGIRPG
Sbjct: 300 PEWLTTVTALLGHGQPLYMLFYAAMIVFFCFFYTAIVFNPSDTADNLKRHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+T VGA Y+V VC+ PE LI+ TGVP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAQYIDYVLTRITAVGAIYIVLVCLLPEFLISATGVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           IQG+L+A QYEG+ KK++ + K 
Sbjct: 420 IQGHLLAHQYEGLVKKAKLRGKR 442


>gi|110634010|ref|YP_674218.1| preprotein translocase subunit SecY [Mesorhizobium sp. BNC1]
 gi|110284994|gb|ABG63053.1| protein translocase subunit secY/sec61 alpha [Chelativorans sp.
           BNC1]
          Length = 446

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 301/438 (68%), Positives = 363/438 (82%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNFA+F++A+DLK RI FT+ AL++YR GTYIP+P I+  ++++AFQ +
Sbjct: 1   MASAAEQLASNLNFAAFAKAEDLKKRIWFTLGALLIYRLGTYIPMPGINPDAFAQAFQQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ G+FNMF+GGAVERMA+F+LGIMPYISASII+QL+ + VPSLE LKKEGEQGRKVI
Sbjct: 61  SGGVLGMFNMFAGGAVERMAIFALGIMPYISASIIMQLLTSVVPSLEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL  +QAYGIA+GL+ GQ IV+D  +FF  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATVQAYGIAIGLEGGQNIVADPGWFFRISAVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIFSGIVAGLP+++   LEL R G++ST L+L I    + VI +++FFER
Sbjct: 181 ARGIGNGISLIIFSGIVAGLPTAIGGTLELARTGAMSTGLILAIIVIAIVVIGVIVFFER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF D +  
Sbjct: 241 AQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATMAGFSDTTQL 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   L+ +LGHG+  YM+LY+  I FFAFFYTAIVFNPK+ AD LKKH GFIPG RPG
Sbjct: 301 PGWAGTLLATLGHGQPLYMILYAALIAFFAFFYTAIVFNPKDTADQLKKHSGFIPGYRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA YLV VC+ PE LI+ TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 361 ERTAEYIDYVLTRITVVGAIYLVLVCLLPEFLISATGVPFYLGGTSLLIVVSVTLDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           +QG+LIA QYEG+ KKS+
Sbjct: 421 VQGHLIAHQYEGLIKKSK 438


>gi|307946306|ref|ZP_07661641.1| preprotein translocase, SecY subunit [Roseibium sp. TrichSKD4]
 gi|307769970|gb|EFO29196.1| preprotein translocase, SecY subunit [Roseibium sp. TrichSKD4]
          Length = 443

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/444 (65%), Positives = 359/444 (80%), Gaps = 1/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A++LK RI FT+ AL+VYR GTYIPLP I+  ++ +AF   
Sbjct: 1   MASAAEQLASNLNFSAFAKAEELKKRIWFTLGALLVYRLGTYIPLPGINPEAFGQAFNQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +GI G+FNMF+GGAVERMA+F+LGIMPYISASII+QL+   VP+LE +KK+GEQGRKVI
Sbjct: 61  QSGIIGMFNMFAGGAVERMAIFALGIMPYISASIIMQLMTTVVPTLEQMKKDGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L  LQAYGIAVGL+    +V+D  +FF  ST+ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVVLAALQAYGIAVGLEGAANVVTDPGWFFRASTVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVAGLP+++VS LELGR G+++T ++L I    V VIA ++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAGLPTAVVSTLELGRQGALATWIILGIIILAVVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQ+GNRMF+ + S+LPLKLNTAGV+P IFASSLLL+PATI GF +    
Sbjct: 241 AQRRLLIQYPKRQMGNRMFEGNTSFLPLKLNTAGVIPPIFASSLLLVPATISGF-NSGGG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
             W+  +   LGHG+  YMV Y+V I+FF FFYTAIVFNP + ADNLKKHGGFIPGIRPG
Sbjct: 300 NEWLTTITALLGHGQPLYMVFYAVMIIFFCFFYTAIVFNPTDTADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTRVTVVGA Y+  VC+ PE LI+ TGVP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAQYIDYVLTRVTVVGAIYITLVCLLPEFLISATGVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           IQG+L+A QYEG+ KK++ + K  
Sbjct: 420 IQGHLLAHQYEGLVKKAKLRGKRK 443


>gi|254502783|ref|ZP_05114934.1| preprotein translocase, SecY subunit [Labrenzia alexandrii DFL-11]
 gi|222438854|gb|EEE45533.1| preprotein translocase, SecY subunit [Labrenzia alexandrii DFL-11]
          Length = 443

 Score =  602 bits (1553), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 287/443 (64%), Positives = 357/443 (80%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A++LK RI FT+ AL+VYR GTYIP+P I+  ++++AF   
Sbjct: 1   MASAAEQLASNLNFSAFAKAEELKKRIWFTLGALLVYRLGTYIPMPGINPEAFAQAFNQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +GI G+FNMF+GGAVERMA+F+LGIMPYISASII+QL+   VPSLE LKKEGEQGRKVI
Sbjct: 61  QSGIIGMFNMFAGGAVERMAIFALGIMPYISASIIMQLMTTVVPSLEQLKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYGIAVGL+    +V+D  +FF  ST+ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVVLAAFQAYGIAVGLEGATNVVTDPGWFFRASTVITLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVAGLPS++V  LELGR GS++T ++L +    + VIA ++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAGLPSAIVQTLELGRQGSLATGIILAVILLAIVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQ+GNRMF+ + S+LPLKLNTAGV+P IFASSLLL+PATI GF +    
Sbjct: 241 AQRRLLIQYPKRQMGNRMFEGNTSFLPLKLNTAGVIPPIFASSLLLVPATISGF-NAGGG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
             W+  +   LGHG+  +MV Y+  I+FF FFYTAIVFNP + ADNLKKHGGFIPGIRPG
Sbjct: 300 NEWLTTITALLGHGQPLFMVFYAAMIIFFCFFYTAIVFNPSDTADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID+VLTR+TVVGA Y+  VC+ PE LI+ TGVP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAQYIDFVLTRITVVGAIYITIVCLLPEFLISATGVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           IQG+L+A QYEG+ KKS+ + K 
Sbjct: 420 IQGHLLAHQYEGLVKKSKLRGKR 442


>gi|163760820|ref|ZP_02167899.1| protein translocase subunit SecY [Hoeflea phototrophica DFL-43]
 gi|162281864|gb|EDQ32156.1| protein translocase subunit SecY [Hoeflea phototrophica DFL-43]
          Length = 461

 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 302/438 (68%), Positives = 367/438 (83%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A+DLK RI FT+ AL+VYR GTYIPLP I+  ++++AFQ +
Sbjct: 16  MASAAEQLASNLNFSAFAKAEDLKKRIWFTLGALLVYRLGTYIPLPGINPDAFAQAFQGQ 75

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI GLFNMF+GGAVERMA+F+LGIMPYISASII+QL+ + VP+LE LKKEGEQGRK+I
Sbjct: 76  AGGILGLFNMFAGGAVERMAIFALGIMPYISASIIIQLMTSVVPTLEQLKKEGEQGRKII 135

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLLG +QAYGIAVGL++G GIV+D  +FF  +T+ITL+GGTMFL+WLGEQIT
Sbjct: 136 NQYTRYGTVLLGTVQAYGIAVGLESGNGIVTDPGWFFRIATVITLVGGTMFLMWLGEQIT 195

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LP ++   LELGR G++ST L++ I    +AVIA ++F ER
Sbjct: 196 ARGIGNGISLIIFAGIVAALPGAVAGTLELGRTGALSTGLIIAIIVVAIAVIAFIVFIER 255

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQR+LLIQYPKRQVG+RMFQ D S+LPLKLNTAGV+P IFASSLLLLPAT+ GF +    
Sbjct: 256 AQRQLLIQYPKRQVGSRMFQGDTSHLPLKLNTAGVIPPIFASSLLLLPATVAGFANTGDL 315

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   L+ SLGHG+  YM+ Y+  I FFAFFYTAIVFNPK+ ADNLK+HGGFIPGIRPG
Sbjct: 316 PGWATTLLASLGHGQPAYMIFYAAMIAFFAFFYTAIVFNPKDTADNLKRHGGFIPGIRPG 375

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           DRTA +ID+VLTR+TV+GA YLV VC+ PE LIA TGVP  L GTSLLI+VSV LDT+ Q
Sbjct: 376 DRTAEYIDFVLTRITVIGAMYLVFVCLLPEFLIAQTGVPFYLGGTSLLIVVSVTLDTVAQ 435

Query: 421 IQGYLIAQQYEGVFKKSR 438
           +QG+LIAQQYEG+ KKS+
Sbjct: 436 VQGHLIAQQYEGLIKKSK 453


>gi|254470026|ref|ZP_05083430.1| preprotein translocase, SecY subunit [Pseudovibrio sp. JE062]
 gi|211960337|gb|EEA95533.1| preprotein translocase, SecY subunit [Pseudovibrio sp. JE062]
          Length = 446

 Score =  598 bits (1541), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 286/445 (64%), Positives = 360/445 (80%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF++F++A++LK RI FT+ AL+VYRFGTYIPLP I+  + ++AF + 
Sbjct: 1   MASAAEQLASNLNFSAFAKAEELKKRIWFTLGALLVYRFGTYIPLPGINPDALAQAFGNV 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI GLFNMFSGGAVERMA+F+LGIMPYISASII+QL+ + VP+LE LKKEGEQGRK I
Sbjct: 61  QTGIVGLFNMFSGGAVERMAIFALGIMPYISASIIIQLMTSVVPTLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTR+ TV+L   QAYGI+VGL+ G  IV D  +FF  +T++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRFGTVILATFQAYGISVGLEAGTNIVIDPGWFFRIATVLTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVAGLPS++ S LELGR G+++TP++L +   +V VI +++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAGLPSAIASTLELGRQGALATPIILAVVILSVVVIGVIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI--DVS 298
           AQRRLLIQYP+RQ GN+MF+ + S+LPLKLNTAGV+P IFASSLLL+PAT+  F   D +
Sbjct: 241 AQRRLLIQYPRRQQGNKMFEGNTSFLPLKLNTAGVIPPIFASSLLLVPATVSSFQTGDST 300

Query: 299 SSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIR 358
            S  W+  +   LGHG+  YMVLY+  I+FF FFYTAIVFNP E ADNLKKHGGFIPGIR
Sbjct: 301 GSMAWLTTVTALLGHGQPAYMVLYAALIIFFCFFYTAIVFNPSETADNLKKHGGFIPGIR 360

Query: 359 PGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTI 418
           PG+RTA +ID+VLTR+TVVGA Y+  +C+ PE LI+ TGVP    GTSLLI+VSV +DT+
Sbjct: 361 PGERTAQYIDHVLTRITVVGAIYITLICLLPEFLISATGVPFYFGGTSLLIVVSVTMDTV 420

Query: 419 VQIQGYLIAQQYEGVFKKSRSKKKN 443
            QIQG+L+A QYEG+ KK++ + K 
Sbjct: 421 SQIQGHLLAHQYEGLVKKTKLRGKR 445


>gi|304391475|ref|ZP_07373417.1| preprotein translocase, SecY subunit [Ahrensia sp. R2A130]
 gi|303295704|gb|EFL90062.1| preprotein translocase, SecY subunit [Ahrensia sp. R2A130]
          Length = 466

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 282/444 (63%), Positives = 347/444 (78%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLN+ +FS+A DLK RI FT++ALIVYR GTYIP+P I+      AF  +
Sbjct: 1   MASAAEQLAANLNYKTFSKATDLKKRIWFTLLALIVYRLGTYIPVPGINPEQLQAAFDQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+ GL NMF+GGAVER+A+F+LGIMPYISASII+QL+ + +P+LE LKKEGEQGRKVI
Sbjct: 61  SQGVLGLVNMFAGGAVERLAIFALGIMPYISASIIMQLMTSVIPTLEALKKEGEQGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+LG  QAYGIA+GL   +G+V +  +FF+ +T++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILGTAQAYGIAIGLNGAEGMVLNPGWFFILTTVVTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LP +L  +L+ G  GSIST  ML +  + +A+IA ++F ER
Sbjct: 181 ARGIGNGISLIIFAGIVAALPGALAQLLDAGATGSISTLTMLGVLVAIIALIAFIVFIER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MFQ D S+LPLKLNTAGV+P IFASSLLLLPATI GF      
Sbjct: 241 AQRRLLIQYPKRQVGNKMFQGDSSHLPLKLNTAGVIPPIFASSLLLLPATITGFSAAGEQ 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
             W   +   LG G+  Y++ Y   I+FFAFFYTAIVFNPKE ADNLK+HGGFIPGIRPG
Sbjct: 301 GEWAAWISAFLGRGQPGYLLFYGGMILFFAFFYTAIVFNPKETADNLKQHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           DRTA +IDYVLTR+TV GA YLV VC+ PE  +   G+ V L GTSLLI+VSV +DT+ Q
Sbjct: 361 DRTAEYIDYVLTRITVAGAIYLVFVCLLPEMFLTGLGISVFLGGTSLLIVVSVTMDTVQQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           +Q +L AQQYEG+ +KS+ +   S
Sbjct: 421 VQSHLFAQQYEGLIQKSKLRGAKS 444


>gi|218516442|ref|ZP_03513282.1| preprotein translocase subunit SecY [Rhizobium etli 8C-3]
          Length = 406

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 281/400 (70%), Positives = 342/400 (85%)

Query: 41  TYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIA 100
           T+IPLP ++  +Y++AF+ ++ GI GLFNMFSGGAV+RMA+F+LGIMPYISASIIVQL+ 
Sbjct: 1   THIPLPGLNPEAYAQAFRGQAGGILGLFNMFSGGAVQRMAIFALGIMPYISASIIVQLMT 60

Query: 101 ATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFS 160
           + VP+LENLKKEGEQGRK+INQYTRY TV+LG LQAYGIA GL++GQG+V D  +FF  S
Sbjct: 61  SVVPALENLKKEGEQGRKIINQYTRYGTVILGALQAYGIAAGLESGQGLVVDPGWFFRVS 120

Query: 161 TIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPL 220
           T++TLLGGTMFL+WLGEQIT RGIGNG+SLIIF+GI AGLP++L   LELGR G++STPL
Sbjct: 121 TVLTLLGGTMFLMWLGEQITSRGIGNGISLIIFAGIAAGLPTALAGTLELGRTGALSTPL 180

Query: 221 MLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIF 280
           +LL+    + VI +++F ERAQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT+GV+P+IF
Sbjct: 181 ILLVIIVAIGVIGVIVFVERAQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNTSGVIPAIF 240

Query: 281 ASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNP 340
           ASSLLLLPATI GF   ++ P W   +V +LGHGR  YMVLY+  I FFAFFYTAIVFNP
Sbjct: 241 ASSLLLLPATIAGFASTTAMPAWATSIVAALGHGRPLYMVLYAALIAFFAFFYTAIVFNP 300

Query: 341 KEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPV 400
           K+ ADNLKKHGGFIPGIRPG+RTA +IDYVLTR+T++GA YLV VCI PE L++ TG+P+
Sbjct: 301 KDTADNLKKHGGFIPGIRPGERTAEYIDYVLTRITLIGAIYLVFVCILPEILVSQTGIPL 360

Query: 401 SLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           SL GTSLLI+VSV LDT+ QIQG+LIAQQYEG+ KKS+ +
Sbjct: 361 SLGGTSLLIVVSVTLDTVAQIQGHLIAQQYEGLIKKSKLR 400


>gi|158424158|ref|YP_001525450.1| preprotein translocase subunit SecY [Azorhizobium caulinodans ORS
           571]
 gi|158331047|dbj|BAF88532.1| preprotein translocase secY subunit [Azorhizobium caulinodans ORS
           571]
          Length = 444

 Score =  581 bits (1498), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 283/440 (64%), Positives = 339/440 (77%), Gaps = 1/440 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF S  +A++LK RI FT+ ALIV+R GTYIPLP I+  +    F+  
Sbjct: 1   MVSAAEQLAANLNFGSLGKAEELKKRIWFTLGALIVFRLGTYIPLPGINPDALQDVFRGA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI GLFNMFSGGAVERMA+F+L IMPYISASIIVQL+    P+LE LKKEGE GRK I
Sbjct: 61  QQGIIGLFNMFSGGAVERMAIFALNIMPYISASIIVQLLTTVSPTLEALKKEGEAGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L + QAYGIAVGL+   G+V D  +FF  ST+ITL GGTMF++WLGEQIT
Sbjct: 121 NQYTRYLTVVLAVFQAYGIAVGLERSTGVVMDPGWFFRISTVITLTGGTMFMMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF GIVA LP + V  LELGR G+ISTP++L +    V +IA ++F ER
Sbjct: 181 SRGIGNGTSLIIFGGIVAELPGAFVRTLELGRQGAISTPIILGVLVMVVCLIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNR+++   S+LPLKLNT+GV+P IFASSLLL+P TI  F+   + 
Sbjct: 241 AQRRLLIQYPKRQVGNRLYEGQSSHLPLKLNTSGVIPPIFASSLLLIPTTIASFLQ-GAG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W+  +   LGHGR  YM+LY + IVFF FFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWLNQVTALLGHGRPLYMLLYVLLIVFFCFFYTAIVFNPVETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+  VC+FPE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLTRITVVGAAYIAAVCLFPEVLISYAAVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQG+L+A QYEG+ KKS+ +
Sbjct: 420 IQGHLLAHQYEGLVKKSKLR 439


>gi|27380491|ref|NP_772020.1| preprotein translocase subunit SecY [Bradyrhizobium japonicum USDA
           110]
 gi|27353655|dbj|BAC50645.1| preprotein translocase SECY subunit [Bradyrhizobium japonicum USDA
           110]
          Length = 443

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 277/443 (62%), Positives = 343/443 (77%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF +F++A +LK RI FT+ AL+VYR GTYIPLP ID   + + F+S+
Sbjct: 1   MASAAEQLAANLNFGAFAKADELKKRIWFTLGALLVYRLGTYIPLPGIDPNIWEQVFRSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASII+QL+    P LE LKKEGE GRK +
Sbjct: 61  AGGILGMFNMFAGGGIHRMAIFALNIMPYISASIIIQLLTTVSPQLEALKKEGEAGRKTL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   Q+YGIAVGL+    +VSD   FF  ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVILAAFQSYGIAVGLEGAGNVVSDPGMFFRLSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII SGIVA LP++L ++LELGR G++ST L+L++    VAVIA ++F ER
Sbjct: 181 SRGIGNGISLIILSGIVAELPAALANMLELGRQGAMSTGLILVVIIMAVAVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNT+GV+P IFASSLLLLP T+  F +  S 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTVANF-NAGSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +   LGHGR  ++++Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWITTQLGHGRPLFLIMYLALIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TV+GA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVLGAIYLAIVCLIPEILISYASVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           +QGYL+A QYEG+ +KS+ + + 
Sbjct: 420 VQGYLLAHQYEGLIRKSKLRGRR 442


>gi|75675576|ref|YP_317997.1| preprotein translocase subunit SecY [Nitrobacter winogradskyi
           Nb-255]
 gi|74420446|gb|ABA04645.1| protein translocase subunit secY/sec61 alpha [Nitrobacter
           winogradskyi Nb-255]
          Length = 443

 Score =  578 bits (1490), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 279/443 (62%), Positives = 343/443 (77%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF++FS+A +LK RI FT+ AL+VYR GTYIPLP ID   + K F S+
Sbjct: 1   MVSAAEQLAANLNFSAFSKADELKKRIWFTLGALLVYRLGTYIPLPGIDPTVWQKVFNSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMFSGG ++RMA+F+L IMPYISA+II+QL+ +  P LE LKKEGE GRKVI
Sbjct: 61  AGGILGMFNMFSGGGIDRMAIFALNIMPYISAAIILQLLTSVSPKLEALKKEGEAGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   Q+YGIAVGL+    +V++   FF+ ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLAFFQSYGIAVGLQGAGNVVTNPGMFFLLSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L S+LELGR G++ST ++L++    VAVIA ++F ER
Sbjct: 181 SRGIGNGISLIIMAGIVAELPSALASMLELGRQGALSTGIILIVLIMVVAVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF    S+LPLKLNT+GV+P IFASSLLLLP T+  F +  S 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFDGQSSHLPLKLNTSGVIPPIFASSLLLLPTTVANF-NAGSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +   LGHGR  +++LY   IVFF FFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWINTQLGHGRPMFLILYIALIVFFTFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TV GA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVPGAVYLAVVCLIPEILISYAAVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           +QGYL+A QYEG+ KKS+ + + 
Sbjct: 420 VQGYLLAHQYEGLIKKSKLRGRR 442


>gi|92117118|ref|YP_576847.1| preprotein translocase subunit SecY [Nitrobacter hamburgensis X14]
 gi|91800012|gb|ABE62387.1| protein translocase subunit secY/sec61 alpha [Nitrobacter
           hamburgensis X14]
          Length = 443

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 343/443 (77%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF++F++A +LK RI FT+ AL+VYR GTYIPLP ID   + K F S+
Sbjct: 1   MASAAEQLAANLNFSAFAKADELKKRIWFTLGALLVYRLGTYIPLPGIDPTVWQKVFNSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMFSGG ++RMA+F+L IMPYISA+II+QL+ +  P LE LKKEGE GRKVI
Sbjct: 61  AGGILGMFNMFSGGGIDRMAIFALNIMPYISAAIILQLLTSVSPKLEALKKEGEAGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   Q+YGIAVGL+    +V++   FF+ ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLAFFQSYGIAVGLQGAGNVVTNPGMFFLVSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L ++LELGR G++ST ++L++    V VIA ++F ER
Sbjct: 181 SRGIGNGISLIIMAGIVAELPSALANMLELGRQGALSTGIILIVLIMVVGVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNT+GV+P IFASSLLLLP T+  F +    
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTVANF-NAGKG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +   LGHGR  +++LY   IVFF FFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWVNTQLGHGRPMFLILYIALIVFFTFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TV GA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVPGAAYLAVVCLIPEILISYAAVPFYFGGTSLLIVVSVTMDTVQQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           +QGYL+A QYEG+ KKS+ + + 
Sbjct: 420 VQGYLLAHQYEGLIKKSKLRGRR 442


>gi|148256372|ref|YP_001240957.1| preprotein translocase subunit SecY [Bradyrhizobium sp. BTAi1]
 gi|146408545|gb|ABQ37051.1| protein translocase subunit secY/sec61 alpha [Bradyrhizobium sp.
           BTAi1]
          Length = 444

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/443 (62%), Positives = 343/443 (77%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF +F++A +LK RI FT+ AL+VYR GTYIPLP ID   +   F+++
Sbjct: 1   MASAAEQLAANLNFGAFAKADELKKRIWFTLGALLVYRLGTYIPLPGIDPNIWDSVFRTQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASII+QL+    P LE LKKEGE GRK++
Sbjct: 61  AGGILGMFNMFAGGGIHRMAIFALNIMPYISASIIIQLLTTVSPQLEALKKEGEAGRKML 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L  +Q+YGIAVGL+    +V+D   FF  ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVILAAVQSYGIAVGLEGAGNVVADPGLFFRLSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII SGIVA LPS+L ++LELGR G++ST L+L++    VAVIA ++F ER
Sbjct: 181 SRGIGNGISLIILSGIVAELPSALANMLELGRQGALSTGLILIVIVMAVAVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNT+GV+P IFASSLLLLP T+  F +    
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTVANF-NAGKG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +   LGHGR  ++VLY   I+FFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWITTQLGHGRPLFLVLYLALILFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TV+GA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVLGAIYLAIVCLIPEILISYASVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           +QGYL+A QYEG+ +KS+ + + 
Sbjct: 420 VQGYLLAHQYEGLIRKSKLRGRR 442


>gi|85715111|ref|ZP_01046095.1| preprotein translocase SecY [Nitrobacter sp. Nb-311A]
 gi|85698026|gb|EAQ35899.1| preprotein translocase SecY [Nitrobacter sp. Nb-311A]
          Length = 443

 Score =  576 bits (1485), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 278/442 (62%), Positives = 343/442 (77%), Gaps = 1/442 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF++F++A +LK RI FT+ AL+VYR GTYIPLP ID   + K F S+
Sbjct: 1   MVSAAEQLAANLNFSAFAKADELKKRIWFTLGALLVYRLGTYIPLPGIDPTVWQKVFNSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMFSGG ++RMA+F+L IMPYISA+II+QL+ +  P LE LKKEGE GRKVI
Sbjct: 61  AGGILGMFNMFSGGGIDRMAIFALNIMPYISAAIILQLLTSVSPKLEALKKEGEAGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   Q+YGIAVGL+    +V++   FF+ ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLAFFQSYGIAVGLQGAGNVVTNPGMFFLVSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L ++LELGR G++ST ++L++    VAVIA ++F ER
Sbjct: 181 SRGIGNGISLIIMAGIVAELPSALANMLELGRQGALSTGIILIVLIMVVAVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF    S+LPLKLNT+GV+P IFASSLLLLP T+  F +  S 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFDGQSSHLPLKLNTSGVIPPIFASSLLLLPTTVANF-NAGSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +   LGHGR  ++VLY   IVFF FFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWINTQLGHGRPLFLVLYIALIVFFTFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TV GA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVPGAVYLAVVCLIPEILISYAAVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKK 442
           +QGYL+A QYEG+ KKS+ + +
Sbjct: 420 VQGYLLAHQYEGLIKKSKLRGR 441


>gi|298291458|ref|YP_003693397.1| preprotein translocase, SecY subunit [Starkeya novella DSM 506]
 gi|296927969|gb|ADH88778.1| preprotein translocase, SecY subunit [Starkeya novella DSM 506]
          Length = 443

 Score =  575 bits (1481), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 274/443 (61%), Positives = 345/443 (77%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF + ++A +LK RI FT+ AL+VYR GTYIP+P I+  + +  F++ 
Sbjct: 1   MASAAEQLAANLNFGALAKADELKKRIWFTLGALLVYRLGTYIPMPGINPDALADVFRTA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI GLFNMFSGGAV RMA+F+L IMPYISASII+QL+    P+LE LKKEGE GRK I
Sbjct: 61  QQGIIGLFNMFSGGAVSRMAIFALNIMPYISASIIIQLLTTVSPTLEALKKEGEAGRKQI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L + Q+YGIAVGL+    +VSD  +FF  ST+ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLAVFQSYGIAVGLEGSGAVVSDPGWFFRISTVITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF+GIVA LPS++ + LELGR G++ST ++L +    VAVI  ++F ER
Sbjct: 181 SRGIGNGISLIIFAGIVAELPSAIANTLELGRQGALSTGIILAVILMAVAVIMFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN++++   S+LPLKLNT+GV+P IFASSLLL+P T+  F+   S 
Sbjct: 241 AQRRLLIQYPKRQVGNKVYEGQSSHLPLKLNTSGVIPPIFASSLLLIPTTVASFMQ-GSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W+  +   +GHG+  +M+LY + IVFF FFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PGWLTTVTTLIGHGQPLFMLLYVLLIVFFCFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TV+GA YL  VC+FPE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLTRITVIGAAYLAIVCLFPEILISYAAVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           +QG+L+A QYEG+ KK++ + K 
Sbjct: 420 VQGHLLAHQYEGLVKKAKLRGKR 442


>gi|146340077|ref|YP_001205125.1| preprotein translocase subunit SecY [Bradyrhizobium sp. ORS278]
 gi|146192883|emb|CAL76888.1| Preprotein translocase secY subunit [Bradyrhizobium sp. ORS278]
          Length = 443

 Score =  574 bits (1480), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 275/443 (62%), Positives = 342/443 (77%), Gaps = 1/443 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF + ++A +LK RI FT+ AL+VYR GTYIPLP ID   +   F+++
Sbjct: 1   MASAAEQLAANLNFGALAKADELKKRIWFTLGALLVYRLGTYIPLPGIDPNIWDSVFRTQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASII+QL+    P LE LKKEGE GRK++
Sbjct: 61  AGGILGMFNMFAGGGIHRMAIFALNIMPYISASIIIQLLTTVSPQLEALKKEGEAGRKML 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L  +Q+YGIAVGL+    +V+D   FF  ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVILAAVQSYGIAVGLEGAGNVVADPGLFFRLSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII SGIVA LPS+L ++LELGR G++ST L+L++    VAVIA ++F ER
Sbjct: 181 SRGIGNGISLIILSGIVAELPSALANMLELGRQGALSTGLILIVIVMAVAVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNT+GV+P IFASSLLLLP T+  F +    
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTVANF-NAGKG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +   LGHGR  ++VLY   I+FFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWITTQLGHGRPLFLVLYLALILFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TV+GA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVLGAIYLAIVCLIPEILISYASVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKN 443
           +QGYL+A QYEG+ +KS+ + + 
Sbjct: 420 VQGYLLAHQYEGLIRKSKLRGRR 442


>gi|209884833|ref|YP_002288690.1| preprotein translocase, SecY subunit [Oligotropha carboxidovorans
           OM5]
 gi|209873029|gb|ACI92825.1| preprotein translocase, SecY subunit [Oligotropha carboxidovorans
           OM5]
          Length = 443

 Score =  571 bits (1472), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 285/444 (64%), Positives = 348/444 (78%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF+SF++A +LK RI FT+ AL+VYR GTYIPLP ID   +S+ F+S+
Sbjct: 1   MVSAAEQLAANLNFSSFAKADELKKRIWFTLGALVVYRLGTYIPLPGIDPNVWSQVFRSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMFSGG ++RMAVF+L IMPYISASII+QL+    P LE LKKEGE GRK+I
Sbjct: 61  AGGILGMFNMFSGGGIDRMAVFALNIMPYISASIIIQLLQTVSPQLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYGIAVGL++   +VS+  YFF+ ST +TL GGTMFL+WLGEQ+T
Sbjct: 121 NQYTRYLTVVLAAFQAYGIAVGLQSAGNVVSNPGYFFLISTAVTLTGGTMFLMWLGEQVT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS++ S LELGR G++ST L+L I +  V VIA+++F ER
Sbjct: 181 SRGIGNGISLIIMAGIVAELPSAIASTLELGRQGALSTVLILAILAMAVIVIAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMF+   S+LPLKLNT+GV+P IFASSLLLLP TI  F +    
Sbjct: 241 AQRRLLIQYPKRQVGNRMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTIASF-NAGKG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   L   LGHGR  +++LY   IVFF FFYTA+VFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWLNTELGHGRPLFLMLYLGLIVFFTFFYTAVVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TVVGA YL  VC+ PE LI+   VP  L GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVVGAIYLALVCLVPEILISYASVPFYLGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           +QGYL+A QYEG+ +KS  R ++K
Sbjct: 420 VQGYLLAHQYEGLIRKSKLRGRRK 443


>gi|49475774|ref|YP_033815.1| preprotein translocase subunit SecY [Bartonella henselae str.
           Houston-1]
 gi|49238581|emb|CAF27822.1| Preprotein translocase secY subunit [Bartonella henselae str.
           Houston-1]
          Length = 448

 Score =  571 bits (1471), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 281/449 (62%), Positives = 350/449 (77%), Gaps = 8/449 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQF SN+NF +FSRA +LK RI FT+ AL+VYRFGTYI LP I+  +  + F+  
Sbjct: 1   MASAAEQFASNINFGTFSRATELKKRIWFTLGALLVYRFGTYISLPGINIDALRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + +PSLE LKKEGE GRK+I
Sbjct: 61  ASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIIPSLETLKKEGELGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ILQA+GIAV L+ G G    IV +  + F  S++ITL+GGTMFL+WLG
Sbjct: 121 NQYTRYVTVVLAILQAFGIAVALETGIGTGLQIVLEPGFMFRISSVITLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNGVSLIIF+GIVA LPS+   +L       +ST L + I    V+VIA+++
Sbjct: 181 EQITSRGVGNGVSLIIFTGIVANLPSTFAQLLTAHSQADLSTFLFITIIFIAVSVIAIIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+LIQYPKRQVGN+MFQ D+S+LPLKLNTAGV+P IFASSLLLLPAT+  F D
Sbjct: 241 FVERAQRRILIQYPKRQVGNQMFQGDMSHLPLKLNTAGVIPPIFASSLLLLPATVNNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +  SLGHG+  YM++Y++ + FF FFYTAIVFNP + AD LKKH GFIPG
Sbjct: 301 --KMPQWVQAISYSLGHGQPLYMIVYAILMAFFCFFYTAIVFNPSDTADQLKKHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TVVGA Y++ VC+ PE +I+   VP  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVVGAIYIILVCLLPEFMISALQVPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKS--RSKKKN 443
           T+ QIQG+L+A QYEG+ KKS  R  ++N
Sbjct: 419 TVAQIQGHLVAHQYEGLIKKSKLRGGRRN 447


>gi|170738683|ref|YP_001767338.1| preprotein translocase, SecY subunit [Methylobacterium sp. 4-46]
 gi|168192957|gb|ACA14904.1| preprotein translocase, SecY subunit [Methylobacterium sp. 4-46]
          Length = 445

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 273/438 (62%), Positives = 338/438 (77%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF + ++A +LK RI FT+ ALIVYR GTYIPLP ID  +  ++F + 
Sbjct: 1   MASAAEQLAANLNFGAIAKADELKKRIWFTLGALIVYRLGTYIPLPGIDPDALRQSFANA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+ GLFNMFSGGAVERMA+F+L IMPYISASIIVQL+ + +PSLE LKKEGE GRKV+
Sbjct: 61  QGGVLGLFNMFSGGAVERMAIFALNIMPYISASIIVQLLTSVLPSLEALKKEGESGRKVL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L I QA+GIAVGL++  GIV +   FF  ST+ITL GGT+FL+W+GEQIT
Sbjct: 121 NQYTRYLTVVLAIFQAWGIAVGLQSSGGIVQEPGLFFAISTVITLTGGTLFLMWIGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA LPS++   LELGR G++ST ++L +     AV+  ++F ER
Sbjct: 181 SRGIGNGSSLIIFAGIVAHLPSAIAGTLELGRQGALSTAVILGVAVMATAVVYFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQVGNRM++   S++PLKLNT GV+P IFASSLLLLPAT   F    S 
Sbjct: 241 AQRRLLINYPKRQVGNRMYEGQTSFMPLKLNTPGVIPPIFASSLLLLPATAASFQSDPSG 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
              +  L   LGHGR  YMVLY+  I+FFAFFYTA+VFNP+E ADNLKKHGGFIPGIRPG
Sbjct: 301 TGIVATLATYLGHGRPLYMVLYAALIIFFAFFYTAVVFNPQETADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID VL+RVTV+GA YL  +C+ PE L++   +P    GTSLLI+VSV +DT+ Q
Sbjct: 361 ERTAEYIDKVLSRVTVIGAAYLTLICLIPEILVSYASLPFYFGGTSLLIVVSVTMDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           + G+L+A QYEG+ KK++
Sbjct: 421 VHGHLLAHQYEGLVKKAK 438


>gi|163868630|ref|YP_001609839.1| preprotein translocase subunit SecY [Bartonella tribocorum CIP
           105476]
 gi|161018286|emb|CAK01844.1| translocase SecY subunit precursor [Bartonella tribocorum CIP
           105476]
          Length = 448

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 282/449 (62%), Positives = 348/449 (77%), Gaps = 8/449 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQF SN+NF +FSRA +LK RI FT+ AL+VYRFGTYI LP I+  +  + F+  
Sbjct: 1   MASAAEQFASNINFGTFSRATELKKRIWFTLAALLVYRFGTYISLPGINIDALRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + +PSLE LKKEGE GRKVI
Sbjct: 61  ASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSVIPSLETLKKEGEIGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ILQA+GIAV L++G G    IV +    F  S++ITL+GGTMFL+WLG
Sbjct: 121 NQYTRYVTVILAILQAFGIAVALESGIGTGLQIVVEPGLMFRISSVITLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNGVSLIIF+GIVA LPS+   +L       +ST L++ I    V VI L++
Sbjct: 181 EQITSRGVGNGVSLIIFTGIVANLPSTFAQLLTAHSQADLSTFLLVTIVLIAVLVIGLIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+LIQYPKRQVG++MFQ D+S+LPLKLNTAGV+P IFASSLLLLPATI  F D
Sbjct: 241 FIERAQRRILIQYPKRQVGHQMFQGDMSHLPLKLNTAGVIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +  SLGHG+  YM++Y+  + FF FFYTAIVFNP + AD LKKH GFIPG
Sbjct: 301 --KMPQWVQAISYSLGHGQPLYMIIYAFLMAFFCFFYTAIVFNPSDTADQLKKHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TVVGA Y++ VC+ PE +I+   VP  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVVGALYIILVCLLPEFMISAFQVPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKS--RSKKKN 443
           T+ QIQG+L+A QYEG+ KKS  R  ++N
Sbjct: 419 TVAQIQGHLVAHQYEGLIKKSKLRGGRRN 447


>gi|49474384|ref|YP_032426.1| preprotein translocase subunit SecY [Bartonella quintana str.
           Toulouse]
 gi|49239888|emb|CAF26286.1| Preprotein translocase secY subunit [Bartonella quintana str.
           Toulouse]
          Length = 448

 Score =  568 bits (1464), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 277/449 (61%), Positives = 351/449 (78%), Gaps = 8/449 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQF SN++F +FSRA +LK RI FT+ AL+VYRFGTYI LP I+  +  + F+  
Sbjct: 1   MASAAEQFASNMSFGTFSRATELKKRIWFTLAALLVYRFGTYISLPGINIDALRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + +PSLE LKKEGE GRK+I
Sbjct: 61  ASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIIPSLEALKKEGELGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L +LQA+GIAV L+ G G    IV +  + F  S++ITL+GGTMFL+WLG
Sbjct: 121 NQYTRYVTVVLAVLQAFGIAVALETGIGIGLKIVVEPGFMFRISSVITLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNGVSLIIF+GIVA LPS+   +L       +ST L+ +I    ++VIA+++
Sbjct: 181 EQITSRGVGNGVSLIIFTGIVANLPSTFAQLLTAHSQADLSTFLLTIIVLIAISVIAVIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+LIQYPKRQVGN++FQ D+S+LPLKLNTAGV+P IFASSLLLLPAT+  F D
Sbjct: 241 FVERAQRRILIQYPKRQVGNQIFQGDMSHLPLKLNTAGVIPPIFASSLLLLPATVNNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +  SLGHG+  YM++Y++ + FF FFYTAIVFNP + AD LKKH GFIPG
Sbjct: 301 --KMPQWVQAVSYSLGHGQPLYMIIYAILMAFFCFFYTAIVFNPNDTADQLKKHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TV+GA Y++ VC+ PE +I+   VP  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVIGAIYIILVCLLPEFIISALQVPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKS--RSKKKN 443
           T+ QIQG+L+A QYEG+ KKS  R  K+N
Sbjct: 419 TVAQIQGHLVAHQYEGLIKKSKLRGGKRN 447


>gi|115525565|ref|YP_782476.1| preprotein translocase subunit SecY [Rhodopseudomonas palustris
           BisA53]
 gi|115519512|gb|ABJ07496.1| protein translocase subunit secY/sec61 alpha [Rhodopseudomonas
           palustris BisA53]
          Length = 443

 Score =  568 bits (1463), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 278/444 (62%), Positives = 344/444 (77%), Gaps = 1/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF++  +A++LK RI FT+ AL+VYR GTYIPLP ID   + + F+S+
Sbjct: 1   MASAAEQLAANLNFSALGKAEELKKRIWFTLGALLVYRLGTYIPLPGIDPNVWEQVFKSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASII+QL+      LE LKKEGE GRK I
Sbjct: 61  AGGILGMFNMFAGGGINRMAIFALNIMPYISASIIIQLLTTVSKQLEALKKEGEAGRKTI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L  +QAYGIAVGL+    +V++   FF+ ST +TL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVALATVQAYGIAVGLQGSGNVVTEPGAFFLVSTTVTLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LP++L  +LELGR G++ST L+L++    VAVIA ++F ER
Sbjct: 181 ARGIGNGISLIILAGIVAELPAALAGMLELGRQGALSTALILVVLVMAVAVIAFIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNTAGV+P IFASSLLLLPATI  F +V + 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTAGVIPPIFASSLLLLPATIANF-NVGTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W+  +V   GHGR  +++ Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PDWLQWIVTQFGHGRPLFLLFYIGMIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID+VL+R+TVVGA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDFVLSRITVVGAIYLAIVCLIPEILISYAAVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           +QGYL+A QYEG+ KKS+ K +  
Sbjct: 420 VQGYLLAHQYEGLIKKSKLKGRRK 443


>gi|240850815|ref|YP_002972215.1| preprotein translocase subunit SecY [Bartonella grahamii as4aup]
 gi|240267938|gb|ACS51526.1| preprotein translocase subunit SecY [Bartonella grahamii as4aup]
          Length = 448

 Score =  567 bits (1461), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/449 (62%), Positives = 347/449 (77%), Gaps = 8/449 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQF SN+NF +FSRA +LK RI FT+ AL+VYRFGTYI LP I+  +  + F+  
Sbjct: 1   MASAAEQFASNINFGTFSRATELKKRIWFTLAALLVYRFGTYISLPGINIDALRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + +PSLE LKKEGE GRK+I
Sbjct: 61  ASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIIPSLETLKKEGELGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ILQA+GIAV L++G G    IV +    F  S++ITL+GGTMFL+WLG
Sbjct: 121 NQYTRYVTVVLAILQAFGIAVALESGIGTGLQIVLEPGLMFRISSVITLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNGVSLIIF+GIVA  PS+   +L       +ST L++ I    V VI L++
Sbjct: 181 EQITSRGVGNGVSLIIFTGIVANFPSTFAQLLTAHSQADLSTFLLIGIVLIAVLVIGLIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+LIQYPKRQVGN+MFQ D+S+LPLKLNTAGV+P IFASSLLLLPATI  F D
Sbjct: 241 FIERAQRRILIQYPKRQVGNQMFQGDMSHLPLKLNTAGVIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +  +LGHG+  YM++Y+  + FF FFYTAIVFNP + AD LKKH GFIPG
Sbjct: 301 --KMPQWVQAISYALGHGQPLYMIVYAFLMAFFCFFYTAIVFNPSDTADQLKKHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TVVGA Y++ VC+ PE +I+   VP  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVVGAVYIILVCLLPEFMISALQVPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKS--RSKKKN 443
           T+ QIQGYL+A QYEG+ KKS  R  ++N
Sbjct: 419 TVAQIQGYLVAHQYEGLIKKSKLRGGRRN 447


>gi|154248695|ref|YP_001419653.1| preprotein translocase subunit SecY [Xanthobacter autotrophicus
           Py2]
 gi|154162780|gb|ABS69996.1| preprotein translocase, SecY subunit [Xanthobacter autotrophicus
           Py2]
          Length = 444

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 341/440 (77%), Gaps = 1/440 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF +  +A++LK RI FT+ ALIVYR GTYIP+P I+  + +  F++ 
Sbjct: 1   MVSAAEQLAANLNFGALGKAEELKKRIWFTLGALIVYRLGTYIPMPGINPDALADVFKNA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI GLFNMFSGGAVERMA+F+L IMPYISASII+QL+ +  P+LE LKKEGE GRK +
Sbjct: 61  QQGIIGLFNMFSGGAVERMAIFALNIMPYISASIIIQLLTSVSPTLEALKKEGEAGRKQL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L + QAYGIAVGL+    +V+D  +FF  +T+ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLAVFQAYGIAVGLEGSGSVVADPGWFFRITTVITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF GIVA LP + V  L+LGR G+ISTPL+L      V VIA ++F ER
Sbjct: 181 SRGIGNGTSLIIFGGIVAELPGAFVRTLQLGREGAISTPLILAALVLAVVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNR+++   S+LPLKLNT+GV+P IFASSLLL+P TI  F+   S 
Sbjct: 241 AQRRLLIQYPKRQVGNRIYEGQSSHLPLKLNTSGVIPPIFASSLLLIPTTIASFLQ-GSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W+  +   +GHGR  YMVLY + IVFF FFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWLQTITTHIGHGRPAYMVLYVLLIVFFCFFYTAIVFNPVETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVLTR+TVVGA Y+  VC+FPE LI+   +P    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLTRITVVGAAYIAAVCLFPELLISYASLPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQG+L+A QYEG+ KK++ +
Sbjct: 420 IQGHLLAHQYEGLVKKAKLR 439


>gi|299135237|ref|ZP_07028428.1| preprotein translocase, SecY subunit [Afipia sp. 1NLS2]
 gi|298590214|gb|EFI50418.1| preprotein translocase, SecY subunit [Afipia sp. 1NLS2]
          Length = 443

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 277/444 (62%), Positives = 344/444 (77%), Gaps = 1/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF+SF++A +LK RI FT+ AL+VYR GTYIPLP ID   +S+ F+S+
Sbjct: 1   MVSAAEQLAANLNFSSFAKADELKKRIWFTLGALVVYRLGTYIPLPGIDPSVWSQVFKSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMFSGG ++RMAVF+L IMPYISASII+QL+    P LE LKKEGE GRK+I
Sbjct: 61  AGGILGVFNMFSGGGIDRMAVFALNIMPYISASIIIQLLQTVSPQLEALKKEGEAGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYGIA+GL+    +VS+   FF+ ST +TL GGTMFL+WLGEQ+T
Sbjct: 121 NQYTRYLTVVLAAFQAYGIAIGLQGAGNVVSNPGMFFLLSTAVTLTGGTMFLMWLGEQVT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LP+++ + LELGR G++ST ++L I    V VIA+++F ER
Sbjct: 181 SRGIGNGISLIIMAGIVAELPTAIANTLELGRQGALSTVVILAILIMAVVVIAVIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGNRMF+   S+LPLKLNT+GV+P IFASSLLLLP TI  F +    
Sbjct: 241 AQRRLLIQYPKRQVGNRMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTIASF-NAGKG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   L   LGHGR  +++LY   IVFF FFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWLTTQLGHGRPLFLILYLALIVFFTFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TV+GA YL  VC+ PE LI+   VP  L GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVIGAIYLAAVCLVPEILISYASVPFYLGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           +QGY++A QYEG+ +KS+ + +  
Sbjct: 420 VQGYMLAHQYEGLIRKSKLRGRRK 443


>gi|316933547|ref|YP_004108529.1| preprotein translocase subunit SecY [Rhodopseudomonas palustris
           DX-1]
 gi|315601261|gb|ADU43796.1| preprotein translocase, SecY subunit [Rhodopseudomonas palustris
           DX-1]
          Length = 443

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 282/444 (63%), Positives = 341/444 (76%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF++  +A++LK RI FT+ AL+VYR GTYIPLP ID   + + F+ +
Sbjct: 1   MVSAAEQLAANLNFSALGKAEELKKRIWFTLGALLVYRLGTYIPLPGIDPNVWEQVFRQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASIIVQL+    P LE LKKEGE GRK I
Sbjct: 61  AGGILGMFNMFAGGGIHRMAIFALNIMPYISASIIVQLLTTVSPQLEALKKEGESGRKTI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L + Q+YGIAVGL+    +VSD   FF  ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLALFQSYGIAVGLEGAGNVVSDPGMFFRLSTTITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L S+LELGR G++ST L+L++    V VIA ++F ER
Sbjct: 181 SRGIGNGISLIILAGIVAELPSALASMLELGRQGALSTGLILVVLVMAVVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNTAGV+P IFASSLLLLP TI  F +  S 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTAGVIPPIFASSLLLLPTTIANF-NAGSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V   GHGR  +++ Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWIVTQFGHGRPLFLLFYISMIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TVVGA YL  VC+ PE +I+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVVGAIYLAVVCLIPEVMISYAAVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           +QGYL+A QYEG+ KKS  R +KK
Sbjct: 420 VQGYLLAHQYEGLIKKSKLRGRKK 443


>gi|86749435|ref|YP_485931.1| preprotein translocase subunit SecY [Rhodopseudomonas palustris
           HaA2]
 gi|86572463|gb|ABD07020.1| protein translocase subunit secY/sec61 alpha [Rhodopseudomonas
           palustris HaA2]
          Length = 443

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 280/444 (63%), Positives = 342/444 (77%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF++  +A++LK RI FT+ AL+VYR GTYIPLP ID   + + F+S+
Sbjct: 1   MVSAAEQLAANLNFSALGKAEELKKRIWFTLGALLVYRLGTYIPLPGIDPTVWEQVFKSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASIIVQL+    P LE LKKEGE GRK +
Sbjct: 61  AGGILGMFNMFAGGGIHRMAIFALNIMPYISASIIVQLLTTVSPQLEALKKEGESGRKTL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   Q+YGIAVGL+    +VS+   FF+ ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVILAAFQSYGIAVGLQGAGNVVSEPGAFFLLSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L S+LELGR G++ST L+LL+   +V VIA ++F ER
Sbjct: 181 SRGIGNGISLIILAGIVAELPSALASMLELGRQGALSTALILLVLVMSVVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNT+GV+P IFASSLLLLP TI  F +  + 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTIASF-NSGTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V   GHGR  ++V Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWIVTQFGHGRPLFLVFYIAMIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID+VLTR+T VGA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDFVLTRITAVGAIYLAIVCLIPEVLISYAAVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           +QGYL+A QYEG+ +KS  R +KK
Sbjct: 420 VQGYLLAHQYEGLIRKSKLRGRKK 443


>gi|39936293|ref|NP_948569.1| preprotein translocase subunit SecY [Rhodopseudomonas palustris
           CGA009]
 gi|192292017|ref|YP_001992622.1| preprotein translocase subunit SecY [Rhodopseudomonas palustris
           TIE-1]
 gi|39650148|emb|CAE28671.1| secretion protein SecY [Rhodopseudomonas palustris CGA009]
 gi|192285766|gb|ACF02147.1| preprotein translocase, SecY subunit [Rhodopseudomonas palustris
           TIE-1]
          Length = 443

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/444 (63%), Positives = 342/444 (77%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF++  +A++LK RI FT+ AL+VYRFGTYIPLP ID   + + F+ +
Sbjct: 1   MVSAAEQLAANLNFSALGKAEELKKRIWFTLGALLVYRFGTYIPLPGIDPNVWEQVFRQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASIIVQL+    P LE LKKEGE GRK +
Sbjct: 61  AGGILGMFNMFAGGGIHRMAIFALNIMPYISASIIVQLLTTVSPQLEALKKEGESGRKTL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L + Q+YGIAVGL+    +VSD   FF  ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVILALFQSYGIAVGLEGAGNVVSDPGMFFRLSTTITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L ++LELGR G++ST L+L++    V VIA ++F ER
Sbjct: 181 SRGIGNGISLIILAGIVAELPSALANMLELGRQGALSTGLILVVLVMAVVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNTAGV+P IFASSLLLLP TI  F +  S 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTAGVIPPIFASSLLLLPTTIANF-NAGSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V   GHGR  +++ Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWIVTQFGHGRPLFLLFYIGMIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +IDYVL+R+TVVGA YL  VC+ PE +I+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDYVLSRITVVGAIYLAIVCLIPEIMISYASVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           +QGYL+A QYEG+ KKS  R +KK
Sbjct: 420 VQGYLLAHQYEGLIKKSKLRGRKK 443


>gi|121602796|ref|YP_989017.1| preprotein translocase subunit SecY [Bartonella bacilliformis
           KC583]
 gi|120614973|gb|ABM45574.1| preprotein translocase, SecY subunit [Bartonella bacilliformis
           KC583]
          Length = 448

 Score =  561 bits (1445), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/445 (61%), Positives = 344/445 (77%), Gaps = 6/445 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SN+NF++FSRA +LK RI FT+ AL+VYRFGTYI +P ++  +  + F+  
Sbjct: 1   MASAAEQLASNINFSTFSRATELKKRIWFTLAALLVYRFGTYISIPGVNIDTLRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GL NMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE+LKKEGE GRK+I
Sbjct: 61  ASGMLGLVNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIVPSLESLKKEGELGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ++QA+G+AV L+ G G    IV +    F FS +ITL+GGTMFL+WLG
Sbjct: 121 NQYTRYVTVILALVQAFGVAVALETGIGTGLQIVVEPGLMFRFSAVITLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNG+SLIIF+GIVA  PS+   +L       +ST L++ I    V+V+ +++
Sbjct: 181 EQITSRGVGNGISLIIFTGIVANFPSTFAQLLTAHSQADLSTFLLIGIIIIAVSVVGIIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+LIQYPKRQVGN+MFQ DVS+LPLKLNTAGV+P IFASSLLLLPATI  F D
Sbjct: 241 FVERAQRRILIQYPKRQVGNQMFQGDVSHLPLKLNTAGVIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P WI  +  SL HG+  YM++Y+  I FF FFYTAIVFNP + AD LKKH GFIPG
Sbjct: 301 --QMPEWIQSVSFSLSHGQPLYMIIYAALIAFFCFFYTAIVFNPNDTADQLKKHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG RTA +IDYVLTR+TV+GA Y++ VC+ PE +I+   VP  L GTSLLI+V+V LD
Sbjct: 359 IRPGKRTAEYIDYVLTRITVIGAIYIILVCLLPEFMISALHVPFYLGGTSLLIVVNVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSKK 441
           T+ QIQG+L+A QYEG+ KKS+ +K
Sbjct: 419 TVAQIQGHLVAHQYEGLIKKSKLRK 443


>gi|90424917|ref|YP_533287.1| preprotein translocase subunit SecY [Rhodopseudomonas palustris
           BisB18]
 gi|90106931|gb|ABD88968.1| protein translocase subunit secY/sec61 alpha [Rhodopseudomonas
           palustris BisB18]
          Length = 443

 Score =  560 bits (1444), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/444 (61%), Positives = 341/444 (76%), Gaps = 1/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF++  +A++LK RI FT+ AL+VYR GTYIPLP ID   + + F+S+
Sbjct: 1   MVSAAEQLAANLNFSALGKAEELKKRIWFTLGALLVYRLGTYIPLPGIDPHIWDQVFKSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASII+QL+    P LE LKKEGE GRK I
Sbjct: 61  AGGILGMFNMFAGGGINRMAIFALNIMPYISASIIIQLLTTVSPQLEALKKEGESGRKTI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   Q+YGIAVGL+    +VS+   FF+ ST +TL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLAAFQSYGIAVGLQGAGNVVSEPGMFFLISTAVTLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L  +LELGR G++ST ++L++    V VIA ++F ER
Sbjct: 181 SRGIGNGISLIILAGIVAELPSALAGMLELGRQGALSTGIILVVLVMAVVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNT+GV+P IFASSLLLLPAT+  F +  S 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPATVANF-NAGSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +   LGHGR  +++ Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PEWFQWITTQLGHGRPLFLLFYIGMIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID+VL+R+TV+GA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDFVLSRITVIGAAYLAIVCLIPEILISYAAVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           +QGYL+A QYEG+ +KS+ + +  
Sbjct: 420 VQGYLLAHQYEGLIRKSKLRGRRK 443


>gi|217976747|ref|YP_002360894.1| preprotein translocase, SecY subunit [Methylocella silvestris BL2]
 gi|217502123|gb|ACK49532.1| preprotein translocase, SecY subunit [Methylocella silvestris BL2]
          Length = 442

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 272/445 (61%), Positives = 343/445 (77%), Gaps = 4/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N+N+++F +A++LK RI FT+ ALIV+R GTYIPLP ID  ++   F + 
Sbjct: 1   MVSAAEQLAANVNWSAFGKAEELKKRIWFTLGALIVFRLGTYIPLPGIDPAAFEANFTNH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+  LFNMF+GGAV+RMA+F+L IMPYISASII+QL+ + +P+LE LKKEGE GRKVI
Sbjct: 61  KQGVLELFNMFAGGAVQRMAIFALNIMPYISASIIIQLLTSVIPTLEALKKEGESGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYGIAVGL++ QG+V+D  +FF  ST++TLLGGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLAAFQAYGIAVGLESQQGVVTDPGWFFRVSTVLTLLGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA  PS++++ LELGR G+IST L++ +   +V VIA ++F ER
Sbjct: 181 SRGIGNGSSLIIFAGIVAAFPSAIINTLELGRQGAISTGLIIAVLVMSVGVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQ GN++++   S+LPLKLNTAGV+P IFASSLLLLP TI  F   S +
Sbjct: 241 AQRRLLITYPKRQQGNKVYEGQTSFLPLKLNTAGVIPPIFASSLLLLPTTIANF---SQN 297

Query: 301 PTWIVGLVDS-LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRP 359
            + IV L  S L HGR  YMV Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRP
Sbjct: 298 QSGIVALFSSYLAHGRPLYMVAYVGLIVFFAFFYTAIVFNPVETADNLKKHGGFIPGIRP 357

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G+RTA +ID +L R+TV+GA YL  +C+ PE LI+   +P    GTSLLI+VSV +DT+ 
Sbjct: 358 GERTAQYIDTILMRITVIGAAYLAVICLLPEMLISYAALPFYFGGTSLLIVVSVTMDTVA 417

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           Q+ G+L A QYEG+ KK++ + +  
Sbjct: 418 QVLGHLQAHQYEGLVKKAKLRGRRK 442


>gi|91977632|ref|YP_570291.1| preprotein translocase subunit SecY [Rhodopseudomonas palustris
           BisB5]
 gi|91684088|gb|ABE40390.1| protein translocase subunit secY/sec61 alpha [Rhodopseudomonas
           palustris BisB5]
          Length = 443

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 276/444 (62%), Positives = 341/444 (76%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NLNF++  +A++LK RI FT+ AL+VYR GTYIPLP ID   + + F+S+
Sbjct: 1   MVSAAEQLAANLNFSALGKAEELKKRIWFTLGALLVYRLGTYIPLPGIDPTVWEQVFKSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMF+GG + RMA+F+L IMPYISASIIVQL+    P LE LKKEGE GRK +
Sbjct: 61  AGGILGMFNMFAGGGIHRMAIFALNIMPYISASIIVQLLTTVSPQLEALKKEGESGRKTL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   Q+YGIAVGL+    +VS+   FF+ ST ITL GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVILAAFQSYGIAVGLQGAGNVVSEPGAFFLLSTAITLTGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLII +GIVA LPS+L ++LELGR G++ST L+L++    V VIA ++F ER
Sbjct: 181 SRGIGNGISLIILAGIVAELPSALANMLELGRQGALSTGLILVVLVMAVVVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLIQYPKRQVGN+MF+   S+LPLKLNT+GV+P IFASSLLLLP TI  F +  + 
Sbjct: 241 AQRRLLIQYPKRQVGNKMFEGQSSHLPLKLNTSGVIPPIFASSLLLLPTTIASF-NSGTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W   +V   GHGR  +++ Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 300 PDWFQWIVTQFGHGRPLFLLFYIAMIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID+VL+R+T VGA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAEYIDFVLSRITAVGAIYLAIVCLIPEGLISYASVPFYFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKS--RSKKK 442
           +QGYL+A QYEG+ +KS  R +KK
Sbjct: 420 VQGYLLAHQYEGLIRKSKLRGRKK 443


>gi|220921919|ref|YP_002497220.1| preprotein translocase subunit SecY [Methylobacterium nodulans ORS
           2060]
 gi|219946525|gb|ACL56917.1| preprotein translocase, SecY subunit [Methylobacterium nodulans ORS
           2060]
          Length = 445

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/438 (61%), Positives = 339/438 (77%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF + ++A++LK RI FT+ ALIVYR GTYIPLP ID  +  ++F + 
Sbjct: 1   MASAAEQLAANLNFGAIAKAEELKKRIWFTLGALIVYRLGTYIPLPGIDPDALRQSFANA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+ GLFNMFSGGAVERMA+F+L IMPYISASIIVQL+ + +PSLE LKKEGE GRKV+
Sbjct: 61  QGGVLGLFNMFSGGAVERMAIFALNIMPYISASIIVQLLTSVLPSLEALKKEGESGRKVL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L + QA+GIAVGL++  GIV +   FF  ST+ITL GGT+FL+W+GEQIT
Sbjct: 121 NQYTRYLTVVLAVFQAWGIAVGLQSSGGIVQEPGPFFAISTVITLTGGTLFLMWIGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA LPS++   LELGR G++ST ++L +     AV+  ++F ER
Sbjct: 181 SRGIGNGSSLIIFAGIVAHLPSAIAGTLELGRQGALSTAVILGVAVMAAAVVYFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQVGNRM++   S++PLKLNT GV+P IFASSLLLLPAT   F    + 
Sbjct: 241 AQRRLLINYPKRQVGNRMYEGQTSFMPLKLNTPGVIPPIFASSLLLLPATAASFQTDPNG 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
              +  L   LGHGR  YM+LY+  I+FFAFFYTA+VFNP+E A+NLKKHGGFIPGIRPG
Sbjct: 301 TGIVATLATYLGHGRPLYMILYAALIIFFAFFYTAVVFNPQETAENLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA +ID VL+R+TV+GA YL  +C+ PE L++   +P    GTSLLI+VSV +DT+ Q
Sbjct: 361 ERTAEYIDKVLSRITVIGAAYLTLICLIPEILVSYASLPFYFGGTSLLIVVSVTMDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSR 438
           + G+L+A QYEG+ KK++
Sbjct: 421 VHGHLLAHQYEGLVKKAK 438


>gi|154253197|ref|YP_001414021.1| preprotein translocase subunit SecY [Parvibaculum lavamentivorans
           DS-1]
 gi|154157147|gb|ABS64364.1| preprotein translocase, SecY subunit [Parvibaculum lavamentivorans
           DS-1]
          Length = 443

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/440 (61%), Positives = 336/440 (76%), Gaps = 1/440 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNFA+FS+A +LK RI FT+ ALIVYR GTY+PLP ID  + ++ F  +
Sbjct: 1   MASAAEQLAANLNFAAFSKATELKKRIWFTLGALIVYRLGTYVPLPGIDPSALAQVFSQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +G+ G+F+MF+GGA+ RMA+F+L IMPYISASII+QL+    P L  LKKEGEQGRK I
Sbjct: 61  QSGLLGVFDMFAGGAIGRMAIFALAIMPYISASIIIQLMTTVSPHLAQLKKEGEQGRKQI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L  LQ YGIAVGL+  Q +V D   FF  +T+ITL+GGT+FL+WLGEQIT
Sbjct: 121 NQYTRYGTVVLATLQGYGIAVGLEGAQNVVIDPGIFFRITTVITLVGGTVFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RG+GNG+SLIIF+GIVA LP +L   LELGR G++ST ++L +    V VI  ++F ER
Sbjct: 181 SRGVGNGISLIIFAGIVAELPRALAGTLELGRQGALSTAIILFLAVMVVIVIMAIVFVER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLL+QYPKRQVGN+++  D S+LPLKLNTAGV+P IFASSLLLLP TI  F      
Sbjct: 241 AQRRLLVQYPKRQVGNKLYGGDSSHLPLKLNTAGVIPPIFASSLLLLPVTIANFTS-GQG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
           P W+  +   LGHG+  YM  Y+  I+FFAFFYTAIVFNP++ ADNLKK+GGFIPGIRPG
Sbjct: 300 PDWLNSVTALLGHGQPLYMAFYAAGIIFFAFFYTAIVFNPQDTADNLKKYGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
            RTA +IDYVLTR+T VGA YL  VC+ PE LI+   VP    GTSLLI+VSV +DT+ Q
Sbjct: 360 QRTAEYIDYVLTRLTAVGAIYLTIVCLLPELLISQYSVPFYFGGTSLLIVVSVTMDTVSQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           IQ +L+A QYEG+ KKS+ +
Sbjct: 420 IQSHLLAHQYEGLIKKSKLR 439


>gi|296447550|ref|ZP_06889472.1| preprotein translocase, SecY subunit [Methylosinus trichosporium
           OB3b]
 gi|296254938|gb|EFH02043.1| preprotein translocase, SecY subunit [Methylosinus trichosporium
           OB3b]
          Length = 444

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/444 (59%), Positives = 338/444 (76%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NF++FS+A +LK RI FT+ ALIVYR GTYIPLP ID  +++K+F  +
Sbjct: 1   MASAAEQLAANVNFSAFSKADELKKRIWFTLGALIVYRLGTYIPLPGIDPEAFAKSFFGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+  LFNMF+GGAV+R A+F+L IMPYISASII+QL+   +P+LE +KKEGEQGRKV+
Sbjct: 61  SKGVLELFNMFAGGAVQRSAIFALNIMPYISASIIIQLLTTVIPTLEQVKKEGEQGRKVL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYG+A+GL+  QG+V++   FF  +T+ TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLATFQAYGMAIGLEGQQGVVTEPGLFFRLTTVCTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA  P++++S LELGR G+IST L+L + + +  VIA +++ ER
Sbjct: 181 SRGIGNGSSLIIFAGIVAAFPAAILSTLELGRQGAISTGLILGVLAMSFFVIAFIVYMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQ GNR+++   S+LPLKLNT+GV+P IFASSLLLLP TI  F     +
Sbjct: 241 AQRRLLITYPKRQHGNRVYEGQTSFLPLKLNTSGVIPPIFASSLLLLPTTIANFYQTQGT 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
                 +    GHGR  YM+ Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 301 DNLFATISAYFGHGRPLYMLSYVALIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA  ID VL R+TV+GA YL  +C+ PE LI+   +P    GTSLLI+VSV +DT+ Q
Sbjct: 361 ERTAKFIDDVLMRITVLGAAYLAVICLLPEMLISYANLPFYFGGTSLLIVVSVTMDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           I G+L A QYEG+ +K++ + +  
Sbjct: 421 IHGHLQAHQYEGLIRKTKLRGRRK 444


>gi|323136106|ref|ZP_08071189.1| preprotein translocase, SecY subunit [Methylocystis sp. ATCC 49242]
 gi|322399197|gb|EFY01716.1| preprotein translocase, SecY subunit [Methylocystis sp. ATCC 49242]
          Length = 444

 Score =  554 bits (1428), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/444 (59%), Positives = 340/444 (76%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+N ++F ++++LK RI FT+ ALIVYR GTY+PLP ID  +++K+F  +
Sbjct: 1   MASAAEQLAANVNLSAFGKSEELKKRIWFTLGALIVYRLGTYVPLPGIDPDAFAKSFFGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+  LFNMF+GGAV+R A+F+L IMPYISASII+QL+ +  P+LE+LKKEGEQGRKV+
Sbjct: 61  SKGMLELFNMFAGGAVQRRAIFALNIMPYISASIIIQLLTSVFPTLESLKKEGEQGRKVL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QAY +A+GL+  QG+V+D   FF  +T++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVALATFQAYAMAIGLEGQQGVVTDPGIFFRITTVVTLVGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA  PS++VS LELGR G+IST ++L + + +  VIA ++F ER
Sbjct: 181 SRGIGNGSSLIIFAGIVAAFPSAIVSTLELGRQGAISTGIILGVIAMSFFVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQ GNR+++   S+LPLKLNT+GV+P IFASSLLLLP T+  F   + +
Sbjct: 241 AQRRLLITYPKRQHGNRVYEGQTSFLPLKLNTSGVIPPIFASSLLLLPTTVANFYQSTGT 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
            +    +    GHGR  YM+ Y   IVFFAFFYTAIVFNP E ADNLKKHGGFIPGIRPG
Sbjct: 301 DSIFATISAYFGHGRPLYMLAYVGLIVFFAFFYTAIVFNPTETADNLKKHGGFIPGIRPG 360

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA  ID VL R+TV+GA YL  +C+ PE LIA   +P    GTSLLI+VSV +DT+ Q
Sbjct: 361 ERTAKFIDDVLMRITVLGAAYLAIICLLPEGLIAYANLPFYFGGTSLLIVVSVTMDTVAQ 420

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           I G++ AQQYEG+ +K++ K +  
Sbjct: 421 IHGHMQAQQYEGLIRKTKLKGRRK 444


>gi|319408745|emb|CBI82402.1| translocase SecY subunit precursor [Bartonella schoenbuchensis R1]
          Length = 448

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 276/449 (61%), Positives = 343/449 (76%), Gaps = 8/449 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SN+NF +FSRA +LK RI FT+ AL+VYRFGTYI LP I+  +  + F+  
Sbjct: 1   MASAAEQLASNINFGTFSRATELKKRIWFTLAALLVYRFGTYISLPGINIDALRQTFEQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GL NMF+GGAV RMA+F+LGIMPYISASIIVQL+ + +PSLE+LKKEGE GRK+I
Sbjct: 61  ASGVLGLVNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIIPSLESLKKEGELGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ILQA+G+AV L+ G G    IV +    F  S +ITL+GGTMFL+WLG
Sbjct: 121 NQYTRYVTVVLAILQAFGVAVALETGIGTGLQIVLEPGIMFRVSAVITLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNGVSLIIF+GIVA  PS+   +L       +ST L++ I    + V+  ++
Sbjct: 181 EQITSRGVGNGVSLIIFTGIVANFPSTFAQLLTAHSQADLSTFLLIGIVLIIIFVVGFIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+LIQYPKRQVGN+MFQ D+S+LPLKLNTAG++P IFASSLLLLPATI  F D
Sbjct: 241 FIERAQRRILIQYPKRQVGNQMFQSDMSHLPLKLNTAGIIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P WI  +  SLGHG+  YM++Y+  + FF FFYTAIVFNP + AD LKKH GFIPG
Sbjct: 301 --KMPQWIQTISFSLGHGQPLYMIIYAALMAFFCFFYTAIVFNPSDTADQLKKHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TVVGA Y++ VC+ PE +I+   VP  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVVGAIYIILVCLLPEFMISALHVPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKS--RSKKKN 443
           T+ QIQG+L+A QYEG+ KKS  R  K+N
Sbjct: 419 TVAQIQGHLVAHQYEGLIKKSKLRGGKRN 447


>gi|319899079|ref|YP_004159172.1| translocase SecY subunit precursor [Bartonella clarridgeiae 73]
 gi|319403043|emb|CBI76598.1| translocase SecY subunit precursor [Bartonella clarridgeiae 73]
          Length = 448

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 274/444 (61%), Positives = 342/444 (77%), Gaps = 6/444 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQFVSN+NF +FSRA +LK RI FT+ AL+VYRFGTYI LP I+     + F+  
Sbjct: 1   MASAAEQFVSNMNFGAFSRATELKKRIWFTLAALLVYRFGTYISLPGINIDVLRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S+G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + +PSLE LKKEGE GRK+I
Sbjct: 61  SSGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIIPSLEALKKEGELGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ILQA+GIAV L+ G G    IV +    F  S +I+L+GGT+FL+WLG
Sbjct: 121 NQYTRYMTVILAILQAFGIAVALETGIGTGLQIVIEPGIMFRVSAVISLVGGTIFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNGVSLIIF+GIVA  PS+   +L       +ST L++ IF   V+VI +++
Sbjct: 181 EQITSRGVGNGVSLIIFAGIVANFPSTFAQLLTAHSQADLSTFLLIGIFVIAVSVIGVIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR++IQYPKRQVGN+MFQ D+S+ PLKLNTAGV+P IFASSLLLLPATI  F D
Sbjct: 241 FVERAQRRIIIQYPKRQVGNQMFQGDMSHFPLKLNTAGVIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P WI  +   LGHG+  YM++Y+  + FF FFYTAIVFNP + A+ LK+H GFIPG
Sbjct: 301 --KMPQWIQAVSFFLGHGQPLYMIVYAALMAFFCFFYTAIVFNPSDTAEQLKRHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TVVGA Y++ +C+ PE +I+   VP  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVVGAIYIILICLLPEFMISTLHVPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSK 440
           TI QIQG L+A QY+G+ KKS+ +
Sbjct: 419 TIAQIQGSLVAHQYKGLIKKSKLR 442


>gi|300022561|ref|YP_003755172.1| preprotein translocase subunit SecY [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524382|gb|ADJ22851.1| preprotein translocase, SecY subunit [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 447

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 263/442 (59%), Positives = 343/442 (77%), Gaps = 5/442 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  SNLNF++F++A+DLK R+ FT+ ALIVYR GT+IP+P I+  ++++ F+S+
Sbjct: 1   MVSAAEQLASNLNFSAFAKAEDLKRRLWFTLGALIVYRLGTFIPMPGINPAAFAETFKSQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+FNMFSGGA+ER+A+F+L IMPYISASII+QL+ +  P LE LKKEGE GRK I
Sbjct: 61  AGGILGMFNMFSGGALERLAIFALNIMPYISASIIMQLMTSISPKLEALKKEGEAGRKQI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQ----GIVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L  LQAYGIAVGL+  Q     +V D   FF  +T+ITL+GGT+FL+WLG
Sbjct: 121 NQYTRYLTVVLAALQAYGIAVGLEGSQNSAGAVVLDPGLFFRATTVITLVGGTVFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQ+T RG+GNG SLIIF+GIVAGLP ++V + EL R GSIS  ++L      +AV+A ++
Sbjct: 181 EQVTQRGVGNGTSLIIFAGIVAGLPGAVVQLFELSRTGSISPAILLFFIVLALAVVAAIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F E+AQRRLL+QYPKRQVGN+MFQ + S+LPLKLN +GV+P IFASSLLLLP T+  F  
Sbjct: 241 FCEQAQRRLLVQYPKRQVGNKMFQGEASHLPLKLNPSGVIPPIFASSLLLLPITVAQF-T 299

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+   V  LG G+  ++ +Y+  I+FF FFYTA+V NPKE ADNL+K+GGF+PG
Sbjct: 300 AGQGPEWLNTAVAMLGSGQPLHLFIYAAMIIFFTFFYTAVVINPKETADNLRKYGGFLPG 359

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG++TA +IDYV+TR+TVVGA YL  VC+ PE L +  G+P+   GTSLLI VSV +D
Sbjct: 360 IRPGEKTAEYIDYVMTRITVVGALYLAAVCVLPEILTSYAGIPLYFGGTSLLIAVSVTMD 419

Query: 417 TIVQIQGYLIAQQYEGVFKKSR 438
           T+ Q+QG+LIAQQYEG+ KK++
Sbjct: 420 TVSQVQGHLIAQQYEGLIKKAK 441


>gi|218509949|ref|ZP_03507827.1| preprotein translocase subunit SecY [Rhizobium etli Brasil 5]
          Length = 418

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 275/401 (68%), Positives = 333/401 (83%), Gaps = 2/401 (0%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           AL+VYR GT+IPLP ++  +Y++AF+ ++ GI GLFNMFSGGAV+RMA+F+LGIMPYISA
Sbjct: 16  ALLVYRLGTHIPLPGLNPEAYAQAFRGQAGGILGLFNMFSGGAVQRMAIFALGIMPYISA 75

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SIIVQL+ + VP+LENLKKEGEQGRK+INQYTRY TV+LG LQAYGIA GL++GQG+V D
Sbjct: 76  SIIVQLMTSVVPALENLKKEGEQGRKIINQYTRYGTVILGALQAYGIAAGLESGQGLVVD 135

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
             +FF  ST++TLLGGTMFL+WLGEQIT RGIGNG+SLIIF+GI AGLP++L   LELGR
Sbjct: 136 PGWFFRVSTVLTLLGGTMFLMWLGEQITSRGIGNGISLIIFAGIAAGLPTALAGTLELGR 195

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            G++STPL+LL+    + VI +++F ERAQRRLLIQYPKRQVGNRMFQ D S+LPLKLNT
Sbjct: 196 TGALSTPLILLVIIVAIGVIGVIVFVERAQRRLLIQYPKRQVGNRMFQGDTSHLPLKLNT 255

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           +GV+P+IFASSLLLLPATI GF   ++ P W   +V +LGHGR  YMVLY+  I FFAFF
Sbjct: 256 SGVIPAIFASSLLLLPATIAGFASTTAMPAWATSIVAALGHGRPLYMVLYAALIAFFAFF 315

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFP-EA 391
           YTAIVFNPK+ ADNLKKHGGFIPGIRPG+RTA +IDYVLTR+T++GA YLV VCI   ++
Sbjct: 316 YTAIVFNPKDTADNLKKHGGFIPGIRPGERTAEYIDYVLTRITLIGAIYLVFVCIPSGDS 375

Query: 392 LIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGY-LIAQQYE 431
            +A         GTSLLI+VSV LDT+ QI G+ LIAQQYE
Sbjct: 376 GVANPAFHYPFGGTSLLIVVSVTLDTVAQIPGFTLIAQQYE 416


>gi|182678357|ref|YP_001832503.1| preprotein translocase, SecY subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634240|gb|ACB95014.1| preprotein translocase, SecY subunit [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 444

 Score =  551 bits (1421), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/445 (60%), Positives = 340/445 (76%), Gaps = 4/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  SN+N+ +FS+A +LK RI FT+ ALI+YR GTYIPLP ID  ++   F   
Sbjct: 1   MVSAAEQLASNVNWGAFSKATELKQRIWFTLGALIIYRLGTYIPLPGIDPAAFEANFTGN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+  LFNMF+GGAV+RMA+F+L IMPYISASII+QL+ + +P+LE LKKEGE GRKV+
Sbjct: 61  RQGVLELFNMFAGGAVQRMAIFALNIMPYISASIIIQLLTSVLPALETLKKEGEAGRKVM 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYGIAVGL++  G+V++  +FF  ST++TL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYLTVILAAFQAYGIAVGLESQAGVVTEPGFFFRISTVLTLMGGTMFLMWLGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA  PS++++ LELGR G+IST +++ +   ++AVIA ++F ER
Sbjct: 181 SRGIGNGSSLIIFAGIVAAFPSAILNTLELGRQGAISTGVIIGVIIMSIAVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRR+LI YPKRQ GNR+++   S+LPLKLNT+GV+P IFASSLLLLP TI  F   +  
Sbjct: 241 AQRRVLITYPKRQQGNRVYEGQTSFLPLKLNTSGVIPPIFASSLLLLPTTIANF-SQNQG 299

Query: 301 PTWIVGLVDS-LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRP 359
            T I+  V + L HGR  YM  Y   IVFFAFFYTAIVFNP E ADNLKKHGGF+PGIRP
Sbjct: 300 GTGILATVSAYLAHGRPLYMAAYVALIVFFAFFYTAIVFNPVETADNLKKHGGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G+RTA +ID +L R+TV+GA YL  +C+ PE LI+   +P    GTSLLI+VSV +DT+ 
Sbjct: 360 GERTAQYIDTILMRITVLGAAYLAVICLLPEILISYAALPFYFGGTSLLIVVSVTMDTVA 419

Query: 420 QIQGYLIAQQYEGVFKKS--RSKKK 442
           QI G+L A QYEG+ KK+  R K+K
Sbjct: 420 QIHGHLQAHQYEGLIKKAKLRGKRK 444


>gi|170748616|ref|YP_001754876.1| preprotein translocase, SecY subunit [Methylobacterium
           radiotolerans JCM 2831]
 gi|170655138|gb|ACB24193.1| preprotein translocase, SecY subunit [Methylobacterium
           radiotolerans JCM 2831]
          Length = 448

 Score =  551 bits (1419), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/444 (59%), Positives = 339/444 (76%), Gaps = 1/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF + ++A +LK RI FT+ AL+V+R GTYIP+P ID   +++ FQ +
Sbjct: 1   MASAAEQLAANLNFGAIAKADELKKRIWFTLGALVVFRLGTYIPIPGIDPEQFARNFQQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + G+ GLFNMFSGGAVERMA+F+L IMPYISASIIVQL+ + +PSLE LKKEGE GRKVI
Sbjct: 61  AGGVLGLFNMFSGGAVERMAIFALNIMPYISASIIVQLLTSVIPSLEALKKEGESGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L ++Q++GIA+GL+ G     D   FF+ ST+ITL GGT+FL+WLGEQIT
Sbjct: 121 NQYTRYLTVVLALVQSWGIAIGLQ-GSSAAIDPGPFFLASTVITLTGGTLFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA LP ++   LELGR G++S  ++L +  + VA++  ++F ER
Sbjct: 180 SRGIGNGSSLIIFAGIVAHLPVAIAGALELGRTGALSPAIILGVGVAAVALVYFIVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQVGNRM++   S+LPLKLNT+GV+P IFASSLLLLPAT   F     +
Sbjct: 240 AQRRLLINYPKRQVGNRMYEGQTSFLPLKLNTSGVIPPIFASSLLLLPATAASFSANGGA 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
             W+  +   LGHG   +MVLY+  I+FF FFYTA+VFNP+E ADNLKKHGGFIPGIRPG
Sbjct: 300 TGWLGTVTAYLGHGTPLFMVLYAALIIFFTFFYTAVVFNPQETADNLKKHGGFIPGIRPG 359

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           +RTA  ID VLTR+TV+GA YL  VC+ PE L +     +   GTSLLI+VSV +DT+ Q
Sbjct: 360 ERTAAFIDKVLTRITVIGALYLTFVCLCPEILSSYAAASLGFGGTSLLIVVSVTMDTVAQ 419

Query: 421 IQGYLIAQQYEGVFKKSRSKKKNS 444
           I G+L+A QYEG+ KK++ +  ++
Sbjct: 420 IHGHLMAHQYEGLVKKAKLRGAST 443


>gi|209964060|ref|YP_002296975.1| preprotein translocase, SecY subunit [Rhodospirillum centenum SW]
 gi|209957526|gb|ACI98162.1| preprotein translocase, SecY subunit [Rhodospirillum centenum SW]
          Length = 448

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 335/448 (74%), Gaps = 6/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NF +F++A +LK R+ FT+ AL+VYR GTY+PLP I+  +++  F   
Sbjct: 1   MASAAEQLAANINFGAFAKATELKKRLWFTLGALLVYRLGTYVPLPGINAQAFADIFSQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI G+FNMF+GGA+ERM++F+L IMPYISASII+QL+ A  PSLE LKKEGE GRK +
Sbjct: 61  SGGILGMFNMFAGGAIERMSIFALNIMPYISASIIIQLMTAVSPSLEALKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           N+YTRY TV L I Q+YG+A GL+      G G V D   FF  ST+IT++GGTMFL+WL
Sbjct: 121 NEYTRYLTVALAIFQSYGLAAGLEGLSTSAGIGAVRDPGVFFQLSTVITMVGGTMFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RG+GNG+SLIIF+GIVA LP +L  +LELGR G+I T  ++ +    VAV+  +
Sbjct: 181 GEQITARGVGNGISLIIFAGIVAALPGALAQLLELGRTGAIETWFIIFMIVMAVAVVTFI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           +F ERAQRRL++QYPKRQVGN+MF  + S+LPLKLNT+GV+P IFASSLLLLP T +GF 
Sbjct: 241 VFMERAQRRLIVQYPKRQVGNKMFGGESSHLPLKLNTSGVIPPIFASSLLLLPLTAVGF- 299

Query: 296 DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIP 355
                P W+  L   LGHG   YM LY+  I+FF FFYTAIVFNP E ADNLKK+GGFIP
Sbjct: 300 SGGQGPEWLRTLSAYLGHGTPLYMSLYAALIIFFCFFYTAIVFNPTETADNLKKYGGFIP 359

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           GIRPG  TA ++D+VLTR+TV+GA YL  VC+ PE LI+   +P    GTSLLI+V+V +
Sbjct: 360 GIRPGKNTADYLDFVLTRLTVIGAAYLTVVCLLPEFLISRYSMPFYFGGTSLLIVVTVTM 419

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           DT+ QI  +L+A QYEG+ KK++ + + 
Sbjct: 420 DTVAQIHSHLLAHQYEGLIKKAKLRGRK 447


>gi|288957442|ref|YP_003447783.1| preprotein translocase SecY subunit [Azospirillum sp. B510]
 gi|288909750|dbj|BAI71239.1| preprotein translocase SecY subunit [Azospirillum sp. B510]
          Length = 446

 Score =  545 bits (1404), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 264/447 (59%), Positives = 334/447 (74%), Gaps = 5/447 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NF +FS+A +LK RI FT+ ALIVYR GTYIP+P ID       F+ +
Sbjct: 1   MASAAEQLAANINFGAFSKATELKKRIWFTLAALIVYRLGTYIPIPGIDPHILQDVFKQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +GI G+F+M +GGA+ RM +F+L IMPYISASIIVQL+ A  P +E +KKEGE GRK +
Sbjct: 61  GSGILGMFDMLAGGALHRMTIFALNIMPYISASIIVQLLTAVSPQMEAMKKEGEAGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTR+ TV L  +QAYG+AVGL++ +G     V D   FF  +T+ITL+GGTMFL+WLG
Sbjct: 121 NQYTRFGTVALATVQAYGLAVGLESMRGSTGAAVVDPGLFFRIATVITLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RGIGNG SLIIF+GIVA LP +LV+ LELGR G++ST  ++L+    V V+  ++
Sbjct: 181 EQITARGIGNGTSLIIFAGIVAELPRALVNTLELGRQGALSTLFIVLMLVMAVGVVFFIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRRLL+QYPKRQVGNR+F  + S+LPLK+NTAGV+P IFASSLLLLP T +GF  
Sbjct: 241 FMERAQRRLLVQYPKRQVGNRVFGGEASHLPLKMNTAGVIPPIFASSLLLLPLTAVGFAG 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +   + HG   YM+LY+  IVFF FFYTAIVFNP E ADNL+K+GGFIPG
Sbjct: 301 -GEGPEWLQAVSRYVAHGTPLYMLLYASLIVFFCFFYTAIVFNPTETADNLRKYGGFIPG 359

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG  TA HIDYVLTR+TV+G+ YLV VC+ PE LI+   VP    GTSLLI+V+V +D
Sbjct: 360 IRPGKNTADHIDYVLTRLTVIGSAYLVAVCLLPEILISQQSVPFYFGGTSLLIVVTVTMD 419

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           T+ QI  +L+A QYEG+ KKS+ + + 
Sbjct: 420 TVAQIHSHLLAHQYEGLIKKSKLRGRR 446


>gi|163851604|ref|YP_001639647.1| preprotein translocase, SecY subunit [Methylobacterium extorquens
           PA1]
 gi|218530413|ref|YP_002421229.1| preprotein translocase, SecY subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240138772|ref|YP_002963244.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Methylobacterium
           extorquens AM1]
 gi|254561372|ref|YP_003068467.1| preprotein translocase, membrane component, transport across inner
           membrane [Methylobacterium extorquens DM4]
 gi|163663209|gb|ABY30576.1| preprotein translocase, SecY subunit [Methylobacterium extorquens
           PA1]
 gi|218522716|gb|ACK83301.1| preprotein translocase, SecY subunit [Methylobacterium
           chloromethanicum CM4]
 gi|240008741|gb|ACS39967.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Methylobacterium
           extorquens AM1]
 gi|254268650|emb|CAX24609.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Methylobacterium
           extorquens DM4]
          Length = 447

 Score =  545 bits (1404), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/445 (59%), Positives = 341/445 (76%), Gaps = 3/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF + ++A +LK RI FT+ ALIV+R GTYIP+P ID   +++ FQ++
Sbjct: 1   MASAAEQLAANLNFGAIAKADELKKRIWFTLGALIVFRLGTYIPIPGIDPEQFARNFQNQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + G+ G+FNMFSGGAVERMAVF+L IMPYISASIIVQL+ + VP+LE LKKEGE GRKVI
Sbjct: 61  AGGVLGMFNMFSGGAVERMAVFALNIMPYISASIIVQLLTSVVPTLEALKKEGESGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L ++Q++GIA GL+    +++    FF+ ST++TL GGT+FL+W+GEQIT
Sbjct: 121 NQYTRYLTVVLALVQSWGIAFGLQGSNAVITPGP-FFILSTVVTLTGGTLFLMWIGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA LP+S+   LEL R G++S  ++L    + VA+I  ++F ER
Sbjct: 180 SRGIGNGSSLIIFAGIVAHLPASIFGALELTRTGALSPAVLLGAGLAAVALIYFIVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQVGNRM++   S+LPLKLNT+GV+P IFASSLLLLP T+  F   +  
Sbjct: 240 AQRRLLINYPKRQVGNRMYEGQSSFLPLKLNTSGVIPPIFASSLLLLPTTVASF-SANQG 298

Query: 301 PTWIVG-LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRP 359
            T I+G L   LGHGR  YMV Y+  I+FF FFYTAIVFNP+E ADNLKK GGFIPGIRP
Sbjct: 299 STGILGTLTAYLGHGRPLYMVAYAGLIIFFTFFYTAIVFNPQETADNLKKQGGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G+RTA  ID VLTR+TV+GA YL  VC+ PE + + T   +   GTSLLI+VSV +DT+ 
Sbjct: 359 GERTAAFIDKVLTRITVIGAAYLTFVCLVPEIVASYTSAALGFGGTSLLIVVSVTMDTVA 418

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           QI G+L+A QYEG+ KK++ +  ++
Sbjct: 419 QIHGHLMAHQYEGLVKKAKLRGAST 443


>gi|114327238|ref|YP_744395.1| preprotein translocase subunit SecY [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315412|gb|ABI61472.1| protein translocase subunit secY [Granulibacter bethesdensis
           CGDNIH1]
          Length = 447

 Score =  545 bits (1403), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 263/446 (58%), Positives = 340/446 (76%), Gaps = 5/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SN N ++FS+A +LK RI FT+ ALIVYR GTY+P+P +D       F  +
Sbjct: 1   MASAAEQLASNFNLSTFSKATELKKRIWFTLAALIVYRIGTYVPVPGVDASVIGDMFNQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+F+MFSGGA+ RM VF+L IMPYISASIIVQL+ A VPSLE LKKEGE GR+ +
Sbjct: 61  GGGILGMFDMFSGGALSRMTVFALNIMPYISASIIVQLLTAAVPSLEALKKEGESGRRKM 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           N+YTRY TVL+ +LQ+YGIA GL+  QG     V D  +FF  S ++TL+GGTMFL+WLG
Sbjct: 121 NEYTRYLTVLIALLQSYGIAAGLEGMQGPHGAAVIDPGWFFRLSCVVTLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNG+SLIIF+GIVA LP +L ++L++ R  ++S P +L +    VAVIA V+
Sbjct: 181 EQITARGVGNGISLIIFAGIVANLPHALGNLLQMSRNNALSLPSLLAVMVIAVAVIAFVV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+++QYPKRQVGNRMF  D +++PLK+NTA V+P IFASSLLL+PATI GF  
Sbjct: 241 FMERAQRRVVVQYPKRQVGNRMFGGDSTHMPLKVNTANVIPPIFASSLLLIPATIAGF-S 299

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
            +S  +W+  L   LGHG+  YM+LY+  I+FF++FYTA+VFNP+E ADNLKK+GGFIPG
Sbjct: 300 KNSGNSWLSWLSGQLGHGQPIYMLLYAGLIIFFSYFYTAVVFNPQETADNLKKNGGFIPG 359

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG  TA + D +LTR+T VGA YLV VC+ PE LI+  GVP    GTSL+I+VSV +D
Sbjct: 360 IRPGKATADYFDRILTRLTTVGAIYLVIVCLLPEFLISKFGVPFYFGGTSLMIVVSVTMD 419

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSKKK 442
           T+ Q+Q +L+A QYEG+ +++R+K K
Sbjct: 420 TVTQVQSHLLAHQYEGLIRRARTKGK 445


>gi|188581396|ref|YP_001924841.1| preprotein translocase, SecY subunit [Methylobacterium populi
           BJ001]
 gi|179344894|gb|ACB80306.1| preprotein translocase, SecY subunit [Methylobacterium populi
           BJ001]
          Length = 447

 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 267/445 (60%), Positives = 341/445 (76%), Gaps = 3/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF + ++A +LK RI FT+ ALIV+R GTYIP+P ID   +++ FQ++
Sbjct: 1   MASAAEQLAANLNFGAIAKADELKKRIWFTLGALIVFRLGTYIPIPGIDPEQFARNFQNQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + G+ G+FNMFSGGAVERMAVF+L IMPYISASIIVQL+ + VPSLE LKKEGE GRKVI
Sbjct: 61  AGGVLGMFNMFSGGAVERMAVFALNIMPYISASIIVQLLTSVVPSLEALKKEGESGRKVI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L ++Q++GIA GL+    +++    FF+ ST++TL GGT+FL+W+GEQIT
Sbjct: 121 NQYTRYLTVVLALVQSWGIAFGLQGSNAVINPGP-FFILSTVVTLTGGTLFLMWIGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA LP+S+   LEL R G++S  ++L    + VA+I  ++F ER
Sbjct: 180 SRGIGNGSSLIIFAGIVAHLPASIFGALELTRTGALSPAILLGAAVAAVALIYFIVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQRRLLI YPKRQVGNRM++   S+LPLKLNT+GV+P IFASSLLLLP T+  F   +  
Sbjct: 240 AQRRLLINYPKRQVGNRMYEGQSSFLPLKLNTSGVIPPIFASSLLLLPTTVASF-SANQG 298

Query: 301 PTWIVG-LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRP 359
            T I+G L   LGHGR  YMV Y+  I+FF FFYTAIVFNP+E ADNLKK GGFIPGIRP
Sbjct: 299 STGILGTLTAYLGHGRPLYMVAYAGLIIFFTFFYTAIVFNPQETADNLKKQGGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G+RTA  ID VLTR+TV+GA YL  VC+ PE + + T   +   GTSLLI+VSV +DT+ 
Sbjct: 359 GERTAAFIDKVLTRITVIGAAYLTFVCLVPEIVASYTSAALGFGGTSLLIVVSVTMDTVA 418

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           QI G+L+A QYEG+ KK++ +  ++
Sbjct: 419 QIHGHLMAHQYEGLVKKAKLRGAST 443


>gi|319407406|emb|CBI81057.1| translocase SecY subunit precursor [Bartonella sp. 1-1C]
          Length = 448

 Score =  541 bits (1395), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 263/444 (59%), Positives = 340/444 (76%), Gaps = 6/444 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSN+NF +FSRA +LK RI FT+ AL+VYRFGTYI LP I+     + F+  
Sbjct: 1   MASAAEQLVSNMNFGAFSRATELKKRIWFTLAALLVYRFGTYISLPGINIDVLRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK++
Sbjct: 61  ASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIVPSLEALKKEGELGRKIV 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L +LQA+GIAV L+ G G    +V +    F  S +I+L+GGT+FL+WLG
Sbjct: 121 NQYTRYMTVILAVLQAFGIAVALETGIGTGLQVVIEPGIIFRISAVISLVGGTIFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RGIGNG+SLIIF+GIVA  PS+   +L       +ST L++ I  + V +I +++
Sbjct: 181 EQITSRGIGNGISLIIFTGIVANFPSTFAQLLTAHSQADLSTFLLIGIVVAAVLIIGVIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR++IQYPKRQVGN+MFQ D+S+ PLKLNTAGV+P IFASSLLLLPATI  F D
Sbjct: 241 FVERAQRRIIIQYPKRQVGNQMFQGDMSHFPLKLNTAGVIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +   L HG+  YM++Y+V + FF FFYTAIVF+P + A+ LK+H GFIPG
Sbjct: 301 --KMPQWVQNISFFLSHGQPLYMIVYAVLMAFFCFFYTAIVFSPSDTAEQLKRHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TV+GA Y++ +C+ PE +I+   +P  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVIGAIYIILICLLPEFMISTLHIPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSK 440
           T+ QIQG L+A QY+G+ KKS+ +
Sbjct: 419 TVAQIQGSLVAHQYKGLIKKSKLR 442


>gi|319404405|emb|CBI78008.1| translocase SecY subunit precursor [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 448

 Score =  538 bits (1386), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 264/444 (59%), Positives = 338/444 (76%), Gaps = 6/444 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSN+NF +FSRA +LK RI FT+ AL+VYRFGTYI LP I+     + F+  
Sbjct: 1   MASAAEQLVSNMNFGAFSRATELKKRIWFTLAALLVYRFGTYISLPGINIDVLRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  ASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIVPSLEALKKEGEFGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ILQA+GIAV L+ G G    IV +    F  S +I+L+GGT+FL+WLG
Sbjct: 121 NQYTRYMTVILAILQAFGIAVALETGIGTGLQIVIEPGIIFRISAVISLVGGTIFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RGIGNG+SLIIF+GIVA  PS+   +L       +ST L++ I    V +I +++
Sbjct: 181 EQITSRGIGNGISLIIFTGIVANFPSTFAQLLTAHSQADLSTFLLIGIVVVAVLIIGVIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR++IQYPKRQVGN+MFQ D+S+ PLKLNTAGV+P IFASSLLLLPATI  F D
Sbjct: 241 FVERAQRRIIIQYPKRQVGNQMFQGDMSHFPLKLNTAGVIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +   L HG+  YM++Y+  + FF FFYTAIVF+P + A+ LK+H GFIPG
Sbjct: 301 --KMPQWVQNISFFLSHGQPLYMIVYAALMAFFCFFYTAIVFSPSDTAEQLKRHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TV+GA Y++ +C+ PE +I+   +P  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVIGAIYIILICLLPEFMISTLHIPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSK 440
           T+ QIQG L+A QY+G+ +KS+ +
Sbjct: 419 TVAQIQGSLVAHQYKGLIEKSKLR 442


>gi|319405878|emb|CBI79510.1| translocase SecY subunit precursor [Bartonella sp. AR 15-3]
          Length = 448

 Score =  537 bits (1384), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 265/444 (59%), Positives = 338/444 (76%), Gaps = 6/444 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ VSN+NF +FSRA +LK RI FT+ AL++YRFGTYI LP I+     + F+  
Sbjct: 1   MASAAEQLVSNMNFGAFSRATELKKRIWFTLAALLIYRFGTYISLPGINIDVLRQTFEHH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++G+ GLFNMF+GGAV RMA+F+LGIMPYISASIIVQL+ + VPSLE LKKEGE GRK+I
Sbjct: 61  ASGVLGLFNMFAGGAVGRMAIFALGIMPYISASIIVQLLTSIVPSLEALKKEGELGRKII 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV+L ILQA+GIAV L+ G G    IV +    F  + +I+L+GGT+FL+WLG
Sbjct: 121 NQYTRYMTVILAILQAFGIAVALETGIGTGLQIVIEPGIIFRITAVISLVGGTIFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RGIGNGVSLIIF+GIVA  PS+   +L       +ST L++ I    V +I +++
Sbjct: 181 EQITSRGIGNGVSLIIFTGIVANFPSTFAQLLTAHSQADLSTFLLIGIVVIAVFIIGVIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR++IQYPKRQVGN+MFQ D+S+ PLKLNTAGV+P IFASSLLLLPATI  F D
Sbjct: 241 FVERAQRRIIIQYPKRQVGNQMFQGDMSHFPLKLNTAGVIPPIFASSLLLLPATINNFSD 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +   LGHG+  YM++Y+  + FF FFYTAIVF+  + A+ LK+H GFIPG
Sbjct: 301 --KMPQWVQTISFFLGHGQPLYMIVYAALMAFFCFFYTAIVFSSSDTAEQLKRHSGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG+RTA +IDYVLTR+TVVGA Y++ +C+ PE +I+   +P  L GTSLLI+V+V LD
Sbjct: 359 IRPGERTAEYIDYVLTRITVVGAVYIILICLLPEFIISTLHIPFYLGGTSLLIVVTVTLD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSK 440
           T+ QIQG L+A QY+G+ KKS+ +
Sbjct: 419 TVAQIQGSLVAHQYKGLIKKSKLR 442


>gi|296534007|ref|ZP_06896523.1| preprotein translocase subunit SecY [Roseomonas cervicalis ATCC
           49957]
 gi|296265673|gb|EFH11782.1| preprotein translocase subunit SecY [Roseomonas cervicalis ATCC
           49957]
          Length = 455

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 262/442 (59%), Positives = 329/442 (74%), Gaps = 5/442 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLN    ++A +LK RI FT+ ALIVYR GTYIP+P +D    ++  +  
Sbjct: 1   MASAAEQLAANLNLGVLAKATELKKRIWFTLAALIVYRIGTYIPVPGVDASVMAEILRQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +GI G+F+MF+GGA+ RM VF+L IMPYISASII+QL+ A VP+LE LKKEGE GRK +
Sbjct: 61  GSGILGMFDMFTGGALGRMTVFALNIMPYISASIIIQLMTAAVPTLEALKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TVL+ + QAYGIAVGL+  QG     V ++  FF  S + TL+GGT+FL+W+G
Sbjct: 121 NQYTRYLTVLIAVFQAYGIAVGLEQMQGSFGPAVYEAGLFFRISCVTTLVGGTLFLMWIG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RGIGNG+SLIIF+GIVA +PS+LV+ LELGR G++S   ++      +AVI  V+
Sbjct: 181 EQITARGIGNGISLIIFAGIVANVPSALVATLELGRTGALSPVFIVAFMLIALAVIGFVV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+ IQYPKRQVGNRMF  + ++LPLKLNTAGV+P IFASSLLLLPAT  GF  
Sbjct: 241 FVERAQRRIPIQYPKRQVGNRMFGGENTHLPLKLNTAGVIPPIFASSLLLLPATFAGF-S 299

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
              S  ++  +  +L HG+  YM LY   I+FFAFFYTA+VFNP E ADNLKKHGGF+PG
Sbjct: 300 GGQSEGFLSTVTTALAHGQPLYMALYVALIIFFAFFYTAVVFNPTETADNLKKHGGFVPG 359

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG  T+ ++D VLTR+T VGA YL  VC+ PE LI+  GVP    GTSLLIIVSV +D
Sbjct: 360 IRPGQATSDYLDRVLTRLTAVGAIYLCIVCLLPELLISQYGVPFYFGGTSLLIIVSVTMD 419

Query: 417 TIVQIQGYLIAQQYEGVFKKSR 438
           T+ Q+Q +L A QYEG+ +K+R
Sbjct: 420 TVAQVQSHLFAHQYEGLIRKAR 441


>gi|83858546|ref|ZP_00952068.1| preprotein translocase SecY [Oceanicaulis alexandrii HTCC2633]
 gi|83853369|gb|EAP91221.1| preprotein translocase SecY [Oceanicaulis alexandrii HTCC2633]
          Length = 447

 Score =  525 bits (1351), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 266/448 (59%), Positives = 350/448 (78%), Gaps = 7/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ   N+NF +F++AK+L+ RI+FT++ L++YR GT++P+P ID   ++ AFQ +
Sbjct: 1   MASAAEQLAQNMNFGAFAQAKELQKRILFTLLVLVIYRVGTFVPVPGIDPAQFALAFQQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGRKV 119
           S G+ G+FNM SGGAVERMA+F+L +MPYISASII+QL+AAT+PSLE LKK+G EQGRK 
Sbjct: 61  SQGVLGMFNMMSGGAVERMAIFALNVMPYISASIIMQLMAATIPSLERLKKDGGEQGRKQ 120

Query: 120 INQYTRYATVLLGILQAYGIAVGLK---NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           INQYTRY TV+L   QA+ IA+G++   +G  I  +   FF+ +T+ TL+GGTMFL+WLG
Sbjct: 121 INQYTRYLTVVLAAAQAFAIAIGMQTVTDGASIAINPGPFFLITTVTTLVGGTMFLLWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNGVSLIIF+GIVA LP +LV+ L+ G  GSI+ P+++ +    V V+A V+
Sbjct: 181 EQITARGVGNGVSLIIFAGIVAELPRALVNALQAGASGSIAGPVIIAMLVGIVVVLAFVV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ER+QRRLLIQYPKRQVGNRM   + S+LPLKLNTAGV+P+IFASSLLLLPATI GF  
Sbjct: 241 FMERSQRRLLIQYPKRQVGNRMMGGESSFLPLKLNTAGVIPAIFASSLLLLPATIQGF-- 298

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
             S P W+  +V  LG G+  ++  Y+  I+FF FFYT++VFNP+E ADNLKK+GGF+PG
Sbjct: 299 SQSGPDWLANIVAMLGPGQPLFLAFYAAMIIFFTFFYTSLVFNPEETADNLKKYGGFLPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIA-VTGVPVSLSGTSLLIIVSVVL 415
           IRPG RTA ++DYVLTR+TV+GA YL  VC+ PE L A V+G+P  + GTSLLI+VSV L
Sbjct: 359 IRPGKRTAEYLDYVLTRLTVIGAAYLTLVCVLPEFLKAQVSGIPFYIGGTSLLIVVSVTL 418

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           DT+ QIQ +L+A QYEG+ KK++ + + 
Sbjct: 419 DTVGQIQSHLLAHQYEGLIKKTKLRGRK 446


>gi|162149154|ref|YP_001603615.1| preprotein translocase subunit SecY [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209545102|ref|YP_002277331.1| preprotein translocase subunit SecY [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787731|emb|CAP57327.1| putative preprotein translocase secY subunit [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532779|gb|ACI52716.1| preprotein translocase, SecY subunit [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 448

 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 251/447 (56%), Positives = 334/447 (74%), Gaps = 6/447 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NF+SF+ A +LK RI FT+ ALIVYR GTYIP+P +D     +     
Sbjct: 1   MASAAEQLAANMNFSSFANATELKKRIWFTLGALIVYRLGTYIPVPGVDATVMGQLLARH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+F+MF+GGA+ RM VF+L IMPYISASIIVQL++A +PSLENLKKEGE GR+ +
Sbjct: 61  QGGILGMFDMFTGGALGRMTVFALNIMPYISASIIVQLMSAALPSLENLKKEGEAGRRKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDY----FFVFSTIITLLGGTMFLVWLG 176
           N+YTRY TVL+ + QAYGIAVGL+N       +      FF+ S ++TLLGGTMFL+WLG
Sbjct: 121 NEYTRYLTVLIALFQAYGIAVGLENMHSAAGAAVVAPGMFFIVSCVVTLLGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAV-IALV 235
           EQIT RG+GNG+SLIIF+GIVA LP +L S+ +LG  G++S P  +L+F    A+ IA +
Sbjct: 181 EQITSRGVGNGISLIIFAGIVANLPHALASLFQLGYTGALS-PFFVLVFLVLAAITIAFI 239

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           +F E+AQRR++IQYPKRQVG R++  D +++PLK+NTAGV+P IFASS+LL+P TI GF+
Sbjct: 240 VFMEQAQRRVVIQYPKRQVGQRIYGGDSTHMPLKVNTAGVIPPIFASSVLLIPVTIAGFM 299

Query: 296 DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIP 355
           + +S P W+  L   LG G+  YM+ Y+  I+FF++FY A+ FNP+E ADNL+K GGFIP
Sbjct: 300 NNASMPGWLSFLGQELGQGQPLYMLFYAGMIIFFSYFYAAVTFNPQETADNLRKQGGFIP 359

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           GIRPG  TA + D +LTR+T +GA YLV VC+ P+ LI+   VP    GTSL+IIVSV +
Sbjct: 360 GIRPGANTAAYFDRILTRLTSIGAAYLVAVCLLPQILISHYNVPFYFGGTSLIIIVSVTI 419

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           DT+ QIQ +L+A QY+G+ +K+R K +
Sbjct: 420 DTVTQIQSHLVAHQYQGLMRKARGKGR 446


>gi|329114198|ref|ZP_08242960.1| Preprotein translocase subunit SecY [Acetobacter pomorum DM001]
 gi|326696274|gb|EGE47953.1| Preprotein translocase subunit SecY [Acetobacter pomorum DM001]
          Length = 452

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 253/448 (56%), Positives = 326/448 (72%), Gaps = 6/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N N  SF++A +LK RI FT+ ALIVYR GTYIP+P +D     +     
Sbjct: 1   MASAAEQLAANFNVGSFAKATELKKRIWFTLGALIVYRLGTYIPVPGVDATVMGQLLAQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+FNMF+GGA+ RM VF+L IMPYISASIIVQL++  VPSLE LKKEGEQGRK +
Sbjct: 61  QGGILGMFNMFTGGALGRMTVFALNIMPYISASIIVQLMSTAVPSLEALKKEGEQGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TVL+ + QAYGIAVGL+N     G  +V     FF+ S + TL+GGTMFL+WL
Sbjct: 121 NQYTRYLTVLIALFQAYGIAVGLENVHSAAGAAVV-HPGMFFLLSCVTTLVGGTMFLMWL 179

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RG+GNG+SLIIF+GIVA LP +L S+ +LG  G++S   +LL        I  +
Sbjct: 180 GEQITARGVGNGISLIIFAGIVANLPHALASLFQLGYTGALSPFFVLLFLVLAALTIMFI 239

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           +F E+AQRR++IQYPKRQ+G RMF  D +++PLK+NTAGV+P IFASS+LL+P TI GF+
Sbjct: 240 VFMEQAQRRVVIQYPKRQMGQRMFGGDTTHMPLKVNTAGVIPPIFASSVLLIPVTIAGFM 299

Query: 296 DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIP 355
           +  S P W+  L   LG G+  YM+ Y+V IVFF++FY A+ FNP E ADNL+K GGFIP
Sbjct: 300 NGKSLPGWLSFLGQELGQGQPLYMLFYAVMIVFFSYFYAAVTFNPTETADNLRKQGGFIP 359

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           G+RPG  TA + D +LTR+T +GA Y+V VC+ P+ LI+   VP    GTSL+IIVSV +
Sbjct: 360 GVRPGASTASYFDKILTRLTTIGAAYMVAVCLLPQILISHYNVPFYFGGTSLIIIVSVTI 419

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           DT+ QIQ +L+A QY+G+ +KSR  +K 
Sbjct: 420 DTVTQIQSHLVAHQYQGLMRKSRGGRKQ 447


>gi|58038835|ref|YP_190799.1| preprotein translocase subunit SecY [Gluconobacter oxydans 621H]
 gi|58001249|gb|AAW60143.1| Protein translocase subunit SecY [Gluconobacter oxydans 621H]
          Length = 457

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 248/444 (55%), Positives = 329/444 (74%), Gaps = 4/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLN +SFS+A +LK RI FT+ ALIVYR GTYIP+P +D     +     
Sbjct: 1   MASAAEQLAANLNMSSFSKATELKKRIWFTLGALIVYRLGTYIPVPGVDATVMGQLLAQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+F+MF+GGA+ RM VF+L IMPYISASII+QL++  +PS+E +KKEGE GRK +
Sbjct: 61  QGGILGMFDMFTGGALGRMTVFALNIMPYISASIIIQLLSTALPSMEAMKKEGEAGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TV + + QAYGIAVGL+N    G   V     FF+ S ++TL+GGTMFL+WLG
Sbjct: 121 NQYTRYLTVFIALFQAYGIAVGLENMTAHGANAVVAPGMFFIASCVVTLVGGTMFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNG+SLIIF+GIVA LP +L S+ ELGR G++S   +++     +AVI  ++
Sbjct: 181 EQITSRGVGNGISLIIFAGIVANLPHALASLFELGRTGALSPIFVVIFLVLAIAVIGFIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F E+AQRR++IQYPKRQVGNR+F  D +++PLK+NTAGV+P IFASS+LL+P TI GF++
Sbjct: 241 FMEQAQRRVVIQYPKRQVGNRIFGGDSTHMPLKVNTAGVIPPIFASSVLLIPVTISGFMN 300

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
             S P W+  L   LG G+  YM+ Y+  I+FF++FY AI FNP+E A+NL+K GGFIPG
Sbjct: 301 GHSMPGWLSVLGQQLGQGQPLYMLFYAAMILFFSYFYAAITFNPEETAENLRKQGGFIPG 360

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG  TA + D +L+R+T +GA YLV VC+ P+ LI+   VP    GTSL+IIVSV +D
Sbjct: 361 IRPGASTATYFDKILSRLTAIGAMYLVVVCLLPQILISKYNVPFYFGGTSLIIIVSVTID 420

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSK 440
           T+ Q+Q +L+A QY G+ +K RS+
Sbjct: 421 TVTQVQSHLVAHQYSGLIRKQRSR 444


>gi|197104716|ref|YP_002130093.1| preprotein translocase SecY subunit [Phenylobacterium zucineum
           HLK1]
 gi|196478136|gb|ACG77664.1| preprotein translocase SecY subunit [Phenylobacterium zucineum
           HLK1]
          Length = 450

 Score =  523 bits (1346), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 252/444 (56%), Positives = 335/444 (75%), Gaps = 4/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NF +F++A +L  RI FT+ A+IVYR G YIP+P ID  +  +AFQ +
Sbjct: 1   MASAAEQLAANMNFQAFAKATELHKRIWFTLWAMIVYRAGCYIPIPGIDAAALQQAFQGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGRKV 119
           + GI G+FNMFSGGAVERMA+F+L +MPYISASIIVQL+    P  E L+KEG E GRK 
Sbjct: 61  AQGILGMFNMFSGGAVERMALFALNVMPYISASIIVQLLGTVYPPWEKLRKEGGEAGRKQ 120

Query: 120 INQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQI 179
           +NQYTRY TV+L + Q++GIA+GL    G+V +   FF+ ST++TL GGTMFL+WLGEQI
Sbjct: 121 LNQYTRYLTVVLALFQSFGIAMGLSQSPGLVENPGLFFIVSTVVTLTGGTMFLMWLGEQI 180

Query: 180 TMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFE 239
           T RG+GNG+SLIIF+GIVA LP  +    E+ R G++S   + LI +  +AV   ++F E
Sbjct: 181 TSRGVGNGISLIIFAGIVAVLPRYVAQAFEMARTGAMSGGALFLIAALVIAVTVAIVFME 240

Query: 240 RAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSS 299
           R+QRRLL+QYPKRQVGNRMF  D S+LPLK+NT+GV+P IFASSLLLLP T+MGF   ++
Sbjct: 241 RSQRRLLVQYPKRQVGNRMFGGDTSFLPLKINTSGVIPPIFASSLLLLPTTVMGFAATAN 300

Query: 300 SPTWIVGLVDSLG---HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
            P W+  L  + G   HG+  +M+LY   IVFF FFYT++VF+P++ A+NL+K+GGF+PG
Sbjct: 301 LPEWLQWLPAATGQLQHGQPLFMLLYGGLIVFFCFFYTSVVFSPEDTAENLRKYGGFLPG 360

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG RTA ++D+VLTR+TV+GA Y+  VC+ PEALI    V   + GTSLLI+VSV +D
Sbjct: 361 IRPGKRTAEYLDFVLTRLTVIGAAYITIVCLLPEALIGFYNVQFYMGGTSLLIVVSVTMD 420

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSK 440
           T+ QIQ +L+A QYEG+ K+S+ +
Sbjct: 421 TVAQIQSHLLAHQYEGLIKRSKLR 444


>gi|258542047|ref|YP_003187480.1| preprotein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633125|dbj|BAH99100.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636182|dbj|BAI02151.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639237|dbj|BAI05199.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642291|dbj|BAI08246.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645346|dbj|BAI11294.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648401|dbj|BAI14342.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651454|dbj|BAI17388.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654445|dbj|BAI20372.1| protein translocase subunit SecY [Acetobacter pasteurianus IFO
           3283-12]
          Length = 452

 Score =  522 bits (1344), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 252/448 (56%), Positives = 325/448 (72%), Gaps = 6/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N N  SF++A +LK RI FT+ ALIVYR GTYIP+P +D     +     
Sbjct: 1   MASAAEQLAANFNVGSFAKATELKKRIWFTLGALIVYRLGTYIPVPGVDATVMGQLLAQH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+FNMF+GGA+ RM VF+L IMPYISASIIVQL++  VPSLE LKKEGEQGRK +
Sbjct: 61  QGGILGMFNMFTGGALGRMTVFALNIMPYISASIIVQLMSTAVPSLEALKKEGEQGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TVL+ + QAYGIAVGL+N     G  +V     FF+ S + TL+GGTMFL+WL
Sbjct: 121 NQYTRYLTVLIALFQAYGIAVGLENVHSAAGAAVV-HPGMFFLLSCVTTLVGGTMFLMWL 179

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RG+GNG+SLIIF+GIVA LP +L S+ +LG  G++S   +LL        I  +
Sbjct: 180 GEQITARGVGNGISLIIFAGIVANLPHALASLFQLGYTGALSPFFVLLFLVLAALTIMFI 239

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           +F E+AQRR++IQYPKRQ+G RMF  D +++PLK+NTAGV+P IFASS+LL+P TI GF+
Sbjct: 240 VFMEQAQRRVVIQYPKRQMGQRMFGGDTTHMPLKVNTAGVIPPIFASSVLLIPVTIAGFM 299

Query: 296 DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIP 355
           +  S P W+  L   LG G+  YM+ Y+  IVFF++FY A+ FNP E ADNL+K GGFIP
Sbjct: 300 NGKSLPGWLSFLGQELGQGQPLYMLFYAAMIVFFSYFYAAVTFNPTETADNLRKQGGFIP 359

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           G+RPG  TA + D +LTR+T +GA Y+V VC+ P+ LI+   VP    GTSL+IIVSV +
Sbjct: 360 GVRPGASTASYFDKILTRLTTIGAAYMVAVCLLPQILISHYNVPFYFGGTSLIIIVSVTI 419

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           DT+ QIQ +L+A QY+G+ +KSR  +K 
Sbjct: 420 DTVTQIQSHLVAHQYQGLMRKSRGGRKQ 447


>gi|83594000|ref|YP_427752.1| preprotein translocase subunit SecY [Rhodospirillum rubrum ATCC
           11170]
 gi|83576914|gb|ABC23465.1| protein translocase subunit secY/sec61 alpha [Rhodospirillum rubrum
           ATCC 11170]
          Length = 447

 Score =  521 bits (1342), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/447 (58%), Positives = 333/447 (74%), Gaps = 5/447 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SN+NF  F++A +LK RI FT+ AL+VYR GTYIPLP ID  + +  F   
Sbjct: 1   MASAAEQLASNMNFGVFAKATELKKRIWFTLAALVVYRVGTYIPLPGIDPQAMADVFSRN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+F+MF+GGA+ RM +F+L IMPYISASII+QL+ +  P LE LKKEGE GRK I
Sbjct: 61  GGGILGMFDMFAGGALSRMTIFALNIMPYISASIIMQLMTSISPQLEALKKEGESGRKRI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TVL+  LQAYGIAVGL++        V D+  FF F+T++TL+GGT+FL+WLG
Sbjct: 121 NQYTRYLTVLITALQAYGIAVGLESMTSSSGAAVHDAGMFFRFTTVVTLMGGTLFLMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNG+SLIIF+GIVA LP +LV +LELGR G++S  ++L I    V VIA ++
Sbjct: 181 EQITARGVGNGISLIIFTGIVAQLPHALVGMLELGRTGALSPAVILGILVLAVGVIAFIV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQRR+LIQYPKRQ GN+M+  + S++PLK+NT GV+P IFASS+LLLP T   F  
Sbjct: 241 FMERAQRRILIQYPKRQQGNKMYGGESSHMPLKINTPGVIPPIFASSILLLPMTAAQF-S 299

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
               P W+  +   LGHG+  YM LY+  I FFAFFYTA+VFNP++ A+NLKK+GGFIPG
Sbjct: 300 AGQGPEWLTTITTLLGHGQPLYMALYAALIAFFAFFYTAVVFNPEDTAENLKKYGGFIPG 359

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG  T+ ++DYVLTR+T VGA YL+ + I PE LI+  GVP    GTSLLI+V+V +D
Sbjct: 360 IRPGRNTSEYLDYVLTRLTAVGAIYLIFISILPEFLISKVGVPFYFGGTSLLIVVTVTMD 419

Query: 417 TIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           T+ QIQ +L+A QYEG+ KKS+ + K 
Sbjct: 420 TVAQIQSHLLAHQYEGLIKKSKLRGKR 446


>gi|83312210|ref|YP_422474.1| preprotein translocase subunit SecY [Magnetospirillum magneticum
           AMB-1]
 gi|82947051|dbj|BAE51915.1| Preprotein translocase subunit SecY [Magnetospirillum magneticum
           AMB-1]
          Length = 447

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 249/448 (55%), Positives = 330/448 (73%), Gaps = 6/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SNLNF   ++A +LK RI FT++AL+VYR GT+IP+P +D       F+  
Sbjct: 1   MASAAEQLASNLNFGVLAKATELKKRIWFTLLALVVYRLGTWIPMPGVDPHVLGDLFKQS 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+ G+F+M +GGA+ RM +F+L IMPYISASII+QL+   +PSLE +KKEGE GRK I
Sbjct: 61  GGGMLGMFDMLAGGALHRMTIFALNIMPYISASIILQLMTTVIPSLEAVKKEGESGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLK-----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV++ ++QAYGIAVGL+      G  ++ DS   F FST++TL GGT+FL+WL
Sbjct: 121 NQYTRYLTVVIAVMQAYGIAVGLEGMTSSRGSAVMMDSHLLFRFSTVVTLTGGTLFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIG G SLII +GIVA LP+++ + LELGR G++   +++ I   +VAV+A +
Sbjct: 181 GEQITARGIGQGTSLIIMAGIVAELPAAISNTLELGRTGALPVLVIIGILVMSVAVVAFI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           +F ERAQRR+++QYPKRQVGN+MF  + S+LPLK+NT+GV+P IFASS+LL+P TI  F 
Sbjct: 241 VFMERAQRRIIVQYPKRQVGNKMFGGESSHLPLKVNTSGVIPPIFASSILLMPVTIAQF- 299

Query: 296 DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIP 355
             S  P W+      +G G+  Y+ LY   IVFF+FFYTA+VFNP + A+NLKK+GGFIP
Sbjct: 300 TASGGPEWLTTFTALMGRGQPLYLALYLSLIVFFSFFYTAVVFNPVDTAENLKKYGGFIP 359

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           GIRPG  T+ ++DYVLTR+TVVGA YL  + I PE LI+   VP    GTSLLI+VSV +
Sbjct: 360 GIRPGKNTSDYLDYVLTRLTVVGAAYLSVLSILPELLISKFSVPFYFGGTSLLIVVSVTM 419

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           DT+ Q+Q +L+A QYEG+ KKSR + + 
Sbjct: 420 DTVAQVQSHLLAHQYEGLIKKSRLRGRR 447


>gi|167645598|ref|YP_001683261.1| preprotein translocase subunit SecY [Caulobacter sp. K31]
 gi|167348028|gb|ABZ70763.1| preprotein translocase, SecY subunit [Caulobacter sp. K31]
          Length = 452

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 253/445 (56%), Positives = 333/445 (74%), Gaps = 7/445 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NF SF +A +L  RI FT+IALIVYR GTY+P+P I+  +++ AF  +
Sbjct: 1   MASAAEQLAANMNFGSFQKATELHKRIWFTLIALIVYRLGTYVPIPGINPEAFAAAFSQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGRKV 119
           S GI G+FNMFSGGAV+RMAVFSL +MPYISASIIVQL+ +  P  E LKKEG E GRK 
Sbjct: 61  SKGILGMFNMFSGGAVQRMAVFSLNVMPYISASIIVQLMGSVYPPWEKLKKEGGEAGRKT 120

Query: 120 INQYTRYATVLLGILQAYGIAVGLKNGQGIV--SDSDYFFVFSTIITLLGGTMFLVWLGE 177
           +NQYTRY  V+L ++Q++ IAVGL++  G+V  S +  FF+ ST++ L GGT+FL+WLGE
Sbjct: 121 LNQYTRYLAVILAVVQSFSIAVGLQSQAGMVVGSIAPVFFIVSTVVALTGGTLFLMWLGE 180

Query: 178 QITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIF 237
           QIT RG+GNGVSLIIF+GIV+ LP  +V +    + G++S   +  +    VAVI  ++F
Sbjct: 181 QITSRGVGNGVSLIIFTGIVSALPLGVVQMFTQVQTGAMSGFALFAVAILAVAVIFFIVF 240

Query: 238 FERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV 297
            ER+QRRLL+ YPKRQ GNRM   D S++PLKLNTAGV+P IFASSLLLLP T MGF+  
Sbjct: 241 VERSQRRLLVHYPKRQQGNRMIGGDTSFIPLKLNTAGVIPPIFASSLLLLPTTAMGFLAT 300

Query: 298 SSSPTWIVGL---VDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           ++ P W   L   V +L HG+  +MVLY+  I+FF+FFYT++VFNP E A+NL+K+GGF+
Sbjct: 301 ATLPNWAQWLPTAVGALQHGQPLFMVLYAALIIFFSFFYTSVVFNPDETAENLRKYGGFM 360

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTG-VPVSLSGTSLLIIVSV 413
           PGIRPG RTA ++DYVLTR+TV+GA Y+  VCI PE  +   G    +L GTS+LI+V+V
Sbjct: 361 PGIRPGKRTAEYLDYVLTRLTVIGAAYITAVCILPELFMNSMGPTKFTLGGTSILIVVTV 420

Query: 414 VLDTIVQIQGYLIAQQYEGVFKKSR 438
            +DT+ QIQ +L+A QYEG+ KKS+
Sbjct: 421 TMDTVAQIQSHLLAHQYEGLIKKSK 445


>gi|294085978|ref|YP_003552738.1| preprotein translocase subunit SecY [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665553|gb|ADE40654.1| preprotein translocase, SecY subunit [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 444

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 248/426 (58%), Positives = 329/426 (77%), Gaps = 1/426 (0%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +A +LKSR++FT+ ALI+YR GTY+P+P ID  + +  F  +S+GI G+F+MFSGGA+ R
Sbjct: 18  KASELKSRLLFTVGALIIYRLGTYLPIPGIDPGALADIFSQQSSGILGMFDMFSGGALSR 77

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           M +F+L IMPYI+ASII+QL+ A VPSLE LKK+GE GRK+INQYTRY TV+L  +Q YG
Sbjct: 78  MTIFALNIMPYITASIIMQLMTAIVPSLEALKKDGESGRKIINQYTRYMTVVLATVQGYG 137

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           IAVGL+   G+V D   FF  +T++TL+GGT+FL+WLGEQIT RG+GNG+SLIIF+GIVA
Sbjct: 138 IAVGLEAASGVVGDPGMFFRVTTVVTLVGGTLFLMWLGEQITSRGVGNGISLIIFAGIVA 197

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
            LPS+L   LELGR G++S  L++L+F+  + VIA ++F ER+ R++L+QYPKRQ GN++
Sbjct: 198 NLPSALAGTLELGRTGALSAFLIVLLFAMAIGVIAFIVFIERSVRKILVQYPKRQHGNKV 257

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI-DVSSSPTWIVGLVDSLGHGRSF 317
           F  D S+LPLK+N  GV+P IFASSLLL+P +I+      S    W+V L   LG G+  
Sbjct: 258 FGGDQSFLPLKINVPGVIPPIFASSLLLMPISIINLTGGQSGGADWLVTLNALLGRGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ +Y   IVFFAFFYTAIVFNP++ A+NL+KHGG+IPGIRPG  TA ++D+VLTR+TV+
Sbjct: 318 YLAIYIGMIVFFAFFYTAIVFNPEDTAENLRKHGGYIPGIRPGKSTADYLDFVLTRLTVL 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GAGYL  VCI PE LI+   VP    GTSLLI+V+V LDT+ Q+Q +L+A QYEG+ KKS
Sbjct: 378 GAGYLSAVCILPEILISQYAVPFYFGGTSLLIVVTVTLDTVGQVQSHLLAHQYEGLVKKS 437

Query: 438 RSKKKN 443
           + K +N
Sbjct: 438 KLKGRN 443


>gi|221234263|ref|YP_002516699.1| preprotein translocase subunit SecY [Caulobacter crescentus NA1000]
 gi|220963435|gb|ACL94791.1| protein translocase subunit secY [Caulobacter crescentus NA1000]
          Length = 451

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 247/445 (55%), Positives = 332/445 (74%), Gaps = 8/445 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NFASF +A +L  RI FTIIALIVYR GTY+P+P +D  +++  F   
Sbjct: 1   MASAAEQLAANMNFASFQKATELHKRIWFTIIALIVYRLGTYVPIPGVDPTAFASLFSQN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKE-GEQGRKV 119
           S G+ G+F+MFSGGAVERMA+FSL +MPYISASIIVQL+    P  E LKKE GE GRK 
Sbjct: 61  SKGLLGMFDMFSGGAVERMAIFSLNVMPYISASIIVQLMGTVYPPWEKLKKEGGEAGRKT 120

Query: 120 INQYTRYATVLLGILQAYGIAVGLKNGQGIVSD--SDYFFVFSTIITLLGGTMFLVWLGE 177
           +NQYTRY  V+L ++Q+  IA+G+    G+V+D     FF+ STI+ L GGTMFL+WLGE
Sbjct: 121 LNQYTRYLAVILAVVQSASIAIGIAAQPGVVADGVGHTFFIVSTIVALTGGTMFLMWLGE 180

Query: 178 QITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIF 237
           QIT RG+GNGVSLIIF+GIVA LP  L+ +L   +  +   PL L++F    A++A+V F
Sbjct: 181 QITSRGVGNGVSLIIFAGIVASLPIKLMQMLTQAQSNNNYLPLFLVVFGGIAAILAIV-F 239

Query: 238 FERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV 297
            ER+QRRLL+ YPKRQ GNRM   + S++PLK+NTAGV+P IFASSLLLLP T +  +  
Sbjct: 240 IERSQRRLLVHYPKRQQGNRMIGGESSFMPLKINTAGVIPPIFASSLLLLPTTALQLVQT 299

Query: 298 SSSP---TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           ++ P   +W+  +V +L HG+  ++ LY++ I+FF+FFYT++VFNP E A+NL+K+GGF+
Sbjct: 300 ANLPGWASWLPAMVGALQHGQPAFLALYALLIIFFSFFYTSVVFNPDETAENLRKYGGFL 359

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPE-ALIAVTGVPVSLSGTSLLIIVSV 413
           PGIRPG RTA ++DYVLTR+TV+GA Y+  VCI PE  ++A+     +L GTS+LI+V+V
Sbjct: 360 PGIRPGKRTAEYLDYVLTRLTVIGAAYITAVCIAPEFVMMAMNSTQFALGGTSILIVVTV 419

Query: 414 VLDTIVQIQGYLIAQQYEGVFKKSR 438
            +DT+ QIQ +L+A QYEG+ KKS+
Sbjct: 420 TMDTVAQIQSHLLAHQYEGLIKKSK 444


>gi|163796899|ref|ZP_02190856.1| 30S ribosomal protein S11 [alpha proteobacterium BAL199]
 gi|159177888|gb|EDP62437.1| 30S ribosomal protein S11 [alpha proteobacterium BAL199]
          Length = 447

 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 261/448 (58%), Positives = 338/448 (75%), Gaps = 7/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS+ +Q  S +NF +F +A +LK RI FT++AL+VYR GTYIPLP ID ++  + F+  
Sbjct: 1   MASSADQLASQMNFGAFGKATELKKRIWFTLLALVVYRLGTYIPLPGIDPVALKEIFRQN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI G+F+MFSGGA+ RM++ +L IMPYISA+II+QL+ A  P+LE LKKEGE GRK I
Sbjct: 61  AGGIIGMFDMFSGGALGRMSILALNIMPYISAAIIMQLMTAVSPNLEALKKEGEVGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLK-----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TVLL  +QAYGIA G++     NG  ++ D   FF  +T+ITL+GGT+FL+WL
Sbjct: 121 NQYTRYLTVLLAAVQAYGIATGMESLPGANGTAVM-DPGMFFRVTTVITLVGGTIFLMWL 179

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RG+GNG+SLIIFSGIVA LP +L   LELGR G++ST  +LL+    V VIA +
Sbjct: 180 GEQITARGVGNGISLIIFSGIVANLPQALAGTLELGRTGALSTLFILLLLVMAVGVIAFI 239

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
            F ER+QRR+L+QYPKRQVGNRMF  + S+LPLKLN +GV+P IFASSLLL+P T+   +
Sbjct: 240 CFMERSQRRILVQYPKRQVGNRMFGGESSHLPLKLNVSGVIPPIFASSLLLMPITV-AQM 298

Query: 296 DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIP 355
              + P W+  +   LGHG+  Y+ LY   IVFFAFFYTAIVFNP+E A+NL+K+GGF+P
Sbjct: 299 SAGTGPEWLGTVTSLLGHGQPLYVALYVGLIVFFAFFYTAIVFNPQETAENLRKYGGFVP 358

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           GIRPG  TA ++D+VLTR+TVVGAGYL  VCI PE LI+   VP    GTSLLI+V+V +
Sbjct: 359 GIRPGKNTADYLDFVLTRLTVVGAGYLAAVCILPEILISQYSVPFYFGGTSLLIVVTVTM 418

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           DT+ QIQ +L+A QYEG+ KKS+ + + 
Sbjct: 419 DTVTQIQSHLLAHQYEGLIKKSKIRGRR 446


>gi|295688926|ref|YP_003592619.1| preprotein translocase subunit SecY [Caulobacter segnis ATCC 21756]
 gi|295430829|gb|ADG10001.1| preprotein translocase, SecY subunit [Caulobacter segnis ATCC
           21756]
          Length = 451

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/445 (56%), Positives = 335/445 (75%), Gaps = 8/445 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NFASF +A +L  RI FTIIALIVYR G+Y+P+P ID  ++++ F + 
Sbjct: 1   MASAAEQLAANMNFASFQKASELHKRIWFTIIALIVYRLGSYVPIPGIDVNAFARLFNNN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKE-GEQGRKV 119
           S GI G+FNMFSGGAVERMA+FSL +MPYISASIIVQL+ +  P  E LKKE GE GRK 
Sbjct: 61  SEGILGMFNMFSGGAVERMAIFSLNVMPYISASIIVQLMGSVYPPWEKLKKEGGEAGRKT 120

Query: 120 INQYTRYATVLLGILQAYGIAVGL--KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGE 177
           +NQYTRY  V+L ++Q+  IA+GL  + G  +      FFV ST++ L GGT+FL+WLGE
Sbjct: 121 LNQYTRYLAVVLAVVQSASIAMGLAAQPGVVVQGVGTVFFVASTVVALTGGTLFLMWLGE 180

Query: 178 QITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIF 237
           QIT RG+GNGVSLIIF+GIVA LP  L  +L  G+     TPL L++     A++A+V F
Sbjct: 181 QITSRGVGNGVSLIIFAGIVARLPIVLGQMLVQGQTSGNYTPLFLIVIGCVAAILAIV-F 239

Query: 238 FERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV 297
            ER+QRRLL+ YPKRQ GNRM   + S++PLK+NTAGV+P IFASSLLLLP T M F+  
Sbjct: 240 MERSQRRLLVHYPKRQQGNRMIGGESSFMPLKINTAGVIPPIFASSLLLLPTTAMQFVQT 299

Query: 298 SSSP---TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           ++ P   +W+ G+V +L HG   +++ Y++ I+FF+FFYT++VFNP+E A+NL+K+GGF+
Sbjct: 300 TNLPAWASWLPGVVGALQHGHPAFLIFYALLIIFFSFFYTSVVFNPEETAENLRKYGGFL 359

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPE-ALIAVTGVPVSLSGTSLLIIVSV 413
           PGIRPG RTA ++DYVLTR+TV+GA Y+  VC+ PE A++A+     +L GTS+LI+V+V
Sbjct: 360 PGIRPGKRTAEYLDYVLTRLTVIGAAYITAVCVAPELAMMAIKSNQFALGGTSILIVVTV 419

Query: 414 VLDTIVQIQGYLIAQQYEGVFKKSR 438
            +DT+ QIQ +L+A QYEG+ KKS+
Sbjct: 420 TMDTVAQIQSHLLAHQYEGLIKKSK 444


>gi|329889147|ref|ZP_08267490.1| preprotein translocase, SecY subunit [Brevundimonas diminuta ATCC
           11568]
 gi|328844448|gb|EGF94012.1| preprotein translocase, SecY subunit [Brevundimonas diminuta ATCC
           11568]
          Length = 458

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 249/448 (55%), Positives = 330/448 (73%), Gaps = 6/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+N  SF++A +L  R++FT+ AL+VYR GTY+P+P I+  ++   FQ+ 
Sbjct: 1   MASAAEQLAANMNMGSFAKATELHKRLLFTLGALLVYRIGTYVPIPGINGEAFLAFFQNP 60

Query: 61  SA--GIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGR 117
               GI  +FNMFSGGAVERMAVF+L +MPYISASIIVQL+ A  P  E LKKEG E GR
Sbjct: 61  DGQRGILDMFNMFSGGAVERMAVFALNVMPYISASIIVQLMGAVYPPWEKLKKEGGESGR 120

Query: 118 KVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGE 177
           K +NQYTRY TV L + Q++GIAVGL    G++     FF+ ST+  L GGTMFL+WLGE
Sbjct: 121 KQLNQYTRYLTVFLALAQSFGIAVGLNAQPGLIDQPGLFFIISTVTVLTGGTMFLMWLGE 180

Query: 178 QITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIF 237
           Q+T RG+GNG+SLIIF+GIVA LPS++  +L L + G +S   +L I    VAVI  ++F
Sbjct: 181 QVTARGVGNGISLIIFAGIVAVLPSTVARMLGLAQQGQMSAFTLLFIAIMAVAVIVFIVF 240

Query: 238 FERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV 297
            ERAQRRLLIQYPKRQ GNRM   + S+LPLK+NTAGV+P+IFASSLL+LP T+  F   
Sbjct: 241 MERAQRRLLIQYPKRQEGNRMTGGERSFLPLKVNTAGVIPAIFASSLLMLPTTVAQFTAN 300

Query: 298 SSSPTWIVGL---VDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           ++ P W+  L      L HG+  +M+LY+V IVFF FFYT+I FNP++ A+NL+K+GGF+
Sbjct: 301 ANLPDWMSWLPLVTAQLTHGQPVFMILYAVLIVFFCFFYTSITFNPEDTAENLRKYGGFL 360

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVV 414
           PGIRPG RTA ++DYVLTR+TV+GA Y+  VC+ PE L++  G  +   GTS+LI+VSV 
Sbjct: 361 PGIRPGKRTAEYLDYVLTRLTVIGAAYITAVCLLPEFLVSSLGNSLYFGGTSILIVVSVT 420

Query: 415 LDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           +DT+ QIQ +L+A QYEG+ KK++ + +
Sbjct: 421 MDTVAQIQSHLLAHQYEGLIKKAKLRGR 448


>gi|330993868|ref|ZP_08317800.1| Preprotein translocase subunit secY [Gluconacetobacter sp. SXCC-1]
 gi|329759136|gb|EGG75648.1| Preprotein translocase subunit secY [Gluconacetobacter sp. SXCC-1]
          Length = 449

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 247/439 (56%), Positives = 328/439 (74%), Gaps = 8/439 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF+SF+ A +LK RI FT+ ALIVYR GTYIP+P +D     +     
Sbjct: 1   MASAAEQLAANLNFSSFANATELKKRIWFTLGALIVYRIGTYIPVPGVDATVMGQLLARH 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+F+MF+GGA+ RM VF+L IMPYISASIIVQL++A +PSLE LKKEGE GR+ +
Sbjct: 61  QGGILGMFDMFTGGALGRMTVFALNIMPYISASIIVQLMSAAIPSLEALKKEGEGGRRKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           N+YTRY TV++ + QAYGIA+GL+N     G  +VS    FF+ S ++TL+GGTMFL+WL
Sbjct: 121 NEYTRYLTVVIALFQAYGIAIGLENMHTEAGSAVVSPG-MFFIVSCVLTLVGGTMFLMWL 179

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAV-IAL 234
           GEQIT RG+GNG+SLIIF+GIVA LP++L S+ +LG  G++S P  +L+F    A+ IA 
Sbjct: 180 GEQITSRGVGNGISLIIFAGIVANLPNALASLFQLGYTGALS-PFFVLVFLVLAAITIAF 238

Query: 235 VIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGF 294
           ++F E AQRR++IQYPKRQVG RMF  D +++PLK+NTAG +P IFASS+LL+P TI GF
Sbjct: 239 IVFMELAQRRVVIQYPKRQVGQRMFGGDSTHMPLKVNTAGSIPPIFASSVLLIPVTIAGF 298

Query: 295 IDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           ++ SS P W+  L   LG G+  YM+ Y+  IVFF++FY A+ FNP+E A+NL+K GGF+
Sbjct: 299 VNNSSMPGWLSFLGQELGQGQPLYMLFYAAMIVFFSYFYAAVTFNPQETAENLRKQGGFV 358

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVV 414
           PGIRPG  TA   D +LTR+T +GA YLV VC+ P+ LI+   VP    GTSL+IIV+V 
Sbjct: 359 PGIRPGANTAAFFDRILTRITTIGALYLVAVCLLPQILISHYNVPFYFGGTSLIIIVTVT 418

Query: 415 LDTIVQIQGYLIAQQYEGV 433
           +DT+ Q+Q +L+A QY+G+
Sbjct: 419 IDTVTQVQSHLVAHQYQGL 437


>gi|254294420|ref|YP_003060443.1| preprotein translocase, SecY subunit [Hirschia baltica ATCC 49814]
 gi|254042951|gb|ACT59746.1| preprotein translocase, SecY subunit [Hirschia baltica ATCC 49814]
          Length = 457

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 256/460 (55%), Positives = 336/460 (73%), Gaps = 21/460 (4%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ   N+NF++F +AK+L+ RI+FT+ ALIVYR GT IP+P ID ++ + AF  +
Sbjct: 1   MASAAEQLAKNINFSTFGKAKELQQRILFTLGALIVYRLGTQIPIPGIDPVNLATAFGGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI G+ N+FSGGA+ERMA+F+L +MPYISASII+QL  + VPSLE LKKEGE GRK I
Sbjct: 61  SGGILGMMNVFSGGAIERMAIFALNVMPYISASIIMQLATSAVPSLERLKKEGEAGRKQI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGL-----KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TVLL I QAYGIA  L       G  +  D  ++F+ STI+TL+GGT+FL+WL
Sbjct: 121 NQYTRYGTVLLAIAQAYGIAASLSAINPDTGGSVALDPGWYFMTSTIVTLVGGTVFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQ+T RG+GNG+SLIIF+GIVA +P ++ + L   R G+++  ++  I   +VA+I  +
Sbjct: 181 GEQVTARGVGNGISLIIFAGIVAIMPKTIWNALVSTREGTMNVTVLAAIAIISVAMIVFI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           +F ER+QRRLLIQYPKRQ GNRM   + S+LPLKLNTAGV+P IFA+SLL+LP T  G +
Sbjct: 241 VFVERSQRRLLIQYPKRQQGNRMMGGENSFLPLKLNTAGVIPPIFATSLLILPTTAAGMM 300

Query: 296 ----------DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAAD 345
                      VS     +V L+   G G+  ++VLY + +VFF FFYT+IVFNP+E AD
Sbjct: 301 ASGQGAAGGGAVSEGLRSVVALI---GPGQPLFVVLYGLLVVFFCFFYTSIVFNPEETAD 357

Query: 346 NLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL-IAVTGVPVSLSG 404
           NL+KHGGFIPG RPG RTA ++DYVL+R+TV+GA YL  VC+ PE L +    +P  + G
Sbjct: 358 NLRKHGGFIPGYRPGKRTADYLDYVLSRLTVIGAIYLSIVCLLPEILKMNFKSIPFYIGG 417

Query: 405 TSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR--SKKK 442
           TS+LI+VSV +DT+ QIQ +LIA QYEG+ K+SR   +KK
Sbjct: 418 TSILIVVSVTMDTVAQIQSHLIAHQYEGMIKRSRLGGRKK 457


>gi|329850228|ref|ZP_08265073.1| preprotein translocase, SecY subunit [Asticcacaulis biprosthecum
           C19]
 gi|328840543|gb|EGF90114.1| preprotein translocase, SecY subunit [Asticcacaulis biprosthecum
           C19]
          Length = 458

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/447 (54%), Positives = 334/447 (74%), Gaps = 8/447 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+NF +F++A DL  R++FT+ ALIVYR GTY+PLP ID +++S+AFQ+ 
Sbjct: 1   MASAAEQLAANMNFGAFAKATDLHKRLLFTLGALIVYRLGTYVPLPGIDMVAFSQAFQNN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGRKV 119
           S GIFG+ NMF+GGAVERMAVF+L +MPYISASIIVQL+ +     E L+KEG E GRK 
Sbjct: 61  SQGIFGMMNMFAGGAVERMAVFALNLMPYISASIIVQLMGSVYGPWEKLRKEGGEAGRKQ 120

Query: 120 INQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQI 179
           +NQYTRY TV+LG++Q++ IA G++ G G+       F+ ST ITL  GT+FL+WLGEQI
Sbjct: 121 LNQYTRYLTVVLGLVQSFFIATGMQTG-GMALHPGPLFIISTCITLTSGTLFLMWLGEQI 179

Query: 180 TMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFE 239
           T RGIGNG S+IIF+GIVA LP ++ ++L +G  G +  P+++ I    +A I  ++F E
Sbjct: 180 TARGIGNGSSMIIFAGIVAVLPRTVGTLLNMGSTGDLQAPVLVGILLLLLACIVFIVFME 239

Query: 240 RAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI---D 296
           R+QRRL +QYPKRQVGNR+   + S++PLK+NTAGV+P IFASSLLL+P ++  F+   +
Sbjct: 240 RSQRRLRVQYPKRQVGNRIVGGESSFMPLKVNTAGVIPPIFASSLLLMPTSVATFLNQNN 299

Query: 297 VSSSPTW--IVGLV-DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGF 353
            +  P W  I+G V  +L HG   + +LY+V I+FF F YT++VFNP E A+NL+K+GGF
Sbjct: 300 AADQPEWMRIIGQVAGTLTHGNWMFTLLYAVLIIFFCFLYTSLVFNPDETAENLRKYGGF 359

Query: 354 IPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSV 413
           +PGIRPG RTA ++D+VLTR+TV+GA Y+  VC+ PE LI+  G      GTS+LI+V+V
Sbjct: 360 LPGIRPGKRTAEYLDHVLTRITVIGAAYITIVCLLPEFLISSLGNAFYFGGTSILIVVTV 419

Query: 414 VLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            +DT+ QIQ +L+A QY+G+ KKS+ K
Sbjct: 420 TMDTVAQIQSHLLAHQYDGLIKKSKLK 446


>gi|144900904|emb|CAM77768.1| Preprotein translocase SECY subunit [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 449

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 248/448 (55%), Positives = 332/448 (74%), Gaps = 5/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF   ++A +LK RI FT++AL+VYR GT+IP+P +D    ++ F+  
Sbjct: 1   MASAAEQLAANLNFGVLAKATELKKRIWFTLLALVVYRLGTWIPIPGVDPHVMAEMFKQS 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            +G+ G+F+M +GGA++RM +F+L IMPYISASII+QL+   VPSLE +KKEGE G+K I
Sbjct: 61  GSGLLGMFDMLAGGALQRMTIFALAIMPYISASIIIQLMTTIVPSLEAIKKEGESGKKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV++   QAYGIAVGL+      G  ++ D+   F FST++TL+GGTMFL+WL
Sbjct: 121 NQYTRYLTVVIATFQAYGIAVGLEGMSGSMGSAVIMDNHLLFRFSTVVTLVGGTMFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIG G SLII +GIVA LPS+L   LELGR G++   L++ +   +V +IA +
Sbjct: 181 GEQITARGIGQGTSLIIMAGIVAELPSALAGTLELGRTGALPVLLIIFLLIMSVVIIAGI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           ++FERAQRR+++QYPKRQVGN+MF  + S+LPLKLNT+GV+P IFASSLLL+P T+  F 
Sbjct: 241 VYFERAQRRIIVQYPKRQVGNKMFGGESSHLPLKLNTSGVIPPIFASSLLLMPMTVAQFY 300

Query: 296 DVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIP 355
                P W+      +G G+  Y+ +Y+  IVFFAFFYTA+VFNP + ADNLKK+GGFIP
Sbjct: 301 AGGGGPEWLTTFTALMGRGQPLYLGIYTALIVFFAFFYTAVVFNPVDTADNLKKNGGFIP 360

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           GIRPG  T+ ++DYVLTR+TV+GA YL  + + PE LI+   VP    GTSLLI+V+V +
Sbjct: 361 GIRPGKNTSDYLDYVLTRLTVLGAIYLTALSVLPELLISRFSVPFYFGGTSLLIVVTVTM 420

Query: 416 DTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           DT+ QIQ +L+A QYEG+ KKSR + + 
Sbjct: 421 DTVSQIQSHLLAHQYEGLIKKSRLRGRR 448


>gi|148260919|ref|YP_001235046.1| preprotein translocase, SecY subunit [Acidiphilium cryptum JF-5]
 gi|326404317|ref|YP_004284399.1| preprotein translocase SecY subunit [Acidiphilium multivorum
           AIU301]
 gi|146402600|gb|ABQ31127.1| protein translocase subunit secY/sec61 alpha [Acidiphilium cryptum
           JF-5]
 gi|325051179|dbj|BAJ81517.1| preprotein translocase SecY subunit [Acidiphilium multivorum
           AIU301]
          Length = 449

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 250/439 (56%), Positives = 324/439 (73%), Gaps = 7/439 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  S+ N  + S+A DLK RI FT+ ALIV+R GTYIP+P +D           
Sbjct: 1   MASAAEQLASSFNLETLSKATDLKKRIWFTLGALIVFRLGTYIPIPGVDPTVMEHMLAQN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+FNMFSGGA+ RM VF+L IMPYISASII+QL+ A VP LE LKKEG+ G++ I
Sbjct: 61  GGGILGMFNMFSGGALGRMTVFALNIMPYISASIIMQLLQAAVPQLEALKKEGQTGQQKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVS----DSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TVL+ + Q+YGIA+GL++    V     D   FF+ +T+ITL GG++FL+W+G
Sbjct: 121 NQYTRYLTVLIALAQSYGIAIGLESITSTVGPAVLDPGLFFIVTTVITLTGGSVFLMWVG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RGIGNG SLIIF+GIVA LP ++ SVL+LG  G +ST  ++  F  ++AV+A V+
Sbjct: 181 EQITSRGIGNGSSLIIFAGIVAALPGAIASVLQLGASGGLSTGFVIGFFVLSLAVVAFVV 240

Query: 237 FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFID 296
           F ERAQR++LIQYPKRQVGNRMF  D S+LP+K+NT+GV+P IFASSLLL+PAT++GF  
Sbjct: 241 FMERAQRKVLIQYPKRQVGNRMFGGDSSHLPMKVNTSGVIPPIFASSLLLIPATVIGF-S 299

Query: 297 VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPG 356
             + P W+  L   L +G+  YM+LY+  I+FF++FYTA+VFNP+E ADNLKK+GGF+PG
Sbjct: 300 HGTGPGWLQLLARELSNGQPGYMLLYAGLIIFFSYFYTAVVFNPEETADNLKKYGGFVPG 359

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVS--LSGTSLLIIVSVV 414
           IRPG  TA + D VLTR+T +GA YLV VC+ P+ LI    +       GTSLLI+VSV 
Sbjct: 360 IRPGANTAKYFDTVLTRLTTIGAAYLVIVCLIPQFLIGQFDLAAGYYFGGTSLLIVVSVT 419

Query: 415 LDTIVQIQGYLIAQQYEGV 433
           +DT+ QIQ +L+A QYEG+
Sbjct: 420 MDTVAQIQSHLLAHQYEGL 438


>gi|304321460|ref|YP_003855103.1| secretion protein SecY [Parvularcula bermudensis HTCC2503]
 gi|303300362|gb|ADM09961.1| secretion protein SecY [Parvularcula bermudensis HTCC2503]
          Length = 451

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 245/447 (54%), Positives = 327/447 (73%), Gaps = 10/447 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQF SN+N +SF++A +LK R++FTI ALIVYR GT+IP+P ++  ++   F  +
Sbjct: 1   MVSAAEQFASNINLSSFAKADELKKRLLFTIGALIVYRIGTFIPIPGVNPDAFRDLFSQQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + G+ G FN+FSGGA ERMA+ +L IMPYISASII+Q+++A VPSLE +KKEGE GR+ I
Sbjct: 61  TGGLLGTFNLFSGGATERMAILALNIMPYISASIIMQMMSAVVPSLEAIKKEGESGRRQI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQG--------IVSDSDYFFVFSTIITLLGGTMFL 172
           NQYTRY TVLL  +Q Y IA  +    G        +V + +  F  +T +TL+GG MFL
Sbjct: 121 NQYTRYLTVLLATVQGYFIAATIAGTTGTIAGQTVPVVQNPNAIFYITTTVTLVGGVMFL 180

Query: 173 VWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVI 232
           VWLGEQIT RGIGNG+SLIIF+GIVA LP +   +   GR G++S  +++ +    +A+I
Sbjct: 181 VWLGEQITARGIGNGISLIIFAGIVAELPRAAAGLFASGRTGAMSASVIVGVILGAIAII 240

Query: 233 ALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIM 292
           A V+F ER+QRRL++QYP+RQ GNRM Q + S+LPLKLNTAGV+P IFASS+LLLPAT  
Sbjct: 241 AFVVFIERSQRRLVVQYPRRQQGNRMVQGEKSHLPLKLNTAGVIPPIFASSILLLPATAQ 300

Query: 293 GFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGG 352
             +    SP W+  ++  +  G+  Y  LY+  I+FF F YT+IVFNP++ ADNLKK+GG
Sbjct: 301 AAVG-QDSPLWLQNILIYVAVGQPLYFALYAAGIIFFCFLYTSIVFNPEDTADNLKKYGG 359

Query: 353 FIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT-GVPVSLSGTSLLIIV 411
           +I G RPG RTA +I+YVLTR+TV+GA YL  VC+ PE L A    +P++L GTSLLI+V
Sbjct: 360 YIQGYRPGTRTAEYINYVLTRITVIGAAYLTFVCLVPEFLRAQNPAIPITLGGTSLLIVV 419

Query: 412 SVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           +V LDT+ QIQG+L+AQQYE + KKS+
Sbjct: 420 TVTLDTVQQIQGHLLAQQYESLIKKSK 446


>gi|254419750|ref|ZP_05033474.1| preprotein translocase, SecY subunit [Brevundimonas sp. BAL3]
 gi|196185927|gb|EDX80903.1| preprotein translocase, SecY subunit [Brevundimonas sp. BAL3]
          Length = 459

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/448 (54%), Positives = 323/448 (72%), Gaps = 6/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+N  SF++A +L  R++FT+ AL+VYR GTY+P+P I+  ++ + FQ  
Sbjct: 1   MASAAEQLAANMNMGSFAKATELHKRLLFTLGALLVYRIGTYVPIPGINSQAFLQFFQDP 60

Query: 61  SA--GIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGR 117
           S   GI  +FNMFSGGAVERMA+F+L + PYISASIIVQL+    P  E LKKEG E GR
Sbjct: 61  SGQRGILDMFNMFSGGAVERMAIFALNVAPYISASIIVQLMGTVYPPWEKLKKEGGESGR 120

Query: 118 KVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGE 177
           K +NQYTRY TV L + Q+ GIA GL    G+V +   FF+ ST++TL GGTMFL+WLGE
Sbjct: 121 KQLNQYTRYLTVFLALAQSLGIAAGLNAQPGLVDNPGIFFLVSTVVTLTGGTMFLMWLGE 180

Query: 178 QITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIF 237
           Q+T RG+GNG+SLIIF+GIVA LPS++  +L L + G +S   +L I    VA +  ++F
Sbjct: 181 QVTARGVGNGISLIIFAGIVAVLPSTIARMLGLAQQGQMSAFALLFIAVLAVATVVFIVF 240

Query: 238 FERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV 297
            ERAQRRLLIQYPKRQ GNRM   + S+LPLK+NTAGV+P IFASSLL+LP T+      
Sbjct: 241 MERAQRRLLIQYPKRQEGNRMAGGERSFLPLKVNTAGVIPPIFASSLLMLPTTVASLTAN 300

Query: 298 SSSPT---WIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           +  P    W+  +   L HG+  +M LY+  I+FF FFYT+I FNP++ A+NL+K+GGF+
Sbjct: 301 ADLPDYLGWLPLVTSQLTHGQPLFMALYAALIIFFCFFYTSITFNPEDTAENLRKYGGFL 360

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVV 414
           PGIRPG RTA ++DYVLTR+TV+GA Y+  VC+ PE L+A  G  +   GTS+LI+VSV 
Sbjct: 361 PGIRPGKRTAEYLDYVLTRLTVIGAAYITAVCLLPEFLVAQMGNSLYFGGTSILIVVSVT 420

Query: 415 LDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           +DT+ QIQ  L+A QYEG+ KK++ + +
Sbjct: 421 MDTVAQIQSQLLAHQYEGLIKKAKLRGR 448


>gi|16125517|ref|NP_420081.1| preprotein translocase subunit SecY [Caulobacter crescentus CB15]
 gi|13422601|gb|AAK23249.1| preprotein translocase SecY subunit [Caulobacter crescentus CB15]
          Length = 440

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 240/434 (55%), Positives = 324/434 (74%), Gaps = 8/434 (1%)

Query: 12  LNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMF 71
           +NFASF +A +L  RI FTIIALIVYR GTY+P+P +D  +++  F   S G+ G+F+MF
Sbjct: 1   MNFASFQKATELHKRIWFTIIALIVYRLGTYVPIPGVDPTAFASLFSQNSKGLLGMFDMF 60

Query: 72  SGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKE-GEQGRKVINQYTRYATVL 130
           SGGAVERMA+FSL +MPYISASIIVQL+    P  E LKKE GE GRK +NQYTRY  V+
Sbjct: 61  SGGAVERMAIFSLNVMPYISASIIVQLMGTVYPPWEKLKKEGGEAGRKTLNQYTRYLAVI 120

Query: 131 LGILQAYGIAVGLKNGQGIVSD--SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           L ++Q+  IA+G+    G+V+D     FF+ STI+ L GGTMFL+WLGEQIT RG+GNGV
Sbjct: 121 LAVVQSASIAIGIAAQPGVVADGVGHTFFIVSTIVALTGGTMFLMWLGEQITSRGVGNGV 180

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GIVA LP  L+ +L   +  +   PL L++F    A++A+V F ER+QRRLL+ 
Sbjct: 181 SLIIFAGIVASLPIKLMQMLTQAQSNNNYLPLFLVVFGGIAAILAIV-FIERSQRRLLVH 239

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSP---TWIV 305
           YPKRQ GNRM   + S++PLK+NTAGV+P IFASSLLLLP T +  +  ++ P   +W+ 
Sbjct: 240 YPKRQQGNRMIGGESSFMPLKINTAGVIPPIFASSLLLLPTTALQLVQTANLPGWASWLP 299

Query: 306 GLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTAL 365
            +V +L HG+  ++ LY++ I+FF+FFYT++VFNP E A+NL+K+GGF+PGIRPG RTA 
Sbjct: 300 AMVGALQHGQPAFLALYALLIIFFSFFYTSVVFNPDETAENLRKYGGFLPGIRPGKRTAE 359

Query: 366 HIDYVLTRVTVVGAGYLVCVCIFPE-ALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGY 424
           ++DYVLTR+TV+GA Y+  VCI PE  ++A+     +L GTS+LI+V+V +DT+ QIQ +
Sbjct: 360 YLDYVLTRLTVIGAAYITAVCIAPEFVMMAMNSTQFALGGTSILIVVTVTMDTVAQIQSH 419

Query: 425 LIAQQYEGVFKKSR 438
           L+A QYEG+ KKS+
Sbjct: 420 LLAHQYEGLIKKSK 433


>gi|315497993|ref|YP_004086797.1| preprotein translocase, secy subunit [Asticcacaulis excentricus CB
           48]
 gi|315416005|gb|ADU12646.1| preprotein translocase, SecY subunit [Asticcacaulis excentricus CB
           48]
          Length = 450

 Score =  496 bits (1278), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 333/446 (74%), Gaps = 7/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NLNF++F++A +L  R++FT+ ALIVYR GTYIP+P ID  ++ +AF  +
Sbjct: 1   MASAAEQLAANLNFSAFAKATELHKRLLFTLGALIVYRLGTYIPIPGIDLAAFERAFSGQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGRKV 119
           S GI G+FNMFSGGAVERMA+F+L IMPYISASIIVQL+ +     E L+KEG E GRK 
Sbjct: 61  SQGILGMFNMFSGGAVERMAIFALNIMPYISASIIVQLMGSVYAPWEKLRKEGGEAGRKQ 120

Query: 120 INQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQI 179
           +NQYTRY T++L ++Q++ I+ G++   G+  D    F+ S+++TL GGT+FL+WLGEQI
Sbjct: 121 LNQYTRYLTLILALVQSFSISAGMQ-ASGLALDPGPMFIISSVVTLTGGTLFLMWLGEQI 179

Query: 180 TMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFE 239
           T RG+GNG SLIIF+GIVA LP ++ ++L L + G I+  ++LLI    +A I  ++F E
Sbjct: 180 TARGVGNGTSLIIFAGIVAVLPRTIGNLLALAKEGQINAGVLLLIVLVLIAAIVFIVFME 239

Query: 240 RAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI--DV 297
           R+QRRLL+QYPKRQVGNR+   + S++PLK+NTAGV+P IFASSLLL+P T   F+  D 
Sbjct: 240 RSQRRLLVQYPKRQVGNRVMGGESSFMPLKVNTAGVIPPIFASSLLLMPTTAAAFLARDP 299

Query: 298 SSSP---TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           S  P   +W+ G+   L HG+  +M LY+  I+FF F YT++VFNP E A+NL+K+GGF+
Sbjct: 300 SKVPEWLSWLPGVTAQLTHGQPVFMALYAAMIIFFCFLYTSLVFNPDETAENLRKYGGFL 359

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVV 414
           PGIRPG RTA ++D+VLTR+TV+GA Y+  VC+ PE LI+  G      GTS+LI+V+V 
Sbjct: 360 PGIRPGKRTAEYLDFVLTRITVIGAAYITIVCLLPEFLISNLGNSFYFGGTSILIVVTVT 419

Query: 415 LDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +DT+ QIQ +L+A QY+G+ KKS+ +
Sbjct: 420 MDTVAQIQSHLLAHQYDGLIKKSKMR 445


>gi|297717866|gb|ADI50076.1| preprotein translocase SecY subunit [Candidatus Odyssella
           thessalonicensis L13]
          Length = 435

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 247/436 (56%), Positives = 320/436 (73%), Gaps = 7/436 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M+SAVEQ  S  +F++FS+A+DLK RI FT++ALIVYRFGTYIPLP ++ +   +     
Sbjct: 1   MSSAVEQLASGFSFSTFSKAEDLKKRIYFTLLALIVYRFGTYIPLPGVNPLVIQEFAAMN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GIFG+ +MFSGGA+ RM VF+L IMPYISASIIVQL+ +  P LE LKKEGE GRK +
Sbjct: 61  SGGIFGILDMFSGGAISRMTVFALNIMPYISASIIVQLMTSVSPHLEALKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLG 176
           NQYTRY TVLL  +QA+GIAVGL+         V +  +FF FSTI+TL GGT+F++WLG
Sbjct: 121 NQYTRYGTVLLASVQAFGIAVGLEKMVVGTSTAVLNPGFFFKFSTIVTLTGGTLFIMWLG 180

Query: 177 EQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVI 236
           EQIT RG+GNG SLII+SGIVA LP S        R G+IS  +++LI      VIA V+
Sbjct: 181 EQITSRGLGNGTSLIIYSGIVANLPQSFAKTFISARTGAISNGILVLILLMVAVVIAYVV 240

Query: 237 FFERAQRRLLIQYPKRQVG-NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           F E+AQRR+LIQYPKRQV  +R  Q   ++LPLKLN++GV+P IFA+SLLL PATI GF 
Sbjct: 241 FMEKAQRRILIQYPKRQVAADRPAQAQTTHLPLKLNSSGVIPPIFANSLLLFPATIAGF- 299

Query: 296 DVSSSPTWIVGLVDS-LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
             S +P  I+G++ + + HG+  YM+  +  I+FFAFFYTA+VFNP E A+NL+K G FI
Sbjct: 300 SGSMNPDSILGMIATYMAHGKPLYMICSTALIIFFAFFYTALVFNPTETAENLRKMGTFI 359

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVV 414
           PGIRPG  TA +IDYVLTR+TV+G+ YL  +C+ PE +++   +P    GTS+LI+VSV 
Sbjct: 360 PGIRPGKATADYIDYVLTRLTVIGSIYLASICLLPELILSKVALPFYFGGTSILIVVSVT 419

Query: 415 LDTIVQIQGYLIAQQY 430
           +DTI Q+Q +L+A QY
Sbjct: 420 IDTISQMQSHLVAHQY 435


>gi|302382638|ref|YP_003818461.1| preprotein translocase subunit SecY [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193266|gb|ADL00838.1| preprotein translocase, SecY subunit [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 459

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/448 (54%), Positives = 327/448 (72%), Gaps = 6/448 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+N  SF++A +L  R++FT+ AL+VYR GTY+P+P I+  ++ + F + 
Sbjct: 1   MASAAEQLAANMNMGSFAKATELHKRLLFTLGALLVYRIGTYVPIPGINSEAFLQFFNNP 60

Query: 61  SA--GIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQGR 117
               GI  +FNMFSGGAVERMAVF+L + PYISASIIVQL+ +  P  E LKKEG E GR
Sbjct: 61  DGQRGILDMFNMFSGGAVERMAVFALNVTPYISASIIVQLMGSVYPPWEKLKKEGGESGR 120

Query: 118 KVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGE 177
           K +NQYTRY TV+L + Q++GIAVGL     +V     FF+ +T+++L GGTMFL+WLGE
Sbjct: 121 KQLNQYTRYLTVILALAQSFGIAVGLNAQPNLVDSPGIFFLATTVVSLTGGTMFLMWLGE 180

Query: 178 QITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIF 237
           Q+T RG+GNG+SLIIF+GIVA LP ++  +L L   G IS   +L I    VAV+  ++F
Sbjct: 181 QVTARGVGNGISLIIFAGIVAVLPGTIGRLLGLAEQGQISAFALLFIVVMVVAVVVFIVF 240

Query: 238 FERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV 297
            ERAQRRLLIQYPKRQ GNRM   + S+LPLK+NTAGV+P IFASSLLLLP+T+  F   
Sbjct: 241 MERAQRRLLIQYPKRQEGNRMAGGERSFLPLKVNTAGVIPPIFASSLLLLPSTVANFAAT 300

Query: 298 SSSPTWIVGL---VDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           ++ P W+  L      L HG+  +MVLY++ IVFF FFYT+I FNP++ A+NL+K+GGF+
Sbjct: 301 ANLPAWLAWLPTVAAQLTHGQPLFMVLYALLIVFFCFFYTSITFNPEDTAENLRKYGGFL 360

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVV 414
           PGIRPG RTA ++DYVLTR+TV+GA Y+  VC+ PE + A  G  +   GTS+LI+VSV 
Sbjct: 361 PGIRPGKRTAEYLDYVLTRLTVIGAAYITAVCLLPEIVSANFGQGLYFGGTSVLIVVSVT 420

Query: 415 LDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           +DT+ QIQ  L+A QYEG+ KK++ + +
Sbjct: 421 MDTVAQIQSQLLAHQYEGLIKKAKLRGR 448


>gi|85374444|ref|YP_458506.1| preprotein translocase subunit SecY [Erythrobacter litoralis
           HTCC2594]
 gi|84787527|gb|ABC63709.1| probable preprotein translocase [Erythrobacter litoralis HTCC2594]
          Length = 454

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 250/452 (55%), Positives = 324/452 (71%), Gaps = 10/452 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +   SNL+ A+FS+A +L++RI FTI ALIV+RF +++PLP I+ ++ ++     
Sbjct: 1   MASRADNIASNLSLANFSKATELQNRIWFTIGALIVFRFLSFVPLPGINPLALAELADLT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S G+  +FNMF+GG++ERM++ +LG+MPYI+ASI+VQ+ AA  P+L  LKKEG  GR+ +
Sbjct: 61  SGGVIDMFNMFTGGSLERMSLIALGVMPYITASIVVQMAAALHPTLMALKKEGATGRQKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLK---NGQGI--VSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV L ++Q + +A GL+   N  G+  V D  Y F    +I+L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVFLCMMQGWFLAAGLEAFSNSAGLQAVVDPGYMFRVGAVISLVGGTMFLLWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA  PS   ++ E GR GSIS  L++      V +I ++
Sbjct: 181 GEQITSRGIGNGVSLIIMAGIVAQFPSFAGNMFEGGRTGSISAFLIVGFLIMVVILILVI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
            F ERAQRRLLIQYPKR     M Q D S+LPLKLNTAGV+P IFASSLLLLP TI  F 
Sbjct: 241 CFMERAQRRLLIQYPKRATQRGMMQADRSHLPLKLNTAGVIPPIFASSLLLLPLTISQFS 300

Query: 296 DVSSSPTWIVGLV-----DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
             S  PT   G V       L HG+  YM LY + I+FF FFYTA+VFNP++ ADNLKK+
Sbjct: 301 ANSLDPTSGAGAVIQTLNQYLQHGQPIYMTLYGIGIIFFCFFYTAVVFNPEDTADNLKKN 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG RTA ++DYVLTR+TVVGA YL  VC+ PE +IA TG+P+ L GTSLLI+
Sbjct: 361 GGFIPGIRPGKRTAEYLDYVLTRITVVGAIYLTVVCVLPEYVIAQTGIPLFLGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           V+V +DTI QIQ +L+A QY  + KK++ K +
Sbjct: 421 VNVTVDTISQIQSHLLAHQYGDLIKKAKLKGR 452


>gi|312115707|ref|YP_004013303.1| preprotein translocase, SecY subunit [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220836|gb|ADP72204.1| preprotein translocase, SecY subunit [Rhodomicrobium vannielii ATCC
           17100]
          Length = 440

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 323/438 (73%), Gaps = 5/438 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +NL F++F++A +LK R++FT+ AL++YR GT+IPLP ID    +K F+S 
Sbjct: 1   MVSAAEQLAANLKFSTFAKAGELKQRLLFTLGALLIYRLGTFIPLPGIDTALLAKLFESA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
              +FG+ N+FSGGA+ R A+F L IMPYI+ASII+QL+ + +P+LE LKKEGE GRK I
Sbjct: 61  PNTVFGMLNVFSGGALSRSAIFLLNIMPYITASIIIQLLTSVIPTLETLKKEGESGRKQI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV++  +QA   A GL +      +  +FF  +T+++L+GGTMFLVWLGEQIT
Sbjct: 121 NQYTRYLTVVIATVQATLTAQGLNSS---ALEPGWFFQLTTVVSLVGGTMFLVWLGEQIT 177

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG SLIIF+GIVA +P++L  +LE GR G +S  ++L +F   VAV+ +V+FFER
Sbjct: 178 ARGIGNGASLIIFAGIVAEMPTALYRILEQGRSGVLSPAVILGLFVMMVAVVTVVVFFER 237

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           AQR+L IQYPKRQVGNRMFQ D S+LPLKLN +GV+P IFAS+LL LPATI   +  SS 
Sbjct: 238 AQRKLTIQYPKRQVGNRMFQGDSSHLPLKLNASGVIPPIFASTLLYLPATIEQIVGKSSE 297

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
              +  ++   G G+  +++ Y   IVFF FFYT IV +PK+ A+NLKK+GGFIPGIRPG
Sbjct: 298 --TLNQVLTLFGPGQPLHILFYIALIVFFCFFYTPIVISPKDTAENLKKYGGFIPGIRPG 355

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
            RTA +I+YV+TR+T+VGA Y+  VCI PE L      P    GTSLLI+VSV +DT+ Q
Sbjct: 356 QRTAEYIEYVMTRITLVGAAYVSAVCILPEVLSYQMQAPFYFGGTSLLIVVSVTMDTVAQ 415

Query: 421 IQGYLIAQQYEGVFKKSR 438
           +Q +L+A QYEG+ KK++
Sbjct: 416 VQSHLLAHQYEGLIKKAK 433


>gi|114771247|ref|ZP_01448667.1| preprotein translocase SecY [alpha proteobacterium HTCC2255]
 gi|114548172|gb|EAU51059.1| preprotein translocase SecY [alpha proteobacterium HTCC2255]
          Length = 454

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 247/444 (55%), Positives = 317/444 (71%), Gaps = 2/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  SN+++ +F +AK+L+SRI+F +  LIVYR GT+IP+P ID  +     +S 
Sbjct: 1   MASAAEQMASNISWGAFGKAKELQSRIIFALGMLIVYRLGTFIPVPGIDADALKTFVESA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ NMF+GGAV RMA+F+LGIMPYISASIIVQL+ A VPSLE LKKEGEQGRK I
Sbjct: 61  QQGIGGILNMFTGGAVSRMAIFALGIMPYISASIIVQLMTAMVPSLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L I QAYG++ GL+ G    +     F    IITL+GGTMFL+W+GEQIT
Sbjct: 121 NQYTRYGTVALAIFQAYGLSAGLQAGDMATNPGFLTFQLPCIITLVGGTMFLMWIGEQIT 180

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GIVA LP++L      GR G+IS  ++L +    VAVIA ++F ER
Sbjct: 181 ARGIGNGISLIIFVGIVAELPAALAQFFVQGRQGTISPAVILSVMVMVVAVIAFIVFMER 240

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYPKRQVG +++  + S+LP+KLN AGV+P IFAS+LLLLP TI  F    +S
Sbjct: 241 ALRKVHIQYPKRQVGMKVYGGESSHLPIKLNPAGVIPPIFASALLLLPTTIATFSSTQTS 300

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIV-FNPKEAADNLKKHGGFIPGIRP 359
             ++  L+   G G+  Y V + + IVFF++FYTA V F   E ADNLKK  GF+PGIRP
Sbjct: 301 -GFMNTLLAWFGPGQPLYFVFFVIMIVFFSYFYTANVSFKTDEVADNLKKQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G  T L++DYV+ R+ VVG+ YLV VC+ PE L +   VP    GTSLLI+VSV +DTI 
Sbjct: 360 GKNTGLYLDYVVARILVVGSAYLVAVCLLPEVLRSQFAVPFYFGGTSLLIVVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKN 443
           Q+Q +L+A QYEG+ ++S+   KN
Sbjct: 420 QVQSHLLAHQYEGLIERSKLTGKN 443


>gi|114778804|ref|ZP_01453611.1| SecY protein [Mariprofundus ferrooxydans PV-1]
 gi|114550935|gb|EAU53499.1| SecY protein [Mariprofundus ferrooxydans PV-1]
          Length = 446

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 239/436 (54%), Positives = 308/436 (70%), Gaps = 4/436 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
            F    +  +LKSRI+FT+  LIVYR G +IP+P ID    ++ F      + G+F+MFS
Sbjct: 11  GFGDIGKIPELKSRILFTLGMLIVYRIGAHIPVPGIDAGVLAQFFSQAKGSLLGMFDMFS 70

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R+ +F+LGIMPYISA+II+QL+    P LE LKKEGE GR+ I +YTRY TV L 
Sbjct: 71  GGALSRLTIFALGIMPYISAAIIIQLMTVVSPKLEQLKKEGESGRRKITEYTRYGTVGLA 130

Query: 133 ILQAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           I QA GI++GL++    GQ +V D    F   T+ITL+ GT+FL+W+GEQ+T RGIGNG+
Sbjct: 131 IFQAIGISIGLESFSVGGQSVVIDPGMAFRAMTVITLVTGTIFLMWVGEQVTERGIGNGI 190

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GIVAGLP ++ S LEL R G  S   +L +F+ ++AV   V++FERAQRR+ IQ
Sbjct: 191 SLIIFGGIVAGLPHAVGSTLELARTGEFSAFTVLGLFAMSLAVTGAVVWFERAQRRIPIQ 250

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KRQVGNRM+    S+LPLK+NTAGV+P IFASSL+LLPAT   F        W+  L 
Sbjct: 251 YAKRQVGNRMYGGKASFLPLKVNTAGVIPPIFASSLILLPATFAQFTKGVDGFAWLGDLS 310

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
            +L  G   YM L++  IVFF FFYTAIVF+PK+ ADNLKKHGGFIPGIRPG +TA ++D
Sbjct: 311 AALSPGAWLYMALFTGLIVFFCFFYTAIVFDPKDTADNLKKHGGFIPGIRPGQKTADYVD 370

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            VLTR+TVVGA Y+  VC+ P+ LI+   VP    GTSLLI+V V +DT+ QIQ +L++ 
Sbjct: 371 SVLTRITVVGAAYVSMVCLLPQWLISELSVPFYFGGTSLLIVVVVTMDTMGQIQSHLMSH 430

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ KK+R K   S
Sbjct: 431 QYEGLMKKARLKTGKS 446


>gi|126724888|ref|ZP_01740731.1| protein translocase subunit SecY [Rhodobacterales bacterium
           HTCC2150]
 gi|126706052|gb|EBA05142.1| protein translocase subunit SecY [Rhodobacterales bacterium
           HTCC2150]
          Length = 450

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 315/444 (70%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NL++ +F +A +L+ RIVFT+  LIVYR GTYIP+P ID  +  +  +S 
Sbjct: 1   MASAAEQMAANLSWGAFGKATELRQRIVFTLGLLIVYRLGTYIPVPGIDASALREFVESA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S+G+ G+ NMF+GGA+ RM +F+LGIMPYISASIIVQL+ A VP +E LKKEGEQGRK I
Sbjct: 61  SSGLGGILNMFTGGAIGRMGIFALGIMPYISASIIVQLMTAMVPYMEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL   QAYG+A  L+ G  +  +   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATFQAYGLAASLEAGD-LAHEPGLYFRIACMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GIVA +P++L      GR GSIS    + +    +AVI  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIVAEIPAALAQFFASGREGSISPFATIFVIVMVIAVIGFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    + 
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPIKVNPAGVIPAIFASSLLLLPTTISTFSGAQTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA-IVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  IVFF FFYTA + F   E ADNLK   GF+PGIRP
Sbjct: 300 PI-MSTILAYFGPGQPLYLLFFTAMIVFFTFFYTANVAFKTDEVADNLKSQNGFVPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +T  ++DYV+TR+ VVGAGYL  VC+ PE L +   +P    GTS+LI+VSV +DTI 
Sbjct: 359 GKKTEEYLDYVVTRLLVVGAGYLALVCLLPEILRSQLAIPFYFGGTSVLIVVSVTMDTIQ 418

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKN 443
           Q+Q +L+A QYEG+ +KS+ + K 
Sbjct: 419 QVQSHLVAHQYEGLIEKSQLRGKR 442


>gi|148554254|ref|YP_001261836.1| preprotein translocase subunit SecY [Sphingomonas wittichii RW1]
 gi|148499444|gb|ABQ67698.1| protein translocase subunit secY/sec61 alpha [Sphingomonas
           wittichii RW1]
          Length = 455

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 319/450 (70%), Gaps = 10/450 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+N + F++A +LK R+ FT+ ALI++R  +++PLP +D  S    F + 
Sbjct: 1   MASAAEQMAANINLSQFAKATELKKRLWFTLGALIIFRLLSHVPLPGLDPRSLQSLFDTT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+   FN FSGG++ RM++ +LG+MPYI+ASI+VQL  +  P+L  +KKEGE GRK +
Sbjct: 61  KGGVLDFFNAFSGGSLTRMSLIALGVMPYITASIVVQLATSLSPTLAAIKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TVLL  +Q Y IAVGL++     G   V    Y F  +T+I+L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVLLTGIQGYFIAVGLESWGASAGMEAVVIDPYLFRATTVISLIGGTMFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNG+SLII +GIV+ LP++L ++ E GR GS+S   ++L     +A++A +
Sbjct: 181 GEQITSRGIGNGISLIIMAGIVSQLPTALANLFEGGRTGSLSAMFIVLAVIGVIALVAGI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
           +F ERAQR++LIQYPKRQ    M Q D S+LPLK+NTA V+P IFASSLLL+P TI  F 
Sbjct: 241 VFMERAQRQVLIQYPKRQTARGMMQADKSHLPLKINTANVIPPIFASSLLLMPLTISQFA 300

Query: 296 D--VSSSPTW---IVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
                    W   I+G+   L HG   YM LY+  I+FF FFYTA+VFNP+E ADNLK++
Sbjct: 301 GQRTQGESLWGDFIIGMNQYLHHGTPLYMALYAAGIIFFCFFYTAVVFNPEETADNLKRY 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG  TA ++DYVLTR+TV+GA YL  +C+ PE + A  G+ ++L GTSLLI+
Sbjct: 361 GGFIPGIRPGKNTADYLDYVLTRITVIGAAYLTFICLVPEYVTAQYGLGIALGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           V+V +DT+ QIQ +L+A QY  + KK++ K
Sbjct: 421 VNVTIDTVTQIQSHLLAHQYGDLIKKAKLK 450


>gi|159042861|ref|YP_001531655.1| preprotein translocase subunit SecY [Dinoroseobacter shibae DFL 12]
 gi|157910621|gb|ABV92054.1| preprotein translocase, SecY subunit [Dinoroseobacter shibae DFL
           12]
          Length = 453

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 234/439 (53%), Positives = 318/439 (72%), Gaps = 3/439 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+++++  +A +L+ RI FT+  LIVYR GTYIP+P ID     +     
Sbjct: 1   MASAAEQMAANMSWSALGKATELRQRIFFTLGLLIVYRLGTYIPVPGIDGAQLREFMDQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           +AG+ G+ NMF+GGA+ RM +F+LGIMPYISASIIVQL+ A VP LE LKKEGEQGRK I
Sbjct: 61  AAGLGGVLNMFTGGAISRMGIFALGIMPYISASIIVQLLTAMVPKLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QAYG+A+ L++G G+V+D  +FF  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATFQAYGLAISLESG-GLVTDPGWFFRAACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A LP++L    E GR G++STP++L +    +A +  V+F ER
Sbjct: 180 QRGIGNGISLIIFVGIIAELPAALAQFFESGRSGALSTPVILGVILMLLATLVFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +M+    S+LP+K+N AGV+P+IFASSLLLLP TI  F   +S 
Sbjct: 240 ALRKIHIQYPRRQVGMKMYDGGSSHLPVKINPAGVIPAIFASSLLLLPTTISTFSGGNSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIV-FNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  I+FF +FYTA V F  ++ ADNLK   GFIPGIRP
Sbjct: 300 PI-MSTILAYFGPGQPLYLLFFAGMIIFFTYFYTANVSFKTEDVADNLKNQNGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +T  ++DYV++R+ VVG+GYL  VC+ PE +     +     GTS+LIIVSV +DT+ 
Sbjct: 359 GKKTEEYLDYVVSRILVVGSGYLALVCLIPEMVRTELAITAYFGGTSILIIVSVGMDTVQ 418

Query: 420 QIQGYLIAQQYEGVFKKSR 438
           QIQ +L+A QYEG+ +KS+
Sbjct: 419 QIQSHLLAHQYEGLIEKSQ 437


>gi|74316443|ref|YP_314183.1| preprotein translocase subunit SecY [Thiobacillus denitrificans
           ATCC 25259]
 gi|74055938|gb|AAZ96378.1| SecY protein [Thiobacillus denitrificans ATCC 25259]
          Length = 437

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/420 (55%), Positives = 303/420 (72%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R++F + ALIVYR GT+IP+P ID +   + F+S+  GI G+FNMFSGGA+ R +V
Sbjct: 13  DLKRRLLFLLGALIVYRIGTFIPVPGIDPLVLDQLFKSQQGGILGMFNMFSGGALSRFSV 72

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASIIVQL+    P LE LKKEGE GR+ I QYTRY T+ L + QA GIA+
Sbjct: 73  FALGIMPYISASIIVQLMTTVSPQLEALKKEGEAGRRKITQYTRYGTLFLAVFQALGIAI 132

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V D    F   T++TL  GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLP
Sbjct: 133 ALEAQAGLVLDPGMAFRLITVVTLTAGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLP 192

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++   LEL R G+ S PL+L++F   + V ALV+F ER QR++L+ Y KRQVG  +   
Sbjct: 193 SAIGGTLELTRTGAFSIPLVLMLFVGVLLVTALVVFVERGQRKILVNYAKRQVGKMVVGG 252

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN AGV+P IFASS++L PAT+ G+     +  W+  +  +L  G+  Y++L
Sbjct: 253 QSSHLPLKLNMAGVIPPIFASSIILFPATLAGWFGSGENMGWLKDVGATLSPGQPVYVLL 312

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ I+FF FFYTA+VFNPKE ADNLKK G F+PGIRPGD+TA +ID +LTR+T+VGA Y
Sbjct: 313 YALAIIFFCFFYTALVFNPKETADNLKKSGAFVPGIRPGDQTARYIDKILTRLTLVGAIY 372

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q Y+++ QYEG+ KK+  K 
Sbjct: 373 ITLVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMAQVQAYVMSHQYEGLLKKANFKN 432


>gi|296282602|ref|ZP_06860600.1| preprotein translocase subunit SecY [Citromicrobium bathyomarinum
           JL354]
          Length = 454

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 239/452 (52%), Positives = 315/452 (69%), Gaps = 10/452 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +   SNL+ A+FS+A +L+ RI FT++ALI +RF +++PLP ++       +   
Sbjct: 1   MASRADNLASNLSLANFSKATELRQRIWFTVVALIAFRFLSFVPLPGVNPQILGDLYDQT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+  LFN FSGG++ERM++ +LG+MPYI+ASI+VQ+ +A  P+L  LKKEG  GR+ +
Sbjct: 61  RGGVLDLFNTFSGGSLERMSLIALGVMPYITASIVVQMASALHPTLMALKKEGATGRQKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGL-----KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV L ++Q Y +A GL     ++G   V D    F    +I+L+GGTM L+W+
Sbjct: 121 NQYTRYGTVFLCVIQGYFLATGLESYGAQSGLQAVVDPGIMFRIGAVISLVGGTMLLLWI 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA  PS   ++ E GR G+IS  +++      + +I  +
Sbjct: 181 GEQITARGIGNGVSLIIMAGIVAQFPSFASNMFEGGRTGAISAGVIIGFIVMIIGLILFI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
            F ERAQRRLLIQYPKR     M Q D S+LPLK+NT+GV+P IFASSLLLLP TI  F 
Sbjct: 241 SFMERAQRRLLIQYPKRATQRGMMQADRSHLPLKINTSGVIPPIFASSLLLLPLTISQFA 300

Query: 296 DVSSSPTWIVGLVDS-----LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
             S  P   VG   +     L HG+  YM LY++ IVFF FFYTA+VFNP+E ADNLKK+
Sbjct: 301 GSSVDPNSGVGRTINQLNFYLQHGQPIYMALYAILIVFFCFFYTAVVFNPEETADNLKKN 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG RTA ++DYVLTR+TVVGA YL  VC+ PE +IA TG+P+ L GTSLLI+
Sbjct: 361 GGFIPGIRPGKRTAEYLDYVLTRITVVGAAYLTLVCVLPEYMIAQTGIPLFLGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           V+V +DTI QIQ +L+A QY  + KK++ K +
Sbjct: 421 VNVTVDTISQIQSHLLAHQYGDLIKKAKLKGR 452


>gi|149184331|ref|ZP_01862649.1| protein translocase subunit SecY [Erythrobacter sp. SD-21]
 gi|148831651|gb|EDL50084.1| protein translocase subunit SecY [Erythrobacter sp. SD-21]
          Length = 454

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 322/452 (71%), Gaps = 10/452 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS+ + F SN++ A+FS+A +LK+RI FTI AL+V+RF +++PLP I+  + ++     
Sbjct: 1   MASSADNFASNISLANFSKATELKNRIWFTIGALVVFRFLSFVPLPGINARALTQLADQT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI  +FNMF+GG++ERM++ +LG+MPYI+ASI+VQ+ +A  P+L  LKKEG  GR+ +
Sbjct: 61  RGGIIDMFNMFTGGSLERMSLIALGVMPYITASIVVQMASALHPTLAALKKEGTVGRQKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV L  +Q + +A GL++     G   V D  Y F    +I+L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVFLCTIQGWFLAAGLESYGASTGIAAVVDPGYMFRVGAVISLVGGTMFLLWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA  P+ + ++      GSI T ++L   +  V +I L+
Sbjct: 181 GEQITSRGIGNGVSLIIMAGIVAQFPTFVTNMASGYSEGSIGTGILLGFIAMVVGLILLI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
            + ERAQRRLL+QYPKR     M Q D S+LPLKLNTAGV+P IFASSLLLLP TI  F 
Sbjct: 241 SWVERAQRRLLVQYPKRATQRGMMQADRSHLPLKLNTAGVIPPIFASSLLLLPLTITQFA 300

Query: 296 DVSSSPTWIVG-----LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
             S  P   VG     ++  L HG+  YM LY++ I+FF FFYTA+VFNP+E A+NLKK+
Sbjct: 301 GNSLDPESNVGGTFSTVLQYLQHGQPLYMTLYAIGIIFFCFFYTAVVFNPEETAENLKKN 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG RT  ++DYVLTR+TV+GA YL  VC+ PE +IA TGVP+ L GTSLLI+
Sbjct: 361 GGFIPGIRPGKRTEEYLDYVLTRITVIGAIYLTFVCVVPEYMIAQTGVPLFLGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           V+V +DTI QIQ +L+A QY  + KK++ K +
Sbjct: 421 VNVTVDTISQIQSHLLAHQYGDLIKKAKLKGR 452


>gi|163739469|ref|ZP_02146879.1| SecY protein [Phaeobacter gallaeciensis BS107]
 gi|161387222|gb|EDQ11581.1| SecY protein [Phaeobacter gallaeciensis BS107]
          Length = 454

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/445 (52%), Positives = 320/445 (71%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++A+  +A DL++RI+FT+  LIVYR GTYIP+P ID  +  +   S 
Sbjct: 1   MVSAAEQMAANTSWAALGKATDLRNRILFTLGLLIVYRLGTYIPVPGIDADALRQFMTSA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL   QAYG+AV L++G  + +D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATAQAYGLAVSLESGD-LATDPGMYFRLACMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++   L  GR G+IS  +++ +    +A+I  V+F ER
Sbjct: 180 QRGIGNGISLIIFVGIIAEVPAAIAQFLASGRSGAISPAVIIAVILMMIAIIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S+S
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSAGSTS 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ +   IVFFA+FYT  + F P E A+NLK   GF+PGIRP
Sbjct: 300 GPIMSWLLANFGPGQPLYLLFFVGMIVFFAYFYTFNVSFKPDEVANNLKNQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +++YV+ RV V+G+ YL  VC+ PE L     +PV   GTS+LI+VSVV+DTI 
Sbjct: 360 GKKTAEYLEYVVNRVLVLGSAYLAAVCLLPEILRGQLAIPVYFGGTSVLIVVSVVMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           Q Q +L+A QYEG+ +KS+ + +N 
Sbjct: 420 QAQSHLLAHQYEGLIEKSQLRGRNK 444


>gi|126461155|ref|YP_001042269.1| preprotein translocase subunit SecY [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102819|gb|ABN75497.1| protein translocase subunit secY/sec61 alpha [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 452

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 235/446 (52%), Positives = 318/446 (71%), Gaps = 5/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NL++ +  +A DL+ RI FTI  L+VYR GTYIP+P ID  +  +   S 
Sbjct: 1   MASAAEQMAANLSWGALGKATDLRQRIFFTIGLLMVYRLGTYIPVPGIDGSALRQFMDSA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           +AGI G+ NMF+GGA+ RM +F+LGIMPYISASIIVQL+A+ VP LE LKKEGEQGRK I
Sbjct: 61  TAGIGGMLNMFTGGAISRMGIFALGIMPYISASIIVQLMASMVPKLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QA+GIA+ L+ G  +V+D   FF  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATFQAWGIAMSLEAGD-LVTDPGMFFRAACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GIVA +P+ L   L  GR G+IS  +++ + +  +AVI  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIVAEIPAHLAQFLSQGRSGAISPAVIVGVIAMVIAVITFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    + 
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGQQTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA-IVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  IVFFA+FYTA + F   + A+NLK   GFIPGIRP
Sbjct: 300 PV-MSTILAYFGPGQPLYLLFFAGMIVFFAYFYTANVAFKVDDVAENLKNQNGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +T  +++YV+ R+ V+G+ YL  VC+ PE L    G+P    GTS+LI+VSV +DTI 
Sbjct: 359 GKKTEEYLEYVVNRILVLGSAYLAAVCLLPEILRNQLGIPFYFGGTSVLIVVSVTMDTIN 418

Query: 420 QIQGYLIAQQYEGVFKKS--RSKKKN 443
           Q+Q +L+A QYEG+ ++S  R +K+ 
Sbjct: 419 QVQSHLLAHQYEGLIERSQLRGRKRT 444


>gi|84499822|ref|ZP_00998110.1| preprotein translocase SecY [Oceanicola batsensis HTCC2597]
 gi|84392966|gb|EAQ05177.1| preprotein translocase SecY [Oceanicola batsensis HTCC2597]
          Length = 456

 Score =  468 bits (1205), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 322/446 (72%), Gaps = 3/446 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++A+  +A DL++RI+FTI+ LIVYR GT+IP+P ID ++  +  +  
Sbjct: 1   MVSAAEQMAANTSWAALGKATDLRNRILFTIMLLIVYRLGTWIPVPGIDGVALRQFMEGA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+A+ VPSLE +KKEGEQGRK I
Sbjct: 61  GQGIGGILSMFTGGALGRMGIFALGIMPYISASIIVQLLASMVPSLEAIKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDY-FFVFSTIITLLGGTMFLVWLGEQI 179
           NQYTRY TV L  LQ+YG+AV L++G  + +D  Y FF+ + +ITL+GGTMFL+WLGEQI
Sbjct: 121 NQYTRYGTVFLATLQSYGLAVSLQSGDLVQADIPYWFFIATCMITLIGGTMFLMWLGEQI 180

Query: 180 TMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFE 239
           T RG+GNG+SLIIF GI+A LP++L      GR G+IS  +++ +    VA I  V+F E
Sbjct: 181 TARGLGNGISLIIFVGIIAELPAALAQFFASGRSGAISPAVIVGVILMVVATIGFVVFME 240

Query: 240 RAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSS 299
           RA R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    +
Sbjct: 241 RALRKIHIQYPRRQVGMKVYDGGSSHLPIKVNPAGVIPAIFASSLLLLPVTISTFSGNQT 300

Query: 300 SPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIR 358
           SP  +  ++   G G+  Y++ ++  IVFFA+FYT  + F P++ ADNLK   GF+PGIR
Sbjct: 301 SPV-MSTVLAYFGPGQPLYLLFFTAMIVFFAYFYTFNVSFKPEDVADNLKNQNGFVPGIR 359

Query: 359 PGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTI 418
           PG +TA +++YV  R+ V+G+ YL  VC+ PE L +   +P    GTS+LI+VSV +DTI
Sbjct: 360 PGPKTAEYLEYVANRILVLGSAYLAAVCLLPEILRSQLAIPFYFGGTSVLIVVSVTMDTI 419

Query: 419 VQIQGYLIAQQYEGVFKKSRSKKKNS 444
            Q Q +L+A QYEG+ +KS+ + K S
Sbjct: 420 QQAQSHLLAHQYEGLIEKSQLRGKGS 445


>gi|77462279|ref|YP_351783.1| preprotein translocase subunit SecY [Rhodobacter sphaeroides 2.4.1]
 gi|77386697|gb|ABA77882.1| protein translocase subunit secY/sec61 alpha [Rhodobacter
           sphaeroides 2.4.1]
          Length = 452

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 235/446 (52%), Positives = 318/446 (71%), Gaps = 5/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NL++ +  +A DL+ RI FTI  L+VYR GTYIP+P ID  +  +   S 
Sbjct: 1   MASAAEQMAANLSWGALGKATDLRQRIFFTIGLLMVYRLGTYIPVPGIDGSALRQFMDSA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           +AGI G+ NMF+GGA+ RM +F+LGIMPYISASIIVQL+A+ VP LE LKKEGEQGRK I
Sbjct: 61  TAGIGGMLNMFTGGAISRMGIFALGIMPYISASIIVQLMASMVPRLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QA+GIA+ L+ G  +V+D   FF  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATFQAWGIAMSLEAGD-LVTDPGLFFRAACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GIVA +P+ L   L  GR G+IS  +++ + +  +AVI  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIVAEIPAHLAQFLSQGRSGAISPAVIVGVIAMVIAVITFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    + 
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGQQTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA-IVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  IVFFA+FYTA + F   + A+NLK   GFIPGIRP
Sbjct: 300 PV-MSTILAYFGPGQPLYLLFFAGMIVFFAYFYTANVAFKVDDVAENLKNQNGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +T  +++YV+ R+ V+G+ YL  VC+ PE L    G+P    GTS+LI+VSV +DTI 
Sbjct: 359 GKKTEEYLEYVVNRILVLGSAYLAAVCLLPEILRNQLGIPFYFGGTSVLIVVSVTMDTIN 418

Query: 420 QIQGYLIAQQYEGVFKKS--RSKKKN 443
           Q+Q +L+A QYEG+ ++S  R +K+ 
Sbjct: 419 QVQSHLLAHQYEGLIERSQLRGRKRT 444


>gi|56551433|ref|YP_162272.1| preprotein translocase subunit SecY [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761080|ref|ZP_04759169.1| preprotein translocase, SecY subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260752954|ref|YP_003225847.1| preprotein translocase subunit SecY [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56543007|gb|AAV89161.1| preprotein translocase, SecY subunit [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374699|gb|EER64160.1| preprotein translocase, SecY subunit [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552317|gb|ACV75263.1| preprotein translocase, SecY subunit [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 462

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 239/454 (52%), Positives = 318/454 (70%), Gaps = 11/454 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA  QF SN N + F +A DLK R+ FT +ALIV+R  +++PLP ID  +    F   
Sbjct: 1   MASAANQFASNFNLSQFGKATDLKKRLWFTFLALIVFRLLSFVPLPGIDPRTMGALFAQT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+   FN FSGG++ RM++ +LG+MPYI+ASI+VQL  +  P LE LKKEGE GRK +
Sbjct: 61  HGGVLDFFNTFSGGSLSRMSLIALGLMPYITASIVVQLSTSLSPHLEALKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TVLL  +Q Y IAVGL+N     G   V D    F  S +I+L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVLLTAIQGYFIAVGLENWKTPAGLSAVVDPGLLFRISCVISLIGGTMFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RG+GNG SLII +GIV+ LP  +++ LE  R G+++  L++ + +   A++  +
Sbjct: 181 GEQITSRGVGNGTSLIIMAGIVSQLPVIILNTLERTRSGAVNPALIIAVIAVVAALVLFI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
            F ERAQRR+LIQYPKRQ  N M Q D S+LPLKLNTA V+P IFASS+LL+P TI  F 
Sbjct: 241 CFMERAQRRVLIQYPKRQSANGMMQADKSHLPLKLNTANVIPPIFASSVLLMPLTITQFA 300

Query: 296 --DVSSSPTW---IVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
              V++   W   ++ L   L HG   YM+LY + IVFF+FFYTAIVFNP+E ADNLK++
Sbjct: 301 GQRVTAGGRWSNILITLNQYLAHGTWLYMLLYGIGIVFFSFFYTAIVFNPEETADNLKRY 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGV-PVSLSGTSLLI 409
           GGFIPGIRPG  TA ++DY+LTR+TV+GA YL C+C+ PE + +  G+   ++ GTSLLI
Sbjct: 361 GGFIPGIRPGKATADYLDYLLTRITVIGAAYLTCICLVPEFMASELGMTSFAIGGTSLLI 420

Query: 410 IVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
           +V+V +DT+ QIQ +LIA QY  + +KS+ + K+
Sbjct: 421 VVNVTIDTVTQIQSHLIAHQYGDLIRKSKLRGKS 454


>gi|114570325|ref|YP_757005.1| protein translocase subunit SecY/sec61 alpha [Maricaulis maris
           MCS10]
 gi|114340787|gb|ABI66067.1| protein translocase subunit secY/sec61 alpha [Maricaulis maris
           MCS10]
          Length = 446

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 244/452 (53%), Positives = 326/452 (72%), Gaps = 16/452 (3%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQS- 59
           MASA EQ   N+NF+SF++AK+L  RI+FTI  LIVYR GT++P+P I+ + Y++ F++ 
Sbjct: 1   MASAAEQLAQNMNFSSFAKAKELHQRILFTIGILIVYRIGTFVPIPGINPVQYAELFRNL 60

Query: 60  --KSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG-EQG 116
             +  GI  +FNM  GGAVERMA+F L +MPYISASII+QL++AT+PSLE LKKEG EQG
Sbjct: 61  GGEGQGILSMFNMLGGGAVERMAIFVLNVMPYISASIIMQLMSATIPSLEKLKKEGGEQG 120

Query: 117 RKVINQYTRYATVLLGILQAYGIAVGLK--NGQGIVS--DSDYFFVFSTIITLLGGTMFL 172
           R+ INQYTRY TVLL   QA+ IA+G+   N +G+    +   FF+ ST+ITL+G TM L
Sbjct: 121 RQQINQYTRYLTVLLATGQAFAIAIGMNTPNSEGVALALNPGPFFLASTVITLVGATMLL 180

Query: 173 VWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVI 232
           +WLGEQIT RG+GNGVSLIIF+GI++ +P  +   L         T ++++     +  +
Sbjct: 181 LWLGEQITARGVGNGVSLIIFAGIISAVPGVIGGALSQASSTGDGT-VLVVGGVLILVGL 239

Query: 233 ALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIM 292
            LV+F ER+QRRLL+QYPKRQ GNRM   D S+LPLKLNTAGV+P IFASSLLLLPAT  
Sbjct: 240 LLVVFVERSQRRLLVQYPKRQQGNRMVGGDTSFLPLKLNTAGVIPPIFASSLLLLPATAA 299

Query: 293 GFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGG 352
            F    S P W+   V  LG G  ++M+ Y+  I+FF FFYT++V NP + A+NL+K+GG
Sbjct: 300 SF-QAQSGPGWLQSAVAILGPGSPWFMMAYAAMIIFFCFFYTSVVSNPDDMAENLRKYGG 358

Query: 353 FIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVS 412
           F+PGIRPG RTA +ID+V++R+T +GA YLV +C+ P  +   T    +L GTSLLI+VS
Sbjct: 359 FLPGIRPGKRTAEYIDFVMSRLTFIGALYLVLICMVPMMMNPNT----ALGGTSLLIVVS 414

Query: 413 VVLDTIVQIQGYLIAQQYEGVFKKS--RSKKK 442
           V +DT+ QIQ +L+A QYEG+ KKS  R +K+
Sbjct: 415 VTMDTVSQIQSHLLAHQYEGLIKKSKLRGRKR 446


>gi|114797687|ref|YP_761509.1| preprotein translocase, SecY subunit [Hyphomonas neptunium ATCC
           15444]
 gi|114737861|gb|ABI75986.1| preprotein translocase, SecY subunit [Hyphomonas neptunium ATCC
           15444]
          Length = 451

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/443 (52%), Positives = 322/443 (72%), Gaps = 13/443 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MA+A EQ   NLNFA+F++AKDL++RI+FT+  L++YR GT+IP+P +D   Y+  F+S+
Sbjct: 1   MANAAEQMARNLNFATFAKAKDLQARILFTLGILVLYRLGTFIPIPGLDPSQYAALFESQ 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S+GI G  NMF+GGAVERM VF+L +MPYI+ASII+Q++ +  PSLE LKKEGE GRK I
Sbjct: 61  SSGILGSMNMFAGGAVERMGVFALNVMPYITASIIIQMMTSVSPSLEKLKKEGEAGRKQI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGL--KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQ 178
           NQYTRY T+   ++QA+ IA GL     +GI   S +FF+ + ++TL GGTM L+W+GEQ
Sbjct: 121 NQYTRYLTLGFALVQAFAIAGGLVAVRLEGI---SSWFFILTGVVTLTGGTMLLMWMGEQ 177

Query: 179 ITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFF 238
           IT RGIGNG+SLIIF+GI+A +P ++ +++   R  S+    +L I    +A++  ++F 
Sbjct: 178 ITARGIGNGISLIIFAGIIAEMPRAIFNLVAQARTTSVDIGFILAIVVMVIALVVFIVFI 237

Query: 239 ERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVS 298
           ER+QRRL+I YPKRQ      Q   S+LPLK+NT+GV+P+IFA++LL+LP T +GF+  +
Sbjct: 238 ERSQRRLIIHYPKRQQAQGFAQGQKSFLPLKINTSGVIPAIFATALLMLPLTAVGFLGGN 297

Query: 299 SSPTWIVGLVDSLGH-------GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHG 351
           ++ T   G+   LG        G   Y+V Y+V + FFAFFYT+I+FNP+E ADNL+K+G
Sbjct: 298 AADTEATGMTGVLGWLATNFAPGSWTYIVTYAVLVAFFAFFYTSIMFNPQETADNLRKYG 357

Query: 352 GFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIA-VTGVPVSLSGTSLLII 410
           GFIPGIRPG  TA +IDYVLTR+T +GA YLV +CI PE L      +P  + GTSLLI+
Sbjct: 358 GFIPGIRPGSNTAAYIDYVLTRLTTIGALYLVFICILPELLRRYFPQIPFYIGGTSLLIV 417

Query: 411 VSVVLDTIVQIQGYLIAQQYEGV 433
           VSV +DT+ QIQ +LIA QYEG+
Sbjct: 418 VSVTMDTVTQIQSHLIAHQYEGM 440


>gi|254464217|ref|ZP_05077628.1| preprotein translocase, SecY subunit [Rhodobacterales bacterium
           Y4I]
 gi|206685125|gb|EDZ45607.1| preprotein translocase, SecY subunit [Rhodobacterales bacterium
           Y4I]
          Length = 454

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/445 (51%), Positives = 318/445 (71%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++A+  +A DL++RI+FTI  LIVYR GT+IP+P ID  +  +  +  
Sbjct: 1   MVSAAEQMAANTSWAALGKATDLRNRILFTIGLLIVYRLGTFIPVPGIDAAALRQFMEQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VPSLE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPSLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL   QAYG+AV L+ G  + +D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATAQAYGLAVSLEQGD-LATDPGMYFRMACMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++      GR G+IS  +++ +    VAVI  V+F ER
Sbjct: 180 QRGIGNGISLIIFVGIIAEVPAAIAQFFASGRSGAISPAVIIGVILMVVAVIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   +++
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPTTISAFSSGAAT 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ +   IVFFA+FYT  + F P + A+NLK   GF+PGIRP
Sbjct: 300 GPVMSWLLANFGPGQPLYLLFFVAMIVFFAYFYTFNVSFKPDDVANNLKNQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +I+YV+ R+ V+G+ YL  VC+ PE L     +PV   GTS+LI+VSV +DTI 
Sbjct: 360 GKKTAEYIEYVVNRILVLGSAYLALVCLLPEVLRGQFAIPVYFGGTSVLIVVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           Q+Q +L+A QYEG+ +KS+ + +N 
Sbjct: 420 QVQSHLLAHQYEGLIEKSQLRGRNK 444


>gi|294675879|ref|YP_003576494.1| preprotein translocase subunit SecY [Rhodobacter capsulatus SB
           1003]
 gi|294474699|gb|ADE84087.1| preprotein translocase, SecY subunit [Rhodobacter capsulatus SB
           1003]
          Length = 456

 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 321/450 (71%), Gaps = 8/450 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NL++++F +A DL++RI FTI  LI+YR GTYIP+P ID  +     +  
Sbjct: 1   MASAAEQMAANLSWSAFGKATDLRARIFFTIGLLIIYRLGTYIPVPGIDADALRDFMERA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           S GI G+ +MF+GGA+ RM VF+LGIMPYISASIIVQL+ A VP+LE +KKEGEQGRK I
Sbjct: 61  SQGIGGMLSMFTGGALGRMGVFALGIMPYISASIIVQLMTALVPALEQMKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDS--DYFFVFSTIITLLGGTMFLVWLGEQ 178
           NQ TRY+TV L   QA+G+A  L NG G+ +D+    FF+ S ++TL+GGTMFL+WLGEQ
Sbjct: 121 NQITRYSTVGLATFQAWGLATSLYNG-GMATDAVPHLFFIVSVVVTLVGGTMFLMWLGEQ 179

Query: 179 ITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR-VGSISTPLMLLIFSSTVAVIALVIF 237
           IT RGIGNGVSLIIF GIVA +P++  S    GR  G+ S P+ + +    +AVIA V+F
Sbjct: 180 ITARGIGNGVSLIIFVGIVAEIPAAAASFFAQGRAAGNSSIPVTIGVLVMMIAVIAFVVF 239

Query: 238 FERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV 297
            ERA R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   
Sbjct: 240 MERALRKIHIQYPRRQVGMKIYDGSSSHLPIKVNPAGVIPAIFASSLLLLPTTISTFSGD 299

Query: 298 SSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA-IVFNPKEAADNLKKHGGFIPG 356
           ++ P  +  ++   G G+  Y+  Y+  IVFFA+FYTA + F   E ADNLK  GGFIPG
Sbjct: 300 NTGPI-MSTILAYFGPGQPLYLAFYAGMIVFFAYFYTANVTFKSDEVADNLKNQGGFIPG 358

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLD 416
           IRPG +T  ++DYV+ R+ V+G+ YL  VC+ P  L    GVP    GTS+LI+VSV +D
Sbjct: 359 IRPGKKTEDYLDYVVARILVIGSAYLALVCLLPTILQTELGVPFYFGGTSVLIVVSVTMD 418

Query: 417 TIVQIQGYLIAQQYEGVFKKS--RSKKKNS 444
           TI Q+Q +L+A QYEG+ ++S  R K+K++
Sbjct: 419 TINQVQSHLLAHQYEGLIERSQLRGKRKSA 448


>gi|119383532|ref|YP_914588.1| preprotein translocase subunit SecY [Paracoccus denitrificans
           PD1222]
 gi|119373299|gb|ABL68892.1| protein translocase subunit secY/sec61 alpha [Paracoccus
           denitrificans PD1222]
          Length = 457

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 234/444 (52%), Positives = 315/444 (70%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NL++ +  +A +L+ RI FT+  LI+YR GTYIP+P ID  +        
Sbjct: 1   MASAAEQMAANLSWGALGKATELRQRIWFTLGLLIIYRLGTYIPVPGIDGAALRNFMDQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            AGI G+ +MF+GGA+ RM VF+LGIMPYISASIIVQL+A+ VP+LE +KKEGEQGRK I
Sbjct: 61  QAGIGGILSMFTGGALGRMGVFALGIMPYISASIIVQLLASMVPALEQMKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L + QA+G+AV L++G  +  +   FF  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVALALFQAWGLAVSLEHGN-LAHEPGMFFRASVVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GIVA +P  L   L  GR G++STP++L +     AVIA V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIVAEIPGHLAQFLAQGRSGAVSTPVILGVMIMVAAVIAFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    + 
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGQSSHLPIKVNPAGVIPAIFASSLLLLPVTISTFSGNQTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  IVFF +FYT  + F  ++ A+NLK  GGFIPGIRP
Sbjct: 300 PI-MSTVLAYFGPGQPLYLLFFAAMIVFFTYFYTYNVSFKTEDVAENLKNQGGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G RT  ++ YV+TRV V+G+ YL  VC+ PE +     +P    GTS+LI+VSVV+DTI 
Sbjct: 359 GKRTEDYLTYVVTRVLVIGSAYLAFVCLLPEIIRDQLAIPFYFGGTSVLIVVSVVMDTIN 418

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKN 443
           Q+Q +L+A QYEG+ +KS+ + K 
Sbjct: 419 QVQSHLLAHQYEGLIEKSQLRGKR 442


>gi|254487369|ref|ZP_05100574.1| preprotein translocase, SecY subunit [Roseobacter sp. GAI101]
 gi|214044238|gb|EEB84876.1| preprotein translocase, SecY subunit [Roseobacter sp. GAI101]
          Length = 473

 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 316/444 (71%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SAVE   +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID  +  +  +S 
Sbjct: 20  MVSAVESMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGTALRQFMESA 79

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 80  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLMTSMVPALEQLKKEGEQGRKKI 139

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTR+ TV L  LQAYG+AV L+ G  I +D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 140 NQYTRFGTVALATLQAYGLAVSLEAGD-IAADPGMYFRMACMITLVGGTMFLMWLGEQIT 198

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++      GR G+IS  +++ +    +  I  V+F ER
Sbjct: 199 ARGIGNGISLIIFVGIIAEVPAAIAQFFSSGRSGAISPAVIVGVLVMVIVTIMFVVFMER 258

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +M+    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S+ 
Sbjct: 259 ALRKIHIQYPRRQVGQKMYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGNSTG 318

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
           P   V L+ + G G+  Y++ +   IVFFA+FYT  + F P E ADNLK   GF+PGIRP
Sbjct: 319 PVMSV-LLANFGPGQPLYLLFFVAMIVFFAYFYTFNVSFKPDEVADNLKNQNGFVPGIRP 377

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +++YV+ RV V+GA YL  VCI PE L     +P    GTS+LI+VSV +DTI 
Sbjct: 378 GKKTAEYLEYVVNRVLVLGAAYLAAVCILPEILRGQFAIPFYFGGTSVLIVVSVTMDTIQ 437

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKN 443
           Q+Q +L+A QYEG+ ++S+ + K+
Sbjct: 438 QVQSHLLAHQYEGLLERSQLRGKS 461


>gi|56695420|ref|YP_165768.1| preprotein translocase subunit SecY [Ruegeria pomeroyi DSS-3]
 gi|56677157|gb|AAV93823.1| preprotein translocase, SecY subunit [Ruegeria pomeroyi DSS-3]
          Length = 455

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 319/444 (71%), Gaps = 2/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID ++  +  +  
Sbjct: 1   MVSAAEQMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGVALREFMEQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ A VPSLE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTAMVPSLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTR  TV L  +QAYG+AV L++G  + ++   +F F+T+ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRLGTVALATVQAYGLAVSLESGD-LATEPGMYFRFATMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNGVSLIIF GI+A +P++L      GR G+IS  +++ I    +AVI  V+F ER
Sbjct: 180 ARGIGNGVSLIIFVGIIAEVPAALAQFFASGRSGAISPAVIIAIILMVIAVITFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   +++
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSSGAAN 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ +   IVFFA+FYT  + F P + A NLK   GF+PGIRP
Sbjct: 300 GPVMSWLLANFGPGQPLYLLFFVSMIVFFAYFYTFNVSFKPDDVAQNLKNQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +++YV+ RV V+G+ YL  VC+ PE +     VP    GTS+LIIVSV +DTI 
Sbjct: 360 GKKTAEYLEYVVNRVLVLGSAYLAAVCLLPEIMRGQFNVPFYFGGTSVLIIVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKN 443
           Q+Q +L+A QYEG+ +KS+ + KN
Sbjct: 420 QVQSHLLAHQYEGLIEKSQLRGKN 443


>gi|85709036|ref|ZP_01040102.1| preprotein translocase SecY [Erythrobacter sp. NAP1]
 gi|85690570|gb|EAQ30573.1| preprotein translocase SecY [Erythrobacter sp. NAP1]
          Length = 454

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 242/452 (53%), Positives = 322/452 (71%), Gaps = 10/452 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +   SNLN  +F++A +L+ RI FTI ALIV+RF +++PLP ++ ++     Q  
Sbjct: 1   MASRADNIASNLNLGNFAQATELRQRIWFTIGALIVFRFLSFVPLPGVNPLALDLLAQQN 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
              I  +FNMF+GGA+  M++ +LG+MPYI+ASI+VQ+ +A  P+L  LKKEG  GR+ +
Sbjct: 61  QGTILDMFNMFTGGALANMSLVALGVMPYITASIVVQMASALHPTLAALKKEGASGRQKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKN---GQGI--VSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV L  +Q Y +A GL++    QGI  V +  Y F    +I+L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVFLCAIQGYFLATGLESYASAQGIEAVVNPGYGFRIGAVISLVGGTMFLLWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA  P+  +++ E GR GSI+  +++      V +I L+
Sbjct: 181 GEQITSRGIGNGVSLIIMAGIVAQFPTFAMNMFEGGRTGSIAPTIIIAFLLMVVVLILLI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGF- 294
            F ERAQRRLLIQYPKR     M Q D S+LPLKLNTAGV+P IFASSLLLLP TI  F 
Sbjct: 241 SFVERAQRRLLIQYPKRATQRGMMQADRSHLPLKLNTAGVIPPIFASSLLLLPLTISSFA 300

Query: 295 ---IDVSSS-PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
              +D +S   + IV L   L HG+  YM LY++ I+FF FFYTA+VF+P+E ADNLK++
Sbjct: 301 GNSVDTTSGFGSTIVWLNQYLAHGQPIYMALYAIGIIFFCFFYTAVVFDPEETADNLKRN 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG RTA +++YVLTR+TVVGA YL  VC+ PE +IA TG+P+ L GTSLLI+
Sbjct: 361 GGFIPGIRPGKRTADYLEYVLTRITVVGAIYLTLVCVIPEYMIAQTGIPLFLGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           V+V +DTI Q+Q +L+A QY  + KK++ K +
Sbjct: 421 VNVTVDTISQVQSHLLAHQYGDLIKKAKLKGR 452


>gi|83854953|ref|ZP_00948483.1| preprotein translocase SecY [Sulfitobacter sp. NAS-14.1]
 gi|83941475|ref|ZP_00953937.1| preprotein translocase SecY [Sulfitobacter sp. EE-36]
 gi|83842796|gb|EAP81963.1| preprotein translocase SecY [Sulfitobacter sp. NAS-14.1]
 gi|83847295|gb|EAP85170.1| preprotein translocase SecY [Sulfitobacter sp. EE-36]
          Length = 466

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/444 (51%), Positives = 317/444 (71%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SAVE   +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID  +  +  +S 
Sbjct: 13  MVSAVESMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGTALRQFMESA 72

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 73  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLMTSMVPALEQLKKEGEQGRKKI 132

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTR+ TV L  LQAYG+AV L+ G  I +D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 133 NQYTRFGTVALATLQAYGLAVSLEAGD-IAADPGMYFRIACMITLVGGTMFLMWLGEQIT 191

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++      GR G+IS  +++ +    +A I  V+F ER
Sbjct: 192 ARGIGNGISLIIFVGIIAEVPAAIAQFFSSGRSGAISPAIIVGVLVMVIATIMFVVFMER 251

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +M+    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S+ 
Sbjct: 252 ALRKIHIQYPRRQVGQKMYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGNSTG 311

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
           P   V L+ + G G+  Y++ +   IVFFA+FYT  + F P E ADNLK   GF+PGIRP
Sbjct: 312 PVMSV-LLANFGPGQPLYLLFFVAMIVFFAYFYTFNVSFKPDEVADNLKNQNGFVPGIRP 370

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +++YV+ R+ V+G+ YL  VCI PE L     +P    GTS+LI+VSV +DTI 
Sbjct: 371 GKKTAEYLEYVVNRILVLGSLYLAAVCILPEILRGQFAIPFYFGGTSVLIVVSVTMDTIQ 430

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKN 443
           Q+Q +L+A QYEG+ ++S+ + K+
Sbjct: 431 QVQSHLLAHQYEGLLERSQLRGKS 454


>gi|110678749|ref|YP_681756.1| preprotein translocase subunit SecY [Roseobacter denitrificans OCh
           114]
 gi|109454865|gb|ABG31070.1| preprotein translocase, SecY subunit [Roseobacter denitrificans OCh
           114]
          Length = 454

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 318/446 (71%), Gaps = 7/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SAVE   +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID ++  +  +  
Sbjct: 1   MVSAVESMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGVALREFMEQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ A VP LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLMTAMVPKLEALKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L  LQAYG+AV L+ G  IV+D   FF  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATLQAYGLAVSLEAGD-IVTDPGMFFRASCVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++      GR G+IS  +++ +    +A I  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEVPAAMAQFFASGRSGAISPAVIIGVIIMVIATIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S++
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGNSTN 299

Query: 301 P--TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGI 357
           P  +W   L+ + G G+  Y+  ++  IVFF +FYT  + F P + ADNLK   GFIPGI
Sbjct: 300 PIMSW---LLANFGPGQPLYLAFFTTMIVFFTYFYTFNVSFKPDDVADNLKNQNGFIPGI 356

Query: 358 RPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDT 417
           RPG +T+ +++YV+ RV V+G+ YL  VC+ PE L     +P    GTS+LI+VSV +DT
Sbjct: 357 RPGKKTSEYLEYVVNRVLVLGSAYLAAVCLLPEILRGEFAIPFYFGGTSVLIVVSVTMDT 416

Query: 418 IVQIQGYLIAQQYEGVFKKSRSKKKN 443
           I Q+Q +L+A QYEG+ +KS+ + K+
Sbjct: 417 IQQVQSHLLAHQYEGLLEKSQLRGKS 442


>gi|260427858|ref|ZP_05781837.1| preprotein translocase, SecY subunit [Citreicella sp. SE45]
 gi|260422350|gb|EEX15601.1| preprotein translocase, SecY subunit [Citreicella sp. SE45]
          Length = 448

 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 231/436 (52%), Positives = 309/436 (70%), Gaps = 2/436 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++A+  +A DL++RI+FT+  LIVYR GTYIP+P ID  +     +    GI G+ +
Sbjct: 3   ANTSWAALGKATDLRNRILFTLGLLIVYRLGTYIPVPGIDGAALRNFMEQAGQGIGGMVS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+AA VP LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLLAAMVPFLEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L + QAYG+AV L+ G  +  D  ++F  + +ITL+GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 ALALFQAYGLAVSLEAGD-LAHDPGWYFRAAVVITLVGGTMFLMWLGEQITARGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GIVA +P++L      GR G+IS  ++L      V VI  V+F ERA R++ IQY
Sbjct: 182 LIIFVGIVAEIPAALAQFFASGRSGAISPAIILGAIVMVVLVIMFVVFMERALRKITIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +M +   S+LP+K+N AGV+P+IFASSLLLLP TI  F    S+   +  ++ 
Sbjct: 242 PRRQVGMKMTEAQQSHLPVKVNPAGVIPAIFASSLLLLPTTIATFSQAGSTGPVMSTILA 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ ++  IVFFA+FYT  + F P E ADNLK   GFIPGIRPG +TA H++
Sbjct: 302 YFGPGQPLYLLFFAAMIVFFAYFYTFNVSFKPDEVADNLKNQNGFIPGIRPGKKTADHLE 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+ R+ V+G+ YL  VC+ PE L +   +P    GTS+LI+VSV +DTI QIQ +L+A 
Sbjct: 362 YVVNRILVLGSAYLAAVCLMPEILRSQFAIPFYFGGTSVLIVVSVTMDTIQQIQSHLLAH 421

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ +KS+ + K+ 
Sbjct: 422 QYEGLIQKSQLRGKSK 437


>gi|163733790|ref|ZP_02141232.1| protein translocase subunit SecY [Roseobacter litoralis Och 149]
 gi|161392901|gb|EDQ17228.1| protein translocase subunit SecY [Roseobacter litoralis Och 149]
          Length = 454

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/446 (51%), Positives = 317/446 (71%), Gaps = 7/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SAVE   +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID ++  +  +  
Sbjct: 1   MVSAVESMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGVALREFMEQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ A VP LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLMTAMVPKLEALKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L  LQAYG+AV L+ G  IV+D   FF  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATLQAYGLAVSLEAGD-IVTDPGMFFRASCVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++      GR G+IS  +++ +    +  I  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEVPAAMAQFFASGRSGAISPAVIIGVILMVILTIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S++
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGNSTN 299

Query: 301 P--TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGI 357
           P  +W   L+ + G G+  Y+  ++  IVFF +FYT  + F P + ADNLK   GFIPGI
Sbjct: 300 PIMSW---LLANFGPGQPLYLAFFTTMIVFFTYFYTFNVSFKPDDVADNLKNQNGFIPGI 356

Query: 358 RPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDT 417
           RPG +T+ +++YV+ RV V+G+ YL  VC+ PE L     +P    GTS+LI+VSV +DT
Sbjct: 357 RPGKKTSEYLEYVVNRVLVLGSAYLAAVCLLPEILRGEFAIPFYFGGTSVLIVVSVTMDT 416

Query: 418 IVQIQGYLIAQQYEGVFKKSRSKKKN 443
           I Q+Q +L+A QYEG+ +KS+ + K+
Sbjct: 417 IQQVQSHLLAHQYEGLLEKSQLRGKS 442


>gi|87199290|ref|YP_496547.1| preprotein translocase subunit SecY [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134971|gb|ABD25713.1| protein translocase subunit secY/sec61 alpha [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 455

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 243/456 (53%), Positives = 318/456 (69%), Gaps = 17/456 (3%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +   SNLN A+FS+A +LK RI FT+ ALIV+RF +++PLP ++ +     +   
Sbjct: 1   MASRADNIASNLNLANFSKATELKKRIWFTVGALIVFRFLSFVPLPGVNPLIMETLYNQT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             G+  +FN FSGG++ERM++ +LG+MPYI+ASI+VQL A+  P+L  +KKEGE GRK +
Sbjct: 61  RGGVLDIFNAFSGGSLERMSLIALGVMPYITASIVVQLAASLHPALAAMKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLK-----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY  VLL  +Q + +A GL+     +G   V +    F    +I+L+GGTMFL+WL
Sbjct: 121 NQYTRYGAVLLTAIQGWVLASGLEAYGASSGLQAVVNPGLLFRVGAVISLIGGTMFLLWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA +P    ++ E GR GSIS     LIF   + +IALV
Sbjct: 181 GEQITSRGIGNGVSLIIMAGIVAQMPKFFGNLFEGGRTGSISP---FLIFGIVIMLIALV 237

Query: 236 I---FFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIM 292
           I   F ERA RRLLIQYPKR     M   D S+LPLK+NTAGV+P IFASSLLLLP TI 
Sbjct: 238 IGICFLERATRRLLIQYPKRATQRGMMAADRSHLPLKINTAGVIPPIFASSLLLLPLTIT 297

Query: 293 GFIDVSSSPTW-----IVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNL 347
            F   S SP       IV L   LGHG+  YM+ Y++ I+FF+FFYTA+VFNP+E A+NL
Sbjct: 298 QFAGNSISPDTKMGQAIVTLNQYLGHGKPLYMLFYALGIIFFSFFYTAVVFNPEETAENL 357

Query: 348 KKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGV-PVSLSGTS 406
           KK+GGFIPGIRPG  TA ++DYVLTR+TV+GA Y+  VC+ PE ++A TG+  +   GTS
Sbjct: 358 KKNGGFIPGIRPGKNTANYLDYVLTRITVLGAAYITVVCVVPEFIMAETGMGTLFFGGTS 417

Query: 407 LLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           LLI+V+V +DTI QIQ +L+A QY  + KK++ K +
Sbjct: 418 LLIVVNVTVDTITQIQSHLLAHQYGDLIKKAKLKGR 453


>gi|67458690|ref|YP_246314.1| preprotein translocase subunit SecY [Rickettsia felis URRWXCal2]
 gi|75536848|sp|Q4UMQ9|SECY_RICFE RecName: Full=Preprotein translocase subunit secY
 gi|67004223|gb|AAY61149.1| Preprotein translocase SecY subunit [Rickettsia felis URRWXCal2]
          Length = 433

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/434 (52%), Positives = 321/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFTI+ LIV RFG++IP+P ID I+ S   +   +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTILILIVCRFGSFIPIPGIDSIALSSVAEKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + L +    V +IA++IFFE+AQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIALAVCIGVVVLIAIIIFFEKAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|163740262|ref|ZP_02147656.1| protein translocase subunit SecY [Phaeobacter gallaeciensis 2.10]
 gi|161386120|gb|EDQ10495.1| protein translocase subunit SecY [Phaeobacter gallaeciensis 2.10]
          Length = 447

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/436 (52%), Positives = 315/436 (72%), Gaps = 2/436 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++A+  +A DL++RI+FT+  LIVYR GTYIP+P ID  +  +   S   GI G+ +
Sbjct: 3   ANTSWAALGKATDLRNRILFTLGLLIVYRLGTYIPVPGIDADALRQFMTSAGQGIGGMVS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           LL   QAYG+AV L++G  + +D   +F  + +ITL+GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 LLATAQAYGLAVSLESGD-LATDPGMYFRLACMITLVGGTMFLMWLGEQITQRGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P+++   L  GR G+IS  +++ +    +A+I  V+F ERA R++ IQY
Sbjct: 182 LIIFVGIIAEVPAAIAQFLASGRSGAISPAVIIAVILMMIAIIMFVVFMERALRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S+S   +  L+ 
Sbjct: 242 PRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSAGSTSGPIMSWLLA 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
           + G G+  Y++ +   IVFFA+FYT  + F P E A+NLK   GF+PGIRPG +TA +++
Sbjct: 302 NFGPGQPLYLLFFVGMIVFFAYFYTFNVSFKPDEVANNLKNQNGFVPGIRPGKKTAEYLE 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+ RV V+G+ YL  VC+ PE L     +PV   GTS+LI+VSVV+DTI Q Q +L+A 
Sbjct: 362 YVVNRVLVLGSAYLAAVCLLPEILRGQLAIPVYFGGTSVLIVVSVVMDTIQQAQSHLLAH 421

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ +KS+ + +N 
Sbjct: 422 QYEGLIEKSQLRGRNK 437


>gi|15892909|ref|NP_360623.1| preprotein translocase subunit SecY [Rickettsia conorii str. Malish
           7]
 gi|81774404|sp|Q92GY6|SECY_RICCN RecName: Full=Preprotein translocase subunit secY
 gi|15620100|gb|AAL03524.1| preprotein translocase secY subunit [Rickettsia conorii str. Malish
           7]
          Length = 433

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFTI+ LIV RFG++IP+P ID I+ S       +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTILILIVCRFGSFIPIPGIDSIALSSVAAQNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRITTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFERAQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFERAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|91774655|ref|YP_544411.1| preprotein translocase subunit SecY [Methylobacillus flagellatus
           KT]
 gi|91708642|gb|ABE48570.1| protein translocase subunit secY/sec61 alpha [Methylobacillus
           flagellatus KT]
          Length = 440

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 228/427 (53%), Positives = 308/427 (72%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  +  +LKSR++F + ALIV+R G +IP+P ID    ++ F+S+S GI G+FNMFSG
Sbjct: 7   FGAVGKVSELKSRLLFVLGALIVFRLGAHIPVPGIDPDVLARLFESQSGGILGMFNMFSG 66

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+ER  +F+LGIMPYISASII+QL+    P +E LKKEGE GR+ I +YTRY TV L  
Sbjct: 67  GALERFTIFALGIMPYISASIIMQLLTVVSPRMEQLKKEGESGRRTITKYTRYGTVFLAT 126

Query: 134 LQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIF 193
            QA GIA+ L+   G+V D  + F F+T+ITL+GGTMFL+WLGEQIT RGIGNG+S+IIF
Sbjct: 127 FQALGIAIALEGQAGLVLDPGFMFRFTTVITLVGGTMFLMWLGEQITERGIGNGISIIIF 186

Query: 194 SGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQ 253
           +GIVAGLP ++   LEL R G+ S PL+L +F + + V A V+F ER QR++ + Y KRQ
Sbjct: 187 AGIVAGLPHAIGGTLELARTGAFSIPLVLFLFVAAILVTAFVVFVERGQRKITVNYAKRQ 246

Query: 254 VGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGH 313
           VG ++F    S+LPLKLN AGV+P IFASS++L PAT+ G+     S TW+  +  +L  
Sbjct: 247 VGRKVFGGQTSHLPLKLNMAGVIPPIFASSIILFPATLAGWFGSHESMTWLKDIGSTLSP 306

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G+  Y++ ++  I+FF FFYTA+VFNPKE ADNLKK G F+PGIRPG++TA +ID ++ R
Sbjct: 307 GQPLYILFFATAIIFFCFFYTALVFNPKETADNLKKSGAFVPGIRPGEQTARYIDRIMGR 366

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV 433
           +T+ GA Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q +L++ QYEG+
Sbjct: 367 LTLAGALYITAVCLLPEFLILKFNVPFYFGGTSLLIIVVVTMDFMAQVQSHLMSHQYEGL 426

Query: 434 FKKSRSK 440
            KK+  K
Sbjct: 427 LKKANFK 433


>gi|157828840|ref|YP_001495082.1| preprotein translocase subunit SecY [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165933567|ref|YP_001650356.1| preprotein translocase subunit SecY [Rickettsia rickettsii str.
           Iowa]
 gi|157801321|gb|ABV76574.1| preprotein translocase subunit SecY [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165908654|gb|ABY72950.1| protein translocase subunit [Rickettsia rickettsii str. Iowa]
          Length = 433

 Score =  458 bits (1179), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFT++ LIV RFG++IP+P ID I+ S       +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTMLILIVCRFGSFIPIPGIDSIALSSVAAKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFERAQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFERAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNTAGV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTAGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKIKLKN 433


>gi|238650952|ref|YP_002916808.1| preprotein translocase subunit SecY [Rickettsia peacockii str.
           Rustic]
 gi|238625050|gb|ACR47756.1| preprotein translocase subunit SecY [Rickettsia peacockii str.
           Rustic]
          Length = 433

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFTI+ LIV RFG++IP+P ID I+ S       +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTILILIVCRFGSFIPIPGIDSIALSSVAAKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFERAQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFERAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTLTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKIKLKN 433


>gi|94498496|ref|ZP_01305052.1| SecY protein [Sphingomonas sp. SKA58]
 gi|94422039|gb|EAT07084.1| SecY protein [Sphingomonas sp. SKA58]
          Length = 454

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 317/452 (70%), Gaps = 10/452 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +Q  SNL+ A FS+A DLK R+ FT+ ALIV+RF +++PLP +D  + S  +   
Sbjct: 1   MASRADQLASNLSLAKFSQATDLKKRLWFTLGALIVFRFLSFVPLPGVDPTALSTLYAQT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI  +FN FSGG++ RM++ +LG+MPYI+ASI+VQL A+  P L  +KKEGE GRK +
Sbjct: 61  NGGILDIFNTFSGGSLSRMSLIALGVMPYITASIVVQLAASLSPQLAAIKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGL-----KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV L  +Q Y IA GL     ++G   V D    F  + +++L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVGLTAVQGYFIAAGLESFGAQSGVQAVVDPGLLFRLTAVVSLIGGTMFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA LP +L ++ + GR GSIS  L++L+    + +I L+
Sbjct: 181 GEQITSRGIGNGVSLIIMAGIVAQLPVTLSNLFKSGREGSISGLLIMLVIVMALGLILLI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGF- 294
            + ERAQRR+LIQYPKRQ    + Q D S+LPLK+NTAGV+P IFASSLLL+P TI  F 
Sbjct: 241 CYMERAQRRVLIQYPKRQTRQGLMQADRSHLPLKVNTAGVIPPIFASSLLLMPLTISQFA 300

Query: 295 ----IDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
                  S    +++ L   L HG   YM LY + IVFF FFYTA+VFNP+E ADNLK++
Sbjct: 301 GQTVAGESRLGDFVLTLNQYLSHGSPVYMALYGLGIVFFCFFYTAVVFNPEETADNLKRN 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG  T  ++DYVLTR+TV+GA YL  +C+ PE  IA  G+P  L GTSLLI+
Sbjct: 361 GGFIPGIRPGKNTEHYLDYVLTRITVIGAAYLAFICLVPEFAIARAGIPFYLGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           V+V +DT+ QIQ +L+A QY  + KK++ K +
Sbjct: 421 VNVTVDTVTQIQSHLLAHQYGDLIKKAKLKGR 452


>gi|239787583|emb|CAX84051.1| Preprotein translocase SecY family protein [uncultured bacterium]
          Length = 440

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/434 (52%), Positives = 308/434 (70%), Gaps = 9/434 (2%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           A+  R  +L+ R++FT+  LIVYR G ++P P ID  + +  F  +   + G+FNMFSGG
Sbjct: 11  ANLGRIPELRKRLLFTLGMLIVYRIGAHVPTPGIDPKALAAFFDQQQGTLLGMFNMFSGG 70

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ R+ VF+LGIMPYIS+SII+QL+ A  P LE +KKEGE GR+ INQYTRY TV+L I 
Sbjct: 71  ALSRLTVFALGIMPYISSSIILQLMTAVFPKLEAIKKEGELGRRKINQYTRYGTVVLSIF 130

Query: 135 QAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
           Q +GIA GL++    G G+V +  + F   T+ITL  GT F++W+GEQIT RGIGNG+SL
Sbjct: 131 QGFGIAYGLESMQAGGLGVVVEPGWAFRVMTVITLTSGTAFIMWVGEQITARGIGNGISL 190

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           IIF+GIVA LP +LV  LEL R G +    +L +   +VAV A +IF ERAQRR+ +QY 
Sbjct: 191 IIFAGIVANLPIALVKTLELARTGDLQPLFVLFLLVMSVAVTAFIIFMERAQRRITVQYA 250

Query: 251 KRQV-GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           KRQV G RM   + ++LPLK+NT+GV+P IFASS++L P TI  F    +   W+    +
Sbjct: 251 KRQVSGRRMVGGESTHLPLKVNTSGVIPPIFASSIILFPVTIANF----APWEWLKSAAN 306

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
           +L  G   YMV+YS+ IVFF FFYTAIVFNP+E ADNL+K+GGF+PGIRPG RTA ++D 
Sbjct: 307 ALSPGHVAYMVVYSLAIVFFCFFYTAIVFNPQETADNLQKYGGFVPGIRPGVRTAEYLDR 366

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           +LTR+T+VGA Y+  VC+ PE LI+   VP    GTS+LI+V V +DT  QIQ +LI++Q
Sbjct: 367 ILTRLTLVGAVYVTAVCLLPEILISSYNVPFYFGGTSMLIVVGVTMDTASQIQSFLISRQ 426

Query: 430 YEGVFKKSRSKKKN 443
           YEG+ +K+R + + 
Sbjct: 427 YEGLMQKARIRGRR 440


>gi|229586989|ref|YP_002845490.1| preprotein translocase subunit SecY [Rickettsia africae ESF-5]
 gi|228022039|gb|ACP53747.1| Preprotein translocase secY subunit [Rickettsia africae ESF-5]
          Length = 433

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFT++ LIV RFG++IP+P ID I+ S       +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTVLILIVCRFGSFIPIPGIDSIALSSVAAKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFERAQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFERAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|34581389|ref|ZP_00142869.1| preprotein translocase secY subunit [Rickettsia sibirica 246]
 gi|28262774|gb|EAA26278.1| preprotein translocase secY subunit [Rickettsia sibirica 246]
          Length = 433

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFTI+ LIV RFG++IP+P ID I+ S       +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTILILIVCRFGSFIPIPGIDSIALSSVAAKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFERAQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFERAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTA+VFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAVVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|91205857|ref|YP_538212.1| preprotein translocase subunit SecY [Rickettsia bellii RML369-C]
 gi|157826784|ref|YP_001495848.1| preprotein translocase subunit SecY [Rickettsia bellii OSU 85-389]
 gi|122425379|sp|Q1RHP1|SECY_RICBR RecName: Full=Preprotein translocase subunit secY
 gi|91069401|gb|ABE05123.1| Preprotein translocase secY subunit [Rickettsia bellii RML369-C]
 gi|157802088|gb|ABV78811.1| preprotein translocase subunit SecY [Rickettsia bellii OSU 85-389]
          Length = 433

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/436 (52%), Positives = 319/436 (73%), Gaps = 9/436 (2%)

Query: 11  NLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNM 70
           N NF+  S + DL +RI+FTI  LI+ RFG++IP+  ID I+     +   +GI G+FNM
Sbjct: 2   NQNFSKKS-SNDLINRIIFTIFVLIICRFGSFIPIAGIDAIALGSIAEKNQSGILGMFNM 60

Query: 71  FSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVL 130
            SGG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ INQ +RY TVL
Sbjct: 61  LSGGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEAGKRKINQLSRYLTVL 120

Query: 131 LGILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGN 186
           L  LQAYG+AV L+    N   +V     FF  +T+ITL+ GTM L+WLGEQIT RGIGN
Sbjct: 121 LASLQAYGVAVSLESIVTNTGPVVIIPGLFFKITTVITLVVGTMLLMWLGEQITQRGIGN 180

Query: 187 GVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLL 246
           G SLIIF GI++G+PS+++S+ EL R G++S  + + + +  V +I+++IFFE+AQR+LL
Sbjct: 181 GTSLIIFIGIISGVPSAIISMFELSRKGALSPLVAIAVCAGVVILISIIIFFEKAQRKLL 240

Query: 247 IQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVG 306
           +QYPKRQVGN+++  D +Y+PLKLNT+GV+P IFASS+LL PAT+  F   SSS + I+ 
Sbjct: 241 VQYPKRQVGNKIYGGDSTYMPLKLNTSGVIPPIFASSILLFPATLANF---SSSNSEIMN 297

Query: 307 LVD-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTAL 365
           ++   LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ 
Sbjct: 298 MLTYYLGHGKPIYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSE 357

Query: 366 HIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYL 425
           + DY+LTR+TVVG  YL  +CI PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL
Sbjct: 358 YFDYILTRLTVVGGIYLSVICIIPELLMNKYVISLSLGGTSFLIVVNVVLDTLTQIQTYL 417

Query: 426 IAQQYEGVFKKSRSKK 441
            + +YE + KK + K 
Sbjct: 418 FSSKYESLMKKVKLKN 433


>gi|163745564|ref|ZP_02152924.1| protein translocase subunit SecY [Oceanibulbus indolifex HEL-45]
 gi|161382382|gb|EDQ06791.1| protein translocase subunit SecY [Oceanibulbus indolifex HEL-45]
          Length = 460

 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/443 (51%), Positives = 317/443 (71%), Gaps = 9/443 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SAVE   +N ++A+  +A DL++RI+FT+  LIVYR GT+IP+P ID  +     +S 
Sbjct: 1   MVSAVENMAANTSWAALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGGALRDFMESA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSD--YFFVFSTIITLLGGTMFLVWLGEQ 178
           NQYTRY TV L  LQ+YG+AV L+ G  IV+D    + F+ + +ITL+GGTMFL+WLGEQ
Sbjct: 121 NQYTRYGTVALATLQSYGLAVSLQAGD-IVADGQMGFGFIAACMITLVGGTMFLMWLGEQ 179

Query: 179 ITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFF 238
           IT RGIGNG+SLIIF GI+A +P+++      GR G+IS  +++ +    +A I  V+F 
Sbjct: 180 ITARGIGNGISLIIFVGIIAEVPAAIAQFFASGRSGAISPAVIIGVLVMVIATIMFVVFM 239

Query: 239 ERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVS 298
           ERA R++ IQYP+RQVG +M+    S+LP+K+N AGV+P+IFASSLLLLP T+  F   S
Sbjct: 240 ERALRKIHIQYPRRQVGMKMYDGGTSHLPVKVNPAGVIPAIFASSLLLLPVTVSTFSGNS 299

Query: 299 SSP--TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIP 355
           +SP  +W   L+ + G G+  Y++ +   IVFFA+FYT  + F P + ADNLK   GF+P
Sbjct: 300 TSPVMSW---LLANFGPGQPLYLLFFVAMIVFFAYFYTFNVSFKPDDVADNLKNQNGFVP 356

Query: 356 GIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
           GIRPG RTA +++YV+ R+ V+G+ YL  VC+ PE L     +P    GTS+LI+VSV +
Sbjct: 357 GIRPGKRTAEYLEYVVNRILVLGSFYLAAVCVLPEILRGQFAIPFYFGGTSVLIVVSVTM 416

Query: 416 DTIVQIQGYLIAQQYEGVFKKSR 438
           DTI Q+Q +L+A QYEG+ ++S+
Sbjct: 417 DTIQQVQSHLLAHQYEGLLERSQ 439


>gi|71083785|ref|YP_266505.1| preprotein translocase subunit SecY [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062898|gb|AAZ21901.1| Preprotein translocase SECY subunit [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 426

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 306/427 (71%), Gaps = 2/427 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           +S S+  DLK+RI+FTI  L VYRFGT++P+P ID             G+ G+FN+FSGG
Sbjct: 2   SSSSQTNDLKNRIIFTIFILAVYRFGTFVPIPGIDPEQLQTMMSGNQKGLLGMFNVFSGG 61

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           AV RMA+F+LGIMPYIS+SIIVQL+       +NLK +GE GR  I Q TRY TV+L  +
Sbjct: 62  AVSRMAIFALGIMPYISSSIIVQLLTGVSDYFKNLKAQGETGRAKITQITRYGTVILATI 121

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q YG+++GL++   +V +   FF  + + T++ GTMFL+WLGEQIT RGIGNG+SLIIF+
Sbjct: 122 QGYGLSIGLQSSADLVINPGLFFTITAVSTIVAGTMFLMWLGEQITQRGIGNGISLIIFA 181

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVA +P +LV+  ELGR G++ST +++ IF   VA I  ++F ERA R++LI YPKRQ+
Sbjct: 182 GIVAEIPRALVTTFELGRTGAVSTIMIIGIFVLLVATIMFIVFMERALRKILINYPKRQM 241

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GN+M+  + S+LPLK+N AGV+P+IFAS+LLLLP T   F   S + T++  L      G
Sbjct: 242 GNKMYGGESSHLPLKINQAGVIPAIFASALLLLPVTFSNF-SFSDNDTFL-NLSSYFTQG 299

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  YM+LY+  I+FF FFYT+I FNP E ADNL+K+GGF+PGIRPG+ TAL+I+ +LT++
Sbjct: 300 QPLYMLLYASGIIFFTFFYTSITFNPTETADNLRKYGGFVPGIRPGENTALYIEKILTKL 359

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T +GA YL  VC+ PE LIA   +P  L GTS+LI+V V +DT+ QIQ  L++ QYE + 
Sbjct: 360 TTIGALYLTIVCLMPEFLIANYPIPFYLGGTSILIVVVVAIDTVTQIQTRLMSSQYEQLI 419

Query: 435 KKSRSKK 441
           KK++  K
Sbjct: 420 KKTKFGK 426


>gi|221638133|ref|YP_002524395.1| preprotein translocase subunit SecY [Rhodobacter sphaeroides KD131]
 gi|221158914|gb|ACL99893.1| Preprotein translocase secY subunit [Rhodobacter sphaeroides KD131]
          Length = 445

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 312/437 (71%), Gaps = 5/437 (1%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +NL++ +  +A DL+ RI FTI  L+VYR GTYIP+P ID  +  +   S +AGI G+ N
Sbjct: 3   ANLSWGALGKATDLRQRIFFTIGLLMVYRLGTYIPVPGIDGSALRQFMDSATAGIGGMLN 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+A+ VP LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGAISRMGIFALGIMPYISASIIVQLMASMVPKLEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L   QA+GIA+ L+ G  +V+D   FF  + +ITL+GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 FLATFQAWGIAMSLEAGD-LVTDPGMFFRAACVITLVGGTMFLMWLGEQITARGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GIVA +P+ L   L  GR G+IS  +++ + +  +AVI  V+F ERA R++ IQY
Sbjct: 182 LIIFVGIVAEIPAHLAQFLSQGRSGAISPAVIVGVIAMVIAVITFVVFMERALRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    + P  +  ++ 
Sbjct: 242 PRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGQQTGPV-MSTILA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTA-IVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ ++  IVFFA+FYTA + F   + A+NLK   GFIPGIRPG +T  +++
Sbjct: 301 YFGPGQPLYLLFFAGMIVFFAYFYTANVAFKVDDVAENLKNQNGFIPGIRPGKKTEEYLE 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+ R+ V+G+ YL  VC+ PE L    G+P    GTS+LI+VSV +DTI Q+Q +L+A 
Sbjct: 361 YVVNRILVLGSAYLAAVCLLPEILRNQLGIPFYFGGTSVLIVVSVTMDTINQVQSHLLAH 420

Query: 429 QYEGVFKKS--RSKKKN 443
           QYEG+ ++S  R +K+ 
Sbjct: 421 QYEGLIERSQLRGRKRT 437


>gi|157804015|ref|YP_001492564.1| preprotein translocase subunit SecY [Rickettsia canadensis str.
           McKiel]
 gi|157785278|gb|ABV73779.1| preprotein translocase subunit SecY [Rickettsia canadensis str.
           McKiel]
          Length = 433

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SR+VFTI+ LIV RFG++IP+P ID I+ S   +   +GI G+FNM S
Sbjct: 4   NFSQKS-GNDLVSRVVFTILILIVCRFGSFIPIPGIDSIALSSVAEKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM+VF+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVL  
Sbjct: 63  GGSLGRMSVFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLFA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GIV+G+PS+++S+ EL R G++S  + + +    V +IA++IFFE+AQR+LL+Q
Sbjct: 183 SLIIFIGIVSGVPSAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFEKAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGETTHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIIFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ +L +
Sbjct: 360 DYILTRLTVIGGMYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTHLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|99080116|ref|YP_612270.1| preprotein translocase subunit SecY [Ruegeria sp. TM1040]
 gi|99036396|gb|ABF63008.1| protein translocase subunit secY/sec61 alpha [Ruegeria sp. TM1040]
          Length = 454

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 233/445 (52%), Positives = 317/445 (71%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++A+  +A DL++RI+FTI  LIVYR GT+IP+P ID  +  +   + 
Sbjct: 1   MVSAAEQMAANTSWAALGKATDLRNRILFTIGLLIVYRLGTWIPVPGIDADALRQFMDTA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL   QAYG+A  L+ G  +  D   +F  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATAQAYGLAASLEAGD-MAFDPGLYFRLSCMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++V     GR G+IS  +++ +    VAVI  V+F ER
Sbjct: 180 NRGIGNGISLIIFVGIIAEIPAAIVQFFASGRSGAISPAVIIAVIVMVVAVIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S+S
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPTTISTFSQGSAS 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ ++  IVFFA+FYT  + F P + A NLK   GF+PGIRP
Sbjct: 300 SPVMSWLLANFGPGQPLYLLFFTAMIVFFAYFYTFNVSFKPDDVAQNLKNQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +I+YV+ RV V+G+ YL  VC+ PE L     +PV   GTS+LI+VSV +DTI 
Sbjct: 360 GKKTAEYIEYVVNRVLVLGSAYLALVCLLPEILRNNFAIPVYFGGTSVLIVVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           Q+Q +L+A QYEG+ +KS+ + +N 
Sbjct: 420 QVQSHLLAHQYEGLIEKSQLRGRNK 444


>gi|114767221|ref|ZP_01446086.1| preprotein translocase SecY [Pelagibaca bermudensis HTCC2601]
 gi|114540631|gb|EAU43702.1| preprotein translocase SecY [Roseovarius sp. HTCC2601]
          Length = 447

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/436 (52%), Positives = 314/436 (72%), Gaps = 2/436 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++A+  +A DL++RI+FT+  LIVYR GT+IP+P ID  +     +    GI G+ +
Sbjct: 3   ANTSWAALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGGALRDFMEQAGQGIGGMVS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+AA VP+LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLLAAMVPALEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           LL + QAYG+AV L+ G  +  ++ ++F  + +ITL+GGTMFL+WLGEQIT RG+GNG+S
Sbjct: 123 LLALFQAYGLAVSLEAGD-LAHEAGWYFRAAVVITLVGGTMFLMWLGEQITARGVGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GIVA +P++L      GR G++S  +++ +    +AVI  V+F ERA R++ IQY
Sbjct: 182 LIIFVGIVAEIPAALAQFFASGRSGAMSPAIIVGVIVMVIAVIMFVVFMERALRKITIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +M +   S+LP+K+N AGV+P+IFASSLLLLP TI  F    SS   +  ++ 
Sbjct: 242 PRRQVGMKMTEAQQSHLPVKVNPAGVIPAIFASSLLLLPTTIATFSQAGSSGPVMSTILA 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ ++  IVFFA+FYT  + F P + ADNLK   GFIPGIRPG RTA H++
Sbjct: 302 YFGPGQPLYLLFFAAMIVFFAYFYTFNVSFKPDDVADNLKNQNGFIPGIRPGKRTADHLE 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+ R+ VVG+ YL  VC+ PE L +   +P    GTS+LI+VSV +DTI QIQ +L+A 
Sbjct: 362 YVVNRILVVGSAYLAAVCLLPEILRSQYAIPFYFGGTSVLIVVSVTMDTIQQIQSHLLAH 421

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ +KS+ + K+ 
Sbjct: 422 QYEGLIQKSQLRGKSK 437


>gi|118595315|ref|ZP_01552662.1| protein translocase subunit SecY [Methylophilales bacterium
           HTCC2181]
 gi|118441093|gb|EAV47720.1| protein translocase subunit SecY [Methylophilales bacterium
           HTCC2181]
          Length = 440

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 221/428 (51%), Positives = 306/428 (71%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
            F +  +  +LKSR++F + AL+++R G +IP+P ID +   K F S+S GI G+FNMFS
Sbjct: 6   TFGALGKMGELKSRLLFLLGALVIFRLGAHIPVPGIDPMELKKLFDSQSGGILGMFNMFS 65

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R  VF+LGIMPYISASII+ L+ +    L+ LKKEG+ G++VI +YTR  TV+L 
Sbjct: 66  GGALSRFTVFALGIMPYISASIIMTLLTSMTTQLKELKKEGQAGQRVITKYTRQLTVVLA 125

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           + QA GI V L++  G+V D    F  + ++TL+ GTMFLVWLGEQIT RGIGNG+S+II
Sbjct: 126 LFQALGITVALESQPGLVLDPGLMFRLTAMVTLVSGTMFLVWLGEQITERGIGNGISMII 185

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
           F+GIVAGLPS+L + LEL R G+ S PL+  + ++ + V ALV+F ER QRR+ I Y KR
Sbjct: 186 FAGIVAGLPSALGNTLELTRTGAFSIPLVFFLLTAAILVTALVVFVERGQRRITINYAKR 245

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           QVGN+++    S+LPLK+N AGV+P+IFASS++L PATI G+   S S  W+  +  ++ 
Sbjct: 246 QVGNKLYGGQSSHLPLKINQAGVIPAIFASSVILFPATIAGWFGTSESLYWLKDIGAAIS 305

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
            G+  Y++L++  I+FFA+FYTAI FNP E ADNLKK G F+PGIRPG++TA +ID ++ 
Sbjct: 306 PGQPLYILLFAAAIIFFAYFYTAITFNPVETADNLKKGGAFVPGIRPGEQTAKYIDTIVG 365

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+T+VGA Y+  VC+ PE LI     P    GTSLLIIV V +D + Q+Q  +++ QYEG
Sbjct: 366 RLTLVGAIYVTLVCLMPEFLILKFNTPFYFGGTSLLIIVVVTMDFMTQVQSQMMSYQYEG 425

Query: 433 VFKKSRSK 440
           + KK+  K
Sbjct: 426 LLKKANFK 433


>gi|157826043|ref|YP_001493763.1| preprotein translocase subunit SecY [Rickettsia akari str.
           Hartford]
 gi|157800001|gb|ABV75255.1| preprotein translocase subunit SecY [Rickettsia akari str.
           Hartford]
          Length = 433

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRI+FTI+ LIV RFG++IP+P ID I+ S       +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIIFTILILIVCRFGSFIPIPGIDSIALSSVAAKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQISRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
            +QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SVQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G +S  + + +    V +IA++IFFE+AQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGVLSPLIAIAVCIGVVVLIAIIIFFEKAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNTAGV+P IFASS+LL PAT+  F   S+S + I+G+ 
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTAGVIPPIFASSILLFPATLANF---SNSNSEIMGMF 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ Q+Q YL +
Sbjct: 360 DYILTRLTVIGGIYLSVMCVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQVQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|149915865|ref|ZP_01904389.1| preprotein translocase, SecY subunit [Roseobacter sp. AzwK-3b]
 gi|149810188|gb|EDM70034.1| preprotein translocase, SecY subunit [Roseobacter sp. AzwK-3b]
          Length = 449

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/430 (53%), Positives = 317/430 (73%), Gaps = 3/430 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++++F +A DL+ RIVFT+  LIVYR GTYIP+P ID        +  +A I G+ +
Sbjct: 3   ANTSWSAFGKATDLRKRIVFTLGLLIVYRLGTYIPVPGIDGAELRNFMEGAAASIGGMLS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+AA VP+LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLLAAMVPALEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L  LQ+YG+AV L++G G+V+D   FF+ S +ITL+GGTMFL+WLGEQIT RG+GNG+S
Sbjct: 123 FLATLQSYGLAVSLQSG-GLVTDPGLFFIASCMITLVGGTMFLMWLGEQITARGVGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P++L      GR G+IS  +++ +    +AVIA V+F ER+ R++ IQY
Sbjct: 182 LIIFVGIIAEVPAALAQFFSQGRSGAISPAVIIGVIIMVIAVIAFVVFMERSLRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLPATI  F    +SP  +  ++ 
Sbjct: 242 PRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPATISTFSGNETSPI-MSTIMA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ ++V IVFF +FYT  + F P + ADNLK   GF+PG+RPG +TA +++
Sbjct: 301 YFGPGQPAYLLFFTVMIVFFTYFYTYNVSFKPDDVADNLKNQNGFVPGVRPGKKTAEYLE 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV++R+ V+G+GYL  VC+ PE L     +P    GTS+LI+VSV +DTI Q+Q +L+A 
Sbjct: 361 YVVSRILVLGSGYLAAVCLLPEILRGQFAIPFYFGGTSVLIVVSVTMDTIQQVQSHLLAH 420

Query: 429 QYEGVFKKSR 438
           QYEG+ +KS+
Sbjct: 421 QYEGLIEKSQ 430


>gi|239948299|ref|ZP_04700052.1| preprotein translocase, SecY subunit [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239922575|gb|EER22599.1| preprotein translocase, SecY subunit [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 433

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 320/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFTI+ LI  RFG++IP+P ID I+ S   +   +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTILILIECRFGSFIPIPGIDSIALSSVAEKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVAISLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFE+AQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFEKAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|83949768|ref|ZP_00958501.1| preprotein translocase SecY [Roseovarius nubinhibens ISM]
 gi|83837667|gb|EAP76963.1| preprotein translocase SecY [Roseovarius nubinhibens ISM]
          Length = 447

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/444 (50%), Positives = 317/444 (71%), Gaps = 11/444 (2%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++++F +A DL+ RI FT+  LI+YR GT++P+P ID     +  +  +A I G+ +
Sbjct: 3   ANTSWSAFGKATDLRKRIFFTLGLLIIYRLGTWVPVPGIDGAELREFMEGAAASIGGMLS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+ A VP+LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLMTAMVPALEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L  LQ+YG+AV L++G G+ SD   FF+ S +ITL+GGTMFL+W+GEQIT RGIGNG+S
Sbjct: 123 ALATLQSYGLAVSLQSG-GLASDPGMFFIASCMITLVGGTMFLMWIGEQITARGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A LP++L      GR G++S  +++ +    V  IA V+F ERA R++ IQY
Sbjct: 182 LIIFVGIIAELPAALAQFFASGRSGAMSPAVIVGVMLMVVVTIAFVVFMERALRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    +SP  +  ++ 
Sbjct: 242 PRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGNQTSPV-MSTILA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ +++ IVFFA+FYT  + F   + ADNLK   GF+PGIRPG +TA +++
Sbjct: 301 YFGPGQPLYLIFFALMIVFFAYFYTYNVAFKTDDVADNLKNQNGFVPGIRPGKKTAEYLE 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+TR+ V+G+ YL  VC+ PE L +   +P    GTS+LI+VSV +DTI Q+Q +L+A 
Sbjct: 361 YVVTRILVLGSAYLAAVCLLPEILRSQLAIPFYFGGTSVLIVVSVTMDTIQQVQSHLLAH 420

Query: 429 QYEGVFKKS--------RSKKKNS 444
           QYEG+ +KS        RS++K +
Sbjct: 421 QYEGLIEKSQLSGKGKRRSRRKGT 444


>gi|253998035|ref|YP_003050098.1| preprotein translocase subunit SecY [Methylovorus sp. SIP3-4]
 gi|313200101|ref|YP_004038759.1| preprotein translocase subunit SecY [Methylovorus sp. MP688]
 gi|253984714|gb|ACT49571.1| preprotein translocase, SecY subunit [Methylovorus sp. SIP3-4]
 gi|312439417|gb|ADQ83523.1| preprotein translocase, SecY subunit [Methylovorus sp. MP688]
          Length = 440

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 306/423 (72%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  +LKSR++F + AL+VYR G +IP+P ID    +K F+S+S GI G+FNMFSGGA+ 
Sbjct: 11  SKTSELKSRLLFVLGALVVYRLGAHIPVPGIDPDVLAKLFESQSGGILGMFNMFSGGALS 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R  VF+LGIMPYISASII+QL+    P +E LKKEGE GR+ I +YTRY TV L   QA 
Sbjct: 71  RFTVFALGIMPYISASIIMQLLTVVSPRMEQLKKEGEAGRRQITKYTRYGTVFLATFQAL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GIA+ L+   G+V D    F F+ +ITL+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIV
Sbjct: 131 GIAIALEGQAGLVLDPGLMFRFTAVITLVSGTMFLMWLGEQITERGIGNGISIIIFAGIV 190

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP ++   LEL R G+ S PL++ +F++ V V A V+F ER QR++ + Y KRQVG +
Sbjct: 191 AGLPHAIGGTLELARTGAFSIPLVIFLFAAAVLVTAFVVFVERGQRKITVNYAKRQVGRK 250

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           +F    S+LPLKLN AGV+P IFASS++L PAT+ G+   S + +W+  +  +L  G+  
Sbjct: 251 VFGGQTSHLPLKLNMAGVIPPIFASSIILFPATMAGWFGSSENFSWLKDIGTTLSPGQPL 310

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++ ++  IVFF FFYTA+VFNPKE ADNLKK G F+PGIRPGD+TA +ID ++ R+T+V
Sbjct: 311 YIIFFATAIVFFCFFYTALVFNPKETADNLKKSGAFVPGIRPGDQTAKYIDRIMGRLTLV 370

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q +L++ QYEG+ KK+
Sbjct: 371 GALYITAVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMTQVQAHLMSNQYEGLLKKA 430

Query: 438 RSK 440
             K
Sbjct: 431 NFK 433


>gi|91763179|ref|ZP_01265143.1| Preprotein translocase SECY subunit [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91717592|gb|EAS84243.1| Preprotein translocase SECY subunit [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 426

 Score =  456 bits (1172), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 306/427 (71%), Gaps = 2/427 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           +S S+  DLK+RI+FTI  L VYRFGT++P+P ID             G+ G+FN+FSGG
Sbjct: 2   SSSSQTNDLKNRIIFTIFILAVYRFGTFVPIPGIDPEQLQTMMSGNQKGLLGMFNVFSGG 61

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           AV RMA+F+LGIMPYIS+SIIVQL+       +NLK +GE GR  I Q TRY TV+L  +
Sbjct: 62  AVSRMAIFALGIMPYISSSIIVQLLTGVSDYFKNLKAQGETGRAKITQITRYGTVILATI 121

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q YG+++GL++   +V +   FF  + + T++ GTMFL+WLGEQIT RGIGNG+SLIIF+
Sbjct: 122 QGYGLSIGLQSSADLVINPGLFFTITAVSTIVAGTMFLMWLGEQITQRGIGNGISLIIFA 181

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVA +P +LV+  ELGR G++ST +++ IF   VA I  ++F ERA R++LI YPKRQ+
Sbjct: 182 GIVAEIPRALVTTFELGRTGAVSTIMIIGIFVLLVATIMFIVFMERALRKILINYPKRQM 241

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GN+M+  + S+LPLK+N AGV+P+IFAS+LLLLP T   F   S + T++  L      G
Sbjct: 242 GNKMYGGESSHLPLKINQAGVIPAIFASALLLLPVTFSNF-SFSDNDTFL-NLSSYFTQG 299

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  YM+LY+  I+FF FFYT+I FNP E ADNL+K+GGF+PGIRPG+ TAL+I+ ++T++
Sbjct: 300 QPLYMLLYASGIIFFTFFYTSITFNPTETADNLRKYGGFVPGIRPGENTALYIEKIVTKL 359

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T +GA YL  VC+ PE LIA   +P  L GTS+LI+V V +DT+ QIQ  L++ QYE + 
Sbjct: 360 TTIGALYLTIVCLMPEFLIANYPIPFYLGGTSILIVVVVAIDTVTQIQTRLMSSQYEQLI 419

Query: 435 KKSRSKK 441
           KK++  K
Sbjct: 420 KKTKFGK 426


>gi|307294994|ref|ZP_07574836.1| preprotein translocase, SecY subunit [Sphingobium chlorophenolicum
           L-1]
 gi|306879468|gb|EFN10686.1| preprotein translocase, SecY subunit [Sphingobium chlorophenolicum
           L-1]
          Length = 454

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 239/452 (52%), Positives = 318/452 (70%), Gaps = 10/452 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +Q  SNL+ A FS+A DLK R+ FT+ ALIV+RF +++PLP +D  + S+ ++  
Sbjct: 1   MASRADQLASNLSLAKFSQATDLKKRLWFTLGALIVFRFLSFVPLPGVDPTALSQLYKQT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI  +FN FSGG++ RM++ +LG+MPYI+ASI+VQL A+  P L  +KKEGE GRK +
Sbjct: 61  NGGILDIFNTFSGGSLSRMSLIALGVMPYITASIVVQLAASLSPQLAAIKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGL-----KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV L  +Q Y IAVGL     ++G   V D  Y F  + +I+L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVGLTAVQGYFIAVGLESFGAQSGVQAVVDPGYLFRVAAVISLIGGTMFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA LP +L ++ +    G+IS  ++ L+      +IA +
Sbjct: 181 GEQITSRGIGNGVSLIIMAGIVAQLPVTLSNLFKSSSTGAISGLVIFLVIVLGFGLIAFI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
            F ERAQRR+LIQYPKRQ    + Q D S+LPLK+NTAGV+P IFASSLLL+P T+  F 
Sbjct: 241 CFMERAQRRVLIQYPKRQTRQGLMQADRSHLPLKVNTAGVIPPIFASSLLLMPLTVSQFA 300

Query: 296 D-----VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
                  S    +++ L   L HG   YM LY + IVFF FFYTA+VFNP+E ADNLK++
Sbjct: 301 GQTVAGESRLGDFVLTLNQYLSHGSPVYMALYGLGIVFFCFFYTAVVFNPEETADNLKRN 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG  T  ++DYVLTR+TV+GA YL  +C+ PE +IA  G+P  L GTSLLI+
Sbjct: 361 GGFIPGIRPGKNTENYLDYVLTRITVIGAAYLAFICLVPEFVIARAGIPFYLGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           V+V +DT+ QIQ +L+A QY  + KK++ K +
Sbjct: 421 VNVTVDTVTQIQSHLLAHQYGDLIKKAKLKGR 452


>gi|254455795|ref|ZP_05069224.1| preprotein translocase, SecY subunit [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082797|gb|EDZ60223.1| preprotein translocase, SecY subunit [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 426

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 225/427 (52%), Positives = 305/427 (71%), Gaps = 2/427 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           +S S   DL++RI+FTI  L VYRFGT++PLP ID        +    G+ G+FN+F+GG
Sbjct: 2   SSSSSTNDLRNRILFTIFILAVYRFGTFVPLPGIDPEQLKIMMEGNQKGLLGMFNVFAGG 61

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           AV RMA+F+LGIMPYIS++IIVQL+       +NLK +GE GR  I Q TRY TVLL  L
Sbjct: 62  AVSRMAIFALGIMPYISSAIIVQLMTGVSEYFKNLKAQGETGRAKITQITRYGTVLLATL 121

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q YG++VGL++   +V +   FF  +T+ T++ GTMFL+WLGEQIT RGIGNG+SLIIF+
Sbjct: 122 QGYGLSVGLESSADLVINPGVFFKLTTVTTIVAGTMFLMWLGEQITQRGIGNGISLIIFA 181

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVA +P +LV+  ELGR G++ST ++L IF   +  I  V+F ERA R++LI YPKRQ+
Sbjct: 182 GIVAEIPRALVTTFELGRTGAVSTFMILAIFVLLILTILFVVFMERALRKILINYPKRQM 241

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GN+M+  + S+LPLK+N AGV+P+IFAS+LLLLP T   F   S++ T++  L      G
Sbjct: 242 GNKMYGGESSHLPLKINQAGVIPAIFASALLLLPVTFSNF-SFSNNETFL-NLSSYFTQG 299

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  YM+LY+  I+FF FFYT I FNP E ADNL+K+GGF+PGIRPG+ TAL+I+ +LT++
Sbjct: 300 QPLYMLLYASGIIFFTFFYTNITFNPTETADNLRKYGGFVPGIRPGESTALYIENILTKL 359

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T +GA YL  VC+ PE LIA   +P  L G S+LI+V V +DT+ QIQ  L++ QYE + 
Sbjct: 360 TTIGALYLTLVCLLPEFLIANYPIPFYLGGASILIVVVVAIDTVTQIQTRLMSSQYEQLI 419

Query: 435 KKSRSKK 441
           KK++  K
Sbjct: 420 KKTKFGK 426


>gi|302877821|ref|YP_003846385.1| preprotein translocase, SecY subunit [Gallionella capsiferriformans
           ES-2]
 gi|302580610|gb|ADL54621.1| preprotein translocase, SecY subunit [Gallionella capsiferriformans
           ES-2]
          Length = 438

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 221/426 (51%), Positives = 303/426 (71%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           A  ++  DL +R+ F + AL+V+R G +IP+P ID +  +  F+++  GI G+FNMFSGG
Sbjct: 8   APKAKYGDLSTRLWFLLGALVVFRIGAHIPVPGIDPVVLADLFKTQKNGILGMFNMFSGG 67

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ R  +F+LGIMPYISASII+QL +  VP LE LKKEGE GR+ I QYTRY T+ L + 
Sbjct: 68  ALSRFTIFALGIMPYISASIIMQLASIAVPYLEQLKKEGESGRRKITQYTRYGTLGLAVF 127

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q++GI+V L+   G+V      F  +T+ITL+ GTMFL+WLGEQIT RG+GNG+SLIIF+
Sbjct: 128 QSFGISVALQAQPGLVLHPGSMFQMTTMITLVTGTMFLMWLGEQITERGLGNGISLIIFA 187

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GI AGLPS++ S LEL R G+ S PL+L +F   +AV ALV+F ER QR++L+ Y KRQV
Sbjct: 188 GIAAGLPSAIGSTLELARTGAFSIPLVLFLFVGAIAVTALVVFVERGQRKILVNYAKRQV 247

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GNR++    S+LPLKLN AGV+P IFASS++L PATI G+   S    W+      L  G
Sbjct: 248 GNRVYGGQSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFGNSQGMGWLKDASQMLSPG 307

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y++ Y+  I+FF FFYTA+VF+PKE ADNLKK G F+PGIRPG++TA +++ ++ R+
Sbjct: 308 QPIYVLAYASAILFFCFFYTALVFSPKETADNLKKSGAFLPGIRPGEQTAKYVEKIMLRL 367

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T++GA Y+  VC+ PE L+    VP    GTSLLI+V V +D + Q+Q YL+  QY+ + 
Sbjct: 368 TLIGAVYITLVCLLPEFLVVKFNVPFYFGGTSLLILVVVTMDFMAQVQSYLMTHQYDSLL 427

Query: 435 KKSRSK 440
           KK+  K
Sbjct: 428 KKANFK 433


>gi|89053103|ref|YP_508554.1| preprotein translocase subunit SecY [Jannaschia sp. CCS1]
 gi|88862652|gb|ABD53529.1| protein translocase subunit secY/sec61 alpha [Jannaschia sp. CCS1]
          Length = 456

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 230/445 (51%), Positives = 321/445 (72%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M+SA EQ  +N+++++F +A +L+ RI FT+  LI+YR GTYIP+P ID +     F S 
Sbjct: 1   MSSAAEQMAANMSWSAFGKATELRQRIWFTLGLLIIYRIGTYIPVPGIDAVELRAFFDSA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           +AG+ G+ NMF+GGA+ RM VF+LGIMPYISASIIVQL++A VP++E LKKEGE GRK +
Sbjct: 61  AAGLGGVLNMFTGGALSRMGVFALGIMPYISASIIVQLMSAMVPAMEALKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QAYG+AV +++G G+ SD  +FF  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVALATAQAYGLAVSMESG-GLASDPGWFFRAACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P++L    E GR G++STP +L +    +A +  V+F ER
Sbjct: 180 NRGIGNGISLIIFVGIIAEIPAALAQFFETGRSGALSTPAILGVILMLIATLFFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           + R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP T+  F     S
Sbjct: 240 SLRKIHIQYPRRQVGMKVYDGGSSHLPIKVNPAGVIPAIFASSLLLLPTTLTTFGGTEGS 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  ++ + G G+  Y+V ++  IVFF +FYT  + F  ++ ADNLK   GFIPGIRP
Sbjct: 300 GPVLGWILANFGPGQPLYLVFFASMIVFFTYFYTLNVSFKTEDVADNLKNQNGFIPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G RTA +++YV+ R+ V+GAGYL  VC+ PE +     +     GTS+LIIVSV +DT+ 
Sbjct: 360 GARTAEYLEYVVRRILVLGAGYLALVCMMPEIVRTNLSITAYFGGTSILIIVSVGMDTVQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           QIQ +L+A QYEG+ +KS+ + + S
Sbjct: 420 QIQSHLLAHQYEGLLEKSQLRGRKS 444


>gi|260432468|ref|ZP_05786439.1| preprotein translocase, SecY subunit [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416296|gb|EEX09555.1| preprotein translocase, SecY subunit [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 454

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/439 (51%), Positives = 319/439 (72%), Gaps = 2/439 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++A+  +A DL++RI+FT+  LIVYR GT+IP+P ID  +  +  +  
Sbjct: 1   MVSAAEQMAANTSWAALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGQALREFMEQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTR+ TV L  +QAYG+AV L++G  + +D   +F  ST+ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRFGTVALATVQAYGLAVSLESGD-LATDPGLYFRLSTMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P++L   L  GR G+IS  +++ +    +AVI  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEVPAALAQFLASGRSGAISPAVIVGVIVMVIAVITFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+R VG ++++   S+LP+K+N AGV+P+IFASSLLLLP TI  F   +++
Sbjct: 240 ALRKIHIQYPRRNVGMKVYEGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSSGAAN 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ ++  IVFFA+FYT  + F P + ADNLKK  GF+PGIRP
Sbjct: 300 GPIMSWLLANFGPGQPLYLLFFASMIVFFAYFYTFNVSFKPDDVADNLKKQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +++YV+ R+ V+G+ YL  VC+ PE L     +P    GTS+LIIVSV +DTI 
Sbjct: 360 GKKTAEYLEYVVNRILVLGSAYLAAVCLLPEILRGQFAIPFYFGGTSVLIIVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSR 438
           Q+Q +L+A QYEG+ +KS+
Sbjct: 420 QVQSHLLAHQYEGLIEKSQ 438


>gi|71905981|ref|YP_283568.1| preprotein translocase subunit SecY [Dechloromonas aromatica RCB]
 gi|71845602|gb|AAZ45098.1| protein translocase subunit secY/sec61 alpha [Dechloromonas
           aromatica RCB]
          Length = 440

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/419 (52%), Positives = 298/419 (71%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R+ F + AL+VYR G +IP+P ID  + +  F S+  GI G+FNMFSGGA+ R  +
Sbjct: 16  DLKRRLWFLLGALVVYRIGAHIPVPGIDPNALADLFNSQKGGILGMFNMFSGGALSRFTI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL++   P LE LKKEGE GR+ I QYTRY TV+L + Q  GIAV
Sbjct: 76  FALGIMPYISASIIMQLMSVASPQLEALKKEGEAGRRKITQYTRYGTVILALFQGLGIAV 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V+D  + F  +T+ TLL GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLP
Sbjct: 136 ALEAQAGLVNDPGFMFRLTTVSTLLTGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  +LEL R G++     L+I    VAV   V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 196 NAIGGLLELVRTGAMHPLTALIICILVVAVTGFVVFVERGQRKILVNYAKRQVGNKIYGG 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN +GV+P IFASS++L PAT+  +   S S  W+  +  +L  G+  Y++L
Sbjct: 256 QSSHLPLKLNMSGVIPPIFASSIILFPATVANWFGSSESMHWLKDVAGTLSPGQPIYVML 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+  IVFF FFYTA+VFN KE ADNLKK G F+PGIRPG++TA +ID +L R+T++GA Y
Sbjct: 316 YASAIVFFCFFYTALVFNSKETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLIGAAY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q Y+++ QYE + KK+  K
Sbjct: 376 ITVVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMSQVQAYVMSHQYESLLKKANFK 434


>gi|126736626|ref|ZP_01752366.1| preprotein translocase SecY [Roseobacter sp. CCS2]
 gi|126713939|gb|EBA10810.1| preprotein translocase SecY [Roseobacter sp. CCS2]
          Length = 452

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/445 (49%), Positives = 322/445 (72%), Gaps = 3/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N+++++F +A +L+ RI+FT+  LI+YR GT+IP+P ID ++ S+  +  
Sbjct: 1   MASAAEQMAANVSWSAFGKATELRQRIMFTLGLLIIYRLGTFIPVPGIDGLALSQFMEDA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            AGI G+ +MF+GGA+ RMA+F+LGIMPYISASI++QL+ +    L+NLKKEGEQGR+ +
Sbjct: 61  QAGIGGILSMFTGGALSRMAIFTLGIMPYISASIVMQLLGSMWEPLKNLKKEGEQGRRKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QAYG+AV L+ G G+ ++   FF  ST+IT++GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATAQAYGLAVSLEAG-GLAANPGAFFQASTVITIVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++   L  GR G+ISTP+++ I    + V+  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEIPAAMAQFLSQGRSGAISTPVVVGIIIMLIVVLTFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           + R++ IQYP++Q G +++    S+LP+K+N AGV+P+IFAS+LLLLP TI  F   SS 
Sbjct: 240 SLRKIHIQYPRQQRGMKVYDGSTSHLPIKVNPAGVIPAIFASALLLLPTTISTFNGGSSG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ +   I+FF +FYT  + F  ++ A+NLK   GF+PGIRP
Sbjct: 300 P-LMSTILALFGPGQPLYLLFFGGMIIFFTYFYTREVAFKTEDVAENLKNQNGFVPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +T  ++DYV+TR+ V+G+GYL  V + PE + A   +P    GTS+LIIVSV +DTI 
Sbjct: 359 GKKTEEYLDYVVTRILVLGSGYLALVALLPEIIRAELAIPFYFGGTSILIIVSVGMDTIQ 418

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           QIQ +L+A QYEG+ +KS+ + K +
Sbjct: 419 QIQSHLVAHQYEGLIEKSQLRGKRN 443


>gi|146278548|ref|YP_001168707.1| preprotein translocase subunit SecY [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556789|gb|ABP71402.1| protein translocase subunit secY/sec61 alpha [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 452

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 236/446 (52%), Positives = 319/446 (71%), Gaps = 5/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NL++ +  +A DL+ RI FTI  L+VYR GTYIP+P ID  +  +   + 
Sbjct: 1   MASAAEQMAANLSWGALGKATDLRQRIFFTIGLLMVYRLGTYIPVPGIDGSALREFMDTA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           +AGI G+ NMF+GGA+ RM +F+LGIMPYISASIIVQL+A+ VP LE LKKEGEQGRK I
Sbjct: 61  TAGIGGMLNMFTGGAISRMGIFALGIMPYISASIIVQLMASMVPKLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QA+GIA+ L+ G  +V+D   FF  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATFQAWGIAMSLEAGD-LVTDPGMFFRAACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GIVA +P++L      GR G+IS  +++ +    VAVIA V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIVAEIPAALAQFFSQGRSGAISPAVIVGVIVMVVAVIAFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F    + 
Sbjct: 240 ALRKIHIQYPRRQVGMKIYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGAQTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA-IVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  I+FFA+FYTA + F   + A+NLK   GFIPGIRP
Sbjct: 300 PV-MSTILAYFGPGQPLYLLFFAGMIIFFAYFYTANVAFKVDDVAENLKNQNGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +T  +++YV+ RV V+G+ YL  VC+ PE L    G+P    GTS+LI+VSV +DTI 
Sbjct: 359 GKKTEEYLEYVVNRVLVLGSAYLAAVCLLPEVLRDQFGIPFYFGGTSVLIVVSVTMDTIN 418

Query: 420 QIQGYLIAQQYEGVFKKS--RSKKKN 443
           Q+Q +L+A QYEG+ ++S  R +K+N
Sbjct: 419 QVQSHLLAHQYEGLIERSQLRGRKRN 444


>gi|157964786|ref|YP_001499610.1| preprotein translocase subunit SecY [Rickettsia massiliae MTU5]
 gi|157844562|gb|ABV85063.1| Preprotein translocase secY subunit [Rickettsia massiliae MTU5]
          Length = 433

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/434 (52%), Positives = 319/434 (73%), Gaps = 9/434 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S   DL SRIVFTI+ LIV RFG++IP+P ID I+ S       +GI G+FNM S
Sbjct: 4   NFSKKS-GNDLVSRIVFTILILIVCRFGSFIPIPGIDSIALSSVAAKNQSGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ +NQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGEVGKRKVNQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVALSLESIVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+P +++S+ EL R G++S  + + +    V +IA++IFFE+AQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPGAIISMFELSRKGALSPLIAIAVCIGVVVLIAIIIFFEKAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL PAT+  F   S+S +  +G++
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPATLANF---SNSNSETMGML 299

Query: 309 D-SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
              LGHG+  Y++LY   I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + 
Sbjct: 300 TYYLGHGKPVYILLYVALIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYF 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           DY+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL +
Sbjct: 360 DYILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFS 419

Query: 428 QQYEGVFKKSRSKK 441
            +YEG+ KK + K 
Sbjct: 420 SKYEGLMKKVKLKN 433


>gi|103488275|ref|YP_617836.1| preprotein translocase subunit SecY [Sphingopyxis alaskensis
           RB2256]
 gi|98978352|gb|ABF54503.1| protein translocase subunit secY/sec61 alpha [Sphingopyxis
           alaskensis RB2256]
          Length = 457

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 238/451 (52%), Positives = 318/451 (70%), Gaps = 11/451 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAF-QS 59
           MAS  +Q  SNLNF+ F +A +LK+RI FTI ALIV+RF +++PLP +D ++ +  + Q+
Sbjct: 1   MASRADQLASNLNFSKFGQATELKNRIWFTIGALIVFRFLSFVPLPGVDPVALANLYSQA 60

Query: 60  KSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKV 119
            S G+  +FN FSGG++ERM++ +LG+MPYI+ASI+VQL AA  PSL  LKKEGE GRK 
Sbjct: 61  ASGGVLDIFNTFSGGSLERMSIIALGVMPYITASIVVQLAAALSPSLAALKKEGESGRKK 120

Query: 120 INQYTRYATVLLGILQAYGIAVGLKN---GQGI--VSDSDYFFVFSTIITLLGGTMFLVW 174
           +NQYTRY TV+L  +Q Y IAVGL+     QGI  V D    F    +I+++GGT+FL+W
Sbjct: 121 LNQYTRYGTVVLTAVQGYFIAVGLETLGASQGIAAVVDPGMMFRIGAVISIVGGTLFLMW 180

Query: 175 LGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIAL 234
           LGEQIT RGIGNGVSLII +GI+A LP S   +    R GS+    ++ +    +A+IA 
Sbjct: 181 LGEQITSRGIGNGVSLIIMAGILAQLPRSFAQMFTQVREGSMGGGTVVAVIVGGIAIIAF 240

Query: 235 VIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGF 294
           + F ERAQRR+L+QYPKR     + Q D S+LPLK+NTAGV+P IFASSLLL+P T+   
Sbjct: 241 ISFMERAQRRVLVQYPKRATQRGVMQADRSHLPLKVNTAGVIPPIFASSLLLMPLTVTQM 300

Query: 295 I--DVSSSPTW---IVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKK 349
           +  +V     W   ++ L   L HG+  YM LY+  I+FF FFY A+VFNP+E A+NLKK
Sbjct: 301 MGNNVQGDTAWGDFLITLNQYLAHGQPLYMALYAAGIIFFCFFYVAVVFNPEETAENLKK 360

Query: 350 HGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLI 409
             GFIPGIRPG  TA ++D+VLTR+TV+GA YL  +C+ PE  IA +G+P  L GTSLLI
Sbjct: 361 QNGFIPGIRPGKNTATYLDFVLTRITVIGAAYLAVICLVPEYFIAQSGLPFYLGGTSLLI 420

Query: 410 IVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           IV+V +DTI QIQ +++A QY  + KK++ K
Sbjct: 421 IVNVTIDTISQIQSHMLAHQYGDLIKKAKLK 451


>gi|294010633|ref|YP_003544093.1| preprotein translocase SecY subunit [Sphingobium japonicum UT26S]
 gi|292673963|dbj|BAI95481.1| preprotein translocase SecY subunit [Sphingobium japonicum UT26S]
          Length = 454

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 238/452 (52%), Positives = 316/452 (69%), Gaps = 10/452 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +Q  SNL+ A FS+A DLK R+ FT+ ALIV+RF +++PLP +D  + S+ +   
Sbjct: 1   MASRADQLASNLSLAKFSQATDLKKRLWFTLGALIVFRFLSFVPLPGVDPTALSQLYAQT 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           + GI  +FN FSGG++ RM++ +LG+MPYI+ASI+VQL A+  P L  +KKEGE GRK +
Sbjct: 61  NGGILDIFNTFSGGSLSRMSLIALGVMPYITASIVVQLAASLSPQLAAIKKEGESGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGL-----KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWL 175
           NQYTRY TV L  +Q Y IAVGL     ++G   V D  Y F  + +++L+GGTMFL+WL
Sbjct: 121 NQYTRYGTVGLTAVQGYFIAVGLESFGAQSGVQAVVDPGYLFRVAAVVSLIGGTMFLMWL 180

Query: 176 GEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALV 235
           GEQIT RGIGNGVSLII +GIVA LP +L ++ +    G+IS  ++ L+      +IA +
Sbjct: 181 GEQITSRGIGNGVSLIIMAGIVAQLPVTLSNLFKSSSTGAISGLVIFLVIVLGFGLIAFI 240

Query: 236 IFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI 295
            F ERAQRR+LIQYPKRQ    + Q D S+LPLK+NTAGV+P IFASSLLL+P T+  F 
Sbjct: 241 CFMERAQRRVLIQYPKRQTRQGLMQADRSHLPLKVNTAGVIPPIFASSLLLMPLTVSQFA 300

Query: 296 D-----VSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKH 350
                  S    +++ L   L HG   YM LY + IVFF FFYTA+VFNP+E ADNLK++
Sbjct: 301 GQTVAGESRLGDFVLTLNQYLSHGSPVYMALYGLGIVFFCFFYTAVVFNPEETADNLKRN 360

Query: 351 GGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLII 410
           GGFIPGIRPG  T  ++DYVLTR+TV+GA YL  +C+ PE  IA  G+P  L GTSLLI+
Sbjct: 361 GGFIPGIRPGKNTENYLDYVLTRITVIGAAYLAFICLVPEFAIARAGIPFYLGGTSLLIV 420

Query: 411 VSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
           V+V +DT+ QIQ +L+A QY  + KK++ K +
Sbjct: 421 VNVTVDTVTQIQSHLLAHQYGDLIKKAKLKGR 452


>gi|126728204|ref|ZP_01744020.1| protein translocase subunit SecY [Sagittula stellata E-37]
 gi|126711169|gb|EBA10219.1| protein translocase subunit SecY [Sagittula stellata E-37]
          Length = 448

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/436 (51%), Positives = 311/436 (71%), Gaps = 2/436 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++A+  +A DL++RI FT+  LIVYR GT+IP+P ID  +     +  S G+ G+ +
Sbjct: 3   ANTSWAALGKATDLRNRIFFTLGLLIVYRLGTFIPVPGIDGAALRDFVEQASTGVAGIVS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASI+VQL+ A VP+LE LKKEGEQGRK INQYTRYATV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIMVQLLTAMVPTLEQLKKEGEQGRKKINQYTRYATV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L  +QAYG+AV L+ G  +V+D  ++F  + +ITL+GGTMFL+WLGEQIT RG+GNG+S
Sbjct: 123 ALATMQAYGLAVSLEGGD-LVTDPGWYFRAACVITLVGGTMFLMWLGEQITARGVGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GIVA LP++L      GR G+IS  +++ +  +  A+IA V+F ERA R++ IQY
Sbjct: 182 LIIFVGIVAELPAALAQFFASGRSGAISPAVIVGVIIAVAALIAFVVFMERALRKITIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +M +   S+LP+K+N AGV+P+IFASSLLLLP TI  F    S+   +  ++ 
Sbjct: 242 PRRQVGMKMTEAQSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSGSDSAGPVMSTILA 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ +   IVFFA+FYT  + F P + ADNLK   GF+PGIRPG +TA +++
Sbjct: 302 YFGPGQPLYLLFFGAMIVFFAYFYTFNVSFKPDDVADNLKNQNGFVPGIRPGKKTAEYLE 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+ RV VVG+ YL  V + PE L     +P    GTS+LI+VSV +DTI Q+Q +L+A 
Sbjct: 362 YVVNRVLVVGSLYLAGVALMPEILRTQLAIPFYFGGTSVLIVVSVTMDTIQQVQSHLLAH 421

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ +KS+ + K  
Sbjct: 422 QYEGLIQKSQLRGKGK 437


>gi|254509568|ref|ZP_05121635.1| preprotein translocase, SecY subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221533279|gb|EEE36267.1| preprotein translocase, SecY subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 454

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/439 (51%), Positives = 318/439 (72%), Gaps = 2/439 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID  +  +  +  
Sbjct: 1   MVSAAEQMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGAALREFMEQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTR+ TV L  +QAYG+AV L++G  + +D   +F  ST+ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRFGTVALATVQAYGLAVSLESGD-LATDPGLYFRMSTMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P++L      GR G+IS  +++ +    +AVI  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEVPAALAQFFASGRSGAISPAVIVGVIVMVIAVITFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQ G ++++   S+LP+K+N AGV+P+IFASSLLLLP TI  F   +++
Sbjct: 240 ALRKIHIQYPRRQAGMKVYEGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSSGATN 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ ++  IVFFA+FYT  + F P + ADNLKK  GF+PGIRP
Sbjct: 300 GPVMSWLLANFGPGQPLYLLFFASMIVFFAYFYTFNVSFKPDDVADNLKKQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +T+ +++YV+ RV V+G+ YL  VC+ PE L     +P    GTS+LIIVSV +DTI 
Sbjct: 360 GKKTSEYLEYVVNRVLVLGSAYLAAVCLLPEILRGQFAIPFYFGGTSVLIIVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSR 438
           Q+Q +L+A QYEG+ +KS+
Sbjct: 420 QVQSHLLAHQYEGLIEKSQ 438


>gi|149926586|ref|ZP_01914846.1| protein translocase subunit SecY [Limnobacter sp. MED105]
 gi|149824515|gb|EDM83731.1| protein translocase subunit SecY [Limnobacter sp. MED105]
          Length = 435

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/430 (52%), Positives = 305/430 (70%), Gaps = 6/430 (1%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           AS ++  DL+ R+VF ++ALIVYR G +IP+P ID     + F S+  GI G+FNMFSGG
Sbjct: 2   ASSNKFTDLRKRLVFLLLALIVYRIGAHIPVPGIDPTQLKQLFDSQQGGILGMFNMFSGG 61

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ R  VF+LGIMPYISASI++QL +  VP LE LKKEGE GR+ I QYTRY T  L   
Sbjct: 62  ALSRFTVFALGIMPYISASIVMQLASVVVPQLEALKKEGEAGRRKITQYTRYGTFFLATF 121

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           QA GI++ L++  G+V D    F F+T ++L+ GTMFL+WLGEQIT RG+GNG+S++IF+
Sbjct: 122 QAIGISIALESQAGLVIDPGMAFRFTTAVSLVTGTMFLMWLGEQITERGLGNGISILIFA 181

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GI AGLP ++  + EL R G++++ + L+I    VAV  LV+F ER QR++ + Y KRQV
Sbjct: 182 GIAAGLPGAIGGLFELVRTGAMNSLVALMIVVLAVAVTYLVVFVERGQRKITVNYAKRQV 241

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV----DS 310
           GN+++Q   S+LPLKLN AGV+P IFASS++LLPAT+  +    S    +VG +     +
Sbjct: 242 GNKIYQGQTSHLPLKLNMAGVIPPIFASSIILLPATLTSWF--GSGDGAVVGFLKEVSQT 299

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G   YM+LY+  IVFF FFYTA+VFN +E ADNLKK G F+PGIRPG++T+ +ID V
Sbjct: 300 LSPGHPLYMLLYAAAIVFFCFFYTALVFNSRETADNLKKSGAFLPGIRPGEQTSRYIDKV 359

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LTR+T++GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQY
Sbjct: 360 LTRLTLIGAAYITLVCLLPEFLVLGLSVPFYFGGTSLLIIVVVAMDFMAQVQAYVMSQQY 419

Query: 431 EGVFKKSRSK 440
           + + KKS  K
Sbjct: 420 DSLLKKSSFK 429


>gi|319942193|ref|ZP_08016509.1| preprotein translocase subunit secY [Sutterella wadsworthensis
           3_1_45B]
 gi|319804246|gb|EFW01138.1| preprotein translocase subunit secY [Sutterella wadsworthensis
           3_1_45B]
          Length = 441

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 221/423 (52%), Positives = 298/423 (70%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           +  S+  DLK R++F  +AL+VYR G ++P+P ID    ++ F  +  GI GLFNMFSGG
Sbjct: 11  SGLSKYGDLKGRLIFLALALVVYRIGAHVPVPGIDPDMLNQLFNQQQGGILGLFNMFSGG 70

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ R +VF+LGIMPYISASII Q+++  +PSLE ++KEGEQGR+ I QYTRY T+ LG+ 
Sbjct: 71  ALSRFSVFALGIMPYISASIIFQMLSYVLPSLEAIRKEGEQGRRKITQYTRYGTLALGLF 130

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q +GIAV L+   G+V D  + F  +T ++LL GTMFL+WLGEQIT RG+GNG+S+IIF+
Sbjct: 131 QGFGIAVALETQPGLVIDPGFLFRITTTVSLLTGTMFLMWLGEQITERGLGNGISIIIFA 190

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVAGLP+    + +L   G+IS    + +    + V A  +F ER QRR+ + Y KRQV
Sbjct: 191 GIVAGLPNGASGLFQLVSTGAISPLAAIFVIVIVLGVTAFCVFVERGQRRITVNYAKRQV 250

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GNR++    SYLPLK+N +GV+P IFASSL+L PAT+ G+     S  WI  L  +L  G
Sbjct: 251 GNRIYGGQSSYLPLKMNMSGVIPPIFASSLILFPATLAGWFTSGDSTRWIRDLAAALSPG 310

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y +LY+  IVFFA+FYTA+VFNPKE A+NLKK G FIPGIRPG++TA +ID VL R+
Sbjct: 311 QPLYTLLYAALIVFFAYFYTALVFNPKETAENLKKSGAFIPGIRPGEQTARYIDRVLLRL 370

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T+ GA YLV VC+ PE L     VP    GTSLLI+V V +D + Q+Q Y+++ QYE + 
Sbjct: 371 TLGGAIYLVFVCLVPEFLNLRFNVPFYFGGTSLLIVVVVTMDFMSQVQAYMMSHQYENLL 430

Query: 435 KKS 437
           +K+
Sbjct: 431 RKT 433


>gi|262277113|ref|ZP_06054906.1| preprotein translocase, SecY subunit [alpha proteobacterium
           HIMB114]
 gi|262224216|gb|EEY74675.1| preprotein translocase, SecY subunit [alpha proteobacterium
           HIMB114]
          Length = 438

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 240/427 (56%), Positives = 320/427 (74%), Gaps = 1/427 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
            +FS+A DLK RI++T++ LI+YRFGTY+PLP ID  S  +        + G+FN+F+GG
Sbjct: 13  GAFSKADDLKKRILYTLLILIIYRFGTYVPLPGIDPTSLKEIVGGNQRSLLGMFNVFAGG 72

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           AV+RMA+F+LGIMPYISASII+QL+       +NLK +GE GR+ I QYTRY TV+L ++
Sbjct: 73  AVQRMAIFALGIMPYISASIIIQLLTGVTEYFKNLKAQGEVGRQKITQYTRYGTVILALI 132

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q YG+A+ L+N QGIV D   +F F T +TLL GT+FL+WLGEQIT RGIGNG+SLIIFS
Sbjct: 133 QGYGVAISLENSQGIVQDPGLYFRFVTTVTLLTGTVFLMWLGEQITARGIGNGISLIIFS 192

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVA +P +L S  ELGR G+IS+ +++LI    +  I  ++F ERAQRR+LIQYPKRQ 
Sbjct: 193 GIVAEIPGALASTFELGRTGAISSGIIILILLLLLIAIYFIVFVERAQRRVLIQYPKRQQ 252

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GN+M+  + SYLPLK+NTAGV+P+IFAS+LLLLP T+      SS  + ++ +   LG G
Sbjct: 253 GNKMYGGESSYLPLKVNTAGVIPAIFASALLLLPITLS-NFSSSSENSILISITSMLGQG 311

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  YM+ ++  IVFF+FFYT+IVFNP E ADNLKK+GGF+PGIRPG+RTAL I+ +LT++
Sbjct: 312 KPLYMIFFAAGIVFFSFFYTSIVFNPTETADNLKKYGGFVPGIRPGERTALFIENLLTKL 371

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           TV+G+ YLV +C+ PE LIA   VP  L GTSLLI+V V +DTI QIQ  L++ QYE + 
Sbjct: 372 TVIGSAYLVIICLLPEVLIANYPVPFYLGGTSLLIVVVVGMDTITQIQTRLMSVQYESLI 431

Query: 435 KKSRSKK 441
           KK++  +
Sbjct: 432 KKTKFNR 438


>gi|332187819|ref|ZP_08389553.1| preprotein translocase, SecY subunit [Sphingomonas sp. S17]
 gi|332012169|gb|EGI54240.1| preprotein translocase, SecY subunit [Sphingomonas sp. S17]
          Length = 447

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 310/441 (70%), Gaps = 11/441 (2%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
            +++ A F++A DLK R+ FTI ALIV+R  +Y+PLP +D  +     Q  + G+   FN
Sbjct: 3   QSISLAKFAKATDLKKRLWFTIGALIVFRLLSYVPLPGVDPTALGLLSQKTTGGVLDFFN 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
            FSGG++ RM++ +LG+MPYI+ASI+VQL  +  P L  +KKEGE GRK +NQYTRY TV
Sbjct: 63  TFSGGSLSRMSLIALGVMPYITASIVVQLATSLSPQLAAIKKEGESGRKKLNQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKN---GQGI--VSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGI 184
           LL  +Q Y IAVGL+     QGI  V +    F  + +I+L+GGTMFL+WLGEQIT RGI
Sbjct: 123 LLTAIQGYFIAVGLETLGASQGIQAVIEPGMTFRIAAVISLIGGTMFLMWLGEQITSRGI 182

Query: 185 GNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRR 244
           GNGVSLII +GIVA LP++LV++LE GR GSI    ++ I  + V ++  + F ERAQRR
Sbjct: 183 GNGVSLIIMAGIVAHLPTTLVNLLEGGRTGSIDPVRLIGIVVAVVILVLFICFMERAQRR 242

Query: 245 LLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFI--DVSSSPT 302
           +LIQYPKR    R  Q D S+LPLK+NTAGV+P IFASSLLL+P TI  F    V+    
Sbjct: 243 ILIQYPKRAT-QRGMQADRSHLPLKINTAGVIPPIFASSLLLMPLTISQFAGQRVAGESR 301

Query: 303 W---IVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRP 359
           W   I+ L   L HG   YM+LY   I+FF+FFYTA+VFNP+E ADNLK++GGFIPGIRP
Sbjct: 302 WGDFIISLNQYLQHGSPVYMLLYGAGIIFFSFFYTAVVFNPEETADNLKRYGGFIPGIRP 361

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G  T  ++DYVLTR+TV+GA YL  +C+ PE L++   +P  L GTSLLI+V+V +DT+ 
Sbjct: 362 GKNTETYLDYVLTRITVIGAAYLTIICLLPEYLVSALQIPFYLGGTSLLIVVNVTMDTVT 421

Query: 420 QIQGYLIAQQYEGVFKKSRSK 440
           QIQ +L+A QY  + KK++ K
Sbjct: 422 QIQSHLLAHQYGDLIKKAKLK 442


>gi|254492324|ref|ZP_05105497.1| preprotein translocase, SecY subunit [Methylophaga thiooxidans
           DMS010]
 gi|224462496|gb|EEF78772.1| preprotein translocase, SecY subunit [Methylophaga thiooxydans
           DMS010]
          Length = 451

 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/430 (52%), Positives = 305/430 (70%), Gaps = 6/430 (1%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           R  +LKSR++F + ALIVYRFGT++P+P ID  + +  F+ +   I  +FNMFSGGA+ER
Sbjct: 17  RFGELKSRLLFVLGALIVYRFGTFMPVPGIDPAALAIMFEQQRGTILDMFNMFSGGALER 76

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           ++VF+LGIMPYISASII+QL+    P L  LKKEG  G++ I QYTRY T++L   QA G
Sbjct: 77  LSVFALGIMPYISASIIMQLLTVVHPKLAQLKKEGAAGKRKITQYTRYGTLVLATFQALG 136

Query: 139 IAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           IA+ L++    G G+V D  + F  + +ITL+ GTMFL+WLGEQIT RGIGNG+SLIIF+
Sbjct: 137 IAIALESQSAAGVGVVIDPGFVFRITAVITLVTGTMFLMWLGEQITERGIGNGISLIIFA 196

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVAGLPS++   LEL R G + T L++ +    +AV A V+F ERAQRR+ + Y KRQ 
Sbjct: 197 GIVAGLPSAIGGTLELARTGQLHTFLVIALMVLALAVTAFVVFVERAQRRIPVHYAKRQQ 256

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           G +M    V++LPLKLN AGV+P IFASS++L PATI G+   S    W+  +   +  G
Sbjct: 257 GRKMIAGQVTHLPLKLNMAGVIPPIFASSIILFPATIAGWFGSSDGMGWLKDISTLMSPG 316

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y++ Y++ I+FF FFYTA+VFNPKE A+NL+K G FIPGIRPG++TA +ID V+ R+
Sbjct: 317 QPMYVMAYALAIIFFCFFYTALVFNPKETAENLQKSGAFIPGIRPGEQTAKYIDTVMGRL 376

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T+ GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D + Q+Q ++++QQYE + 
Sbjct: 377 TLAGAVYITAVCLLPEFLILYWSVPFYFGGTSLLIIVVVVMDFVSQVQSHMMSQQYESLM 436

Query: 435 KKSRSKKKNS 444
           KK  S K NS
Sbjct: 437 KK--SNKNNS 444


>gi|126740818|ref|ZP_01756503.1| protein translocase subunit SecY [Roseobacter sp. SK209-2-6]
 gi|126718114|gb|EBA14831.1| protein translocase subunit SecY [Roseobacter sp. SK209-2-6]
          Length = 447

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 314/436 (72%), Gaps = 2/436 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID  +  +  +    GI G+ +
Sbjct: 3   ANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDAAALQEFMEQAGQGIGGMVS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASII+QL+ + VP+LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIIQLLTSMVPALEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           LL   Q+YG+AV L++G  + +D   +F  + +ITL+GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 LLATAQSYGLAVSLESGD-LATDPGLYFRLACMITLVGGTMFLMWLGEQITQRGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P+S+      GR G+IS  +++ +    +AVI  V+F ERA R++ IQY
Sbjct: 182 LIIFVGIIAEVPASIAQFFASGRSGAISPAVIIGVIFMVIAVIMFVVFMERALRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   ++S   +  L+ 
Sbjct: 242 PRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPTTISTFSSGATSGPIMSWLLA 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
           + G G+  Y++ +   IVFFA+FYT  + F P++ A+NLK   GF+PGIRPG +TA +I+
Sbjct: 302 NFGPGQPLYLLFFVGMIVFFAYFYTFNVAFKPEDVANNLKNQNGFVPGIRPGKKTAEYIE 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+ RV V+G+GYL  VC+ PE L      PV   GTS+LI+VSV +DTI Q Q +L+A 
Sbjct: 362 YVVNRVLVLGSGYLALVCLLPEVLRGQFAFPVYFGGTSVLIVVSVTMDTIQQAQSHLLAH 421

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ +KS+ + +N 
Sbjct: 422 QYEGLIEKSQLRGRNK 437


>gi|86135788|ref|ZP_01054367.1| preprotein translocase SecY [Roseobacter sp. MED193]
 gi|85826662|gb|EAQ46858.1| preprotein translocase SecY [Roseobacter sp. MED193]
          Length = 454

 Score =  451 bits (1161), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/445 (50%), Positives = 315/445 (70%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++++  +A DL++RI+FT+  LIVYR GT+IP+P ID  +     ++ 
Sbjct: 1   MVSAAEQMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDANALRNFMEAA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEG QG+K I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGAQGQKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QAYG+AV L+ G  + +D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVALATAQAYGLAVSLEAGD-LATDPGMYFRMACMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RG+GNG+SLIIF GI+A +P+S+      GR G+IS  +++ +    +AVI  V+F ER
Sbjct: 180 QRGLGNGISLIIFVGIIAEVPASIAQFFASGRSGAISPAVIIGVILMVIAVIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   +++
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPTTISAFSSGATN 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ +   IVFFA+FYT  + F P++ A+NLK   GF+PGIRP
Sbjct: 300 GPVMSWLLANFGPGQPLYLLFFVSMIVFFAYFYTFNVAFKPEDVANNLKNQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +I+YV+ RV V+G+ YL  VC+ PE L      PV   GTS+LI+VSV +DTI 
Sbjct: 360 GKKTAEYIEYVVNRVLVLGSLYLALVCLLPEVLRGQFAFPVYFGGTSVLIVVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           Q Q +L+A QYEG+ +KS+ + +N 
Sbjct: 420 QAQSHLLAHQYEGLIEKSQLRGRNK 444


>gi|51473819|ref|YP_067576.1| preprotein translocase subunit SecY [Rickettsia typhi str.
           Wilmington]
 gi|81692284|sp|Q68W98|SECY_RICTY RecName: Full=Preprotein translocase subunit secY
 gi|51460131|gb|AAU04094.1| preprotein translocase SecY subunit [Rickettsia typhi str.
           Wilmington]
          Length = 433

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/433 (51%), Positives = 316/433 (72%), Gaps = 7/433 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S + DL SRI+FTI  LI+ R G++IP+P ID I+ +   +    GI G+FNM S
Sbjct: 4   NFSKKS-SNDLVSRIIFTIFMLIICRIGSFIPIPGIDSIALNSVAEKNQFGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ INQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGESGKRKINQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GTM L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVALSLESMVTNTGPVVILAGFFFRVTTVITLVVGTMLLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFE+AQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAITVCIGVVLLIAIIIFFEKAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL P T+  F + +S    +  L 
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPTTLANFSNSNSETMSM--LS 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             LGHG+  Y++LY V I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + D
Sbjct: 301 YYLGHGKPVYILLYVVLIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYFD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           Y+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL + 
Sbjct: 361 YILTRLTVIGGLYLSIICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFSS 420

Query: 429 QYEGVFKKSRSKK 441
           +YEG+ KK + K 
Sbjct: 421 KYEGLMKKIKLKN 433


>gi|255262422|ref|ZP_05341764.1| preprotein translocase, SecY subunit [Thalassiobium sp. R2A62]
 gi|255104757|gb|EET47431.1| preprotein translocase, SecY subunit [Thalassiobium sp. R2A62]
          Length = 454

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 226/439 (51%), Positives = 310/439 (70%), Gaps = 3/439 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M+SA EQ  SN+++ +F +A +L+ RI+FTI  LIVYR GTYIP+P ID  +  +     
Sbjct: 1   MSSAAEQMASNMSWGAFGKATELRQRILFTIGLLIVYRLGTYIPVPGIDGGALRQFMDDA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           +AGI G+ +MF+GGA+ RM +F+LGIMPYISASII+QL++A    L+ LKKEGEQGRK I
Sbjct: 61  AAGIGGILSMFTGGALSRMGIFALGIMPYISASIIIQLLSAMWEPLKQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYG+A  L+ G  + SD   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVILATFQAYGLAASLEAGD-LASDPGLYFRVACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P++L   L  GR G+IS  +++ I    +  +  V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEIPAALAQFLSQGRSGAISPAVIIGIILMVIVTLTFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           + R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFAS+LLLLP TI  F    + 
Sbjct: 240 SLRKVHIQYPRRQVGMKVYDGGSSHLPIKVNPAGVIPAIFASALLLLPTTISTFSGGQTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  I+FF FFYT  + F   E ADNLK   GF+PGIRP
Sbjct: 300 PV-MSTILAYFGPGQPLYLLFFTAMIMFFTFFYTKEVAFKTDEVADNLKNQNGFVPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G RTA ++DYV+TR+ V+GA YL  V + PE L +   +P    GTS+LIIVSV +DTI 
Sbjct: 359 GKRTAEYLDYVVTRILVLGASYLALVALLPEILRSQLSIPFYFGGTSILIIVSVGMDTIQ 418

Query: 420 QIQGYLIAQQYEGVFKKSR 438
           QIQ +L+A QYEG+ +KS+
Sbjct: 419 QIQSHLLAHQYEGLIEKSQ 437


>gi|15604485|ref|NP_221003.1| preprotein translocase subunit SecY [Rickettsia prowazekii str.
           Madrid E]
 gi|6226135|sp|Q9ZCS5|SECY_RICPR RecName: Full=Preprotein translocase subunit secY
 gi|3861179|emb|CAA15079.1| PREPROTEIN TRANSLOCASE SECY SUBUNIT (secY) [Rickettsia prowazekii]
 gi|292572267|gb|ADE30182.1| Preprotein translocase secY subunit [Rickettsia prowazekii Rp22]
          Length = 433

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/433 (51%), Positives = 317/433 (73%), Gaps = 7/433 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           NF+  S + DL +RI+FT+  LI+ RFG++IP+P ID I+ +   +    GI G+FNM S
Sbjct: 4   NFSKKS-SNDLVNRIIFTLFMLIICRFGSFIPIPGIDSIALNSVAEKNQFGILGMFNMLS 62

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ RM++F+L IMPYI+ASII+QL++     LENLKKEGE G++ INQ +RY TVLL 
Sbjct: 63  GGSLGRMSIFALAIMPYITASIIIQLMSVAYKPLENLKKEGETGKRKINQLSRYLTVLLA 122

Query: 133 ILQAYGIAVGLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
             QAYG+A+ L+    N   +V  + +FF  +T+ITL+ GT+ L+WLGEQIT RGIGNG 
Sbjct: 123 SFQAYGVALSLESMVTNTGPVVILAGFFFRVTTVITLVVGTILLMWLGEQITQRGIGNGT 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF GI++G+PS+++S+ EL R G++S  + + +    V +IA++IFFE+AQR+LL+Q
Sbjct: 183 SLIIFIGIISGVPSAIISMFELSRKGALSPLIAITVCIGVVLLIAIIIFFEKAQRKLLVQ 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           YPKRQVGN+++  + +++PLKLNT+GV+P IFASS+LL P T+  F + +S    +  L 
Sbjct: 243 YPKRQVGNKIYGGEATHMPLKLNTSGVIPPIFASSILLFPTTLASFSNSNSDTMSM--LT 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             LGHG+  Y++LY V I+FF+FFYTAIVFN +E A+NL+K+G +IPG RPG  T+ + D
Sbjct: 301 YYLGHGKPVYILLYVVLIMFFSFFYTAIVFNSEETANNLRKYGAYIPGKRPGKNTSDYFD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           Y+LTR+TV+G  YL  +C+ PE L+    + +SL GTS LI+V+VVLDT+ QIQ YL + 
Sbjct: 361 YILTRLTVIGGIYLSVICVIPELLMNKYVISLSLGGTSFLIVVNVVLDTMTQIQTYLFSS 420

Query: 429 QYEGVFKKSRSKK 441
           +YEG+ KK + K 
Sbjct: 421 KYEGLMKKIKLKN 433


>gi|260577159|ref|ZP_05845136.1| preprotein translocase, SecY subunit [Rhodobacter sp. SW2]
 gi|259020633|gb|EEW23952.1| preprotein translocase, SecY subunit [Rhodobacter sp. SW2]
          Length = 452

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 312/446 (69%), Gaps = 5/446 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +NL++ +  +A DL+ RI FT+  LIVYR GTYIP+P ID  +  +   + 
Sbjct: 1   MASAAEQMAANLSWGALGKATDLRQRIFFTVGLLIVYRLGTYIPVPGIDGTALREFMANV 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
            AGI G+ NMF+GGA+ RM +F+LGIMPYISASIIVQL+ + +P+LE LKKEGEQGRK I
Sbjct: 61  GAGIGGILNMFTGGAISRMGIFALGIMPYISASIIVQLMTSMLPALEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV L   QA+GIA+ L+ G  +  D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVFLATFQAWGIAMSLEAGD-LAQDPGLYFRLAVVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GIVA +P +L      GR G++S  +++ +    VAVIA V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIVAEIPRALAQFFSQGRSGALSPAVIIGVLVMVVAVIAFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP T+  F    + 
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPIKVNPAGVIPAIFASSLLLLPITVSTFSGAQTG 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA-IVFNPKEAADNLKKHGGFIPGIRP 359
           P  +  ++   G G+  Y++ ++  IVFF +FYTA + F   + A+NLK   GFIPGIRP
Sbjct: 300 PI-MSTILAYFGPGQPLYLLFFTAMIVFFTYFYTANVAFKTDDVAENLKNQNGFIPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G  T  H+DY++ RV V+G+ YL  VC+ PE L +   VP    GTS+LI+VSV +DTI 
Sbjct: 359 GKATQEHLDYIVNRVLVLGSAYLAAVCLLPEILRSQFAVPFYFGGTSVLIVVSVTMDTIN 418

Query: 420 QIQGYLIAQQYEGVFKKS--RSKKKN 443
           Q+Q +L+A QYEG+ +KS  R KK+ 
Sbjct: 419 QVQSHLLAHQYEGLIEKSQLRGKKRT 444


>gi|56477614|ref|YP_159203.1| preprotein translocase subunit SecY [Aromatoleum aromaticum EbN1]
 gi|56313657|emb|CAI08302.1| Preprotein translocase SecY subunit [Aromatoleum aromaticum EbN1]
          Length = 441

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 227/422 (53%), Positives = 300/422 (71%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           R  DLK R++F + AL+VYR G +IP+P ID    S+ FQS++ GI G+FN+FSGGA+ R
Sbjct: 13  RFGDLKRRVLFLLGALLVYRIGGHIPVPGIDPARLSELFQSQAGGILGVFNLFSGGALSR 72

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
             +F+LGIMPYISASII+QL+   VP LE LKKEGE GR+ I QYTRY TV L + Q+ G
Sbjct: 73  FTIFALGIMPYISASIIMQLMTVAVPQLEALKKEGEAGRRKITQYTRYGTVALSLAQSLG 132

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           IA+ L++  G+V D    F F T+ TL+ GTMFL+WLGEQIT RGIGNG+SLIIF+GI A
Sbjct: 133 IAIALESQPGLVLDPGLMFRFVTVATLVTGTMFLMWLGEQITERGIGNGISLIIFAGIAA 192

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
           GLPS++  + EL R G++     LLI    V V   V+F ER QR++L+ Y KRQVGN++
Sbjct: 193 GLPSAIGGLFELVRTGAMHPFTALLICVLVVLVTGFVVFVERGQRKILVNYAKRQVGNKI 252

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFY 318
           +    S+LPLKLN AGV+P IFASS++L PAT+  +   S   TW+  +  +L  G+  Y
Sbjct: 253 YGGQSSHLPLKLNMAGVIPPIFASSIILFPATLGQWFGASEGMTWLRDISSTLAPGQPIY 312

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  I+FF FFYTA+VFN +E ADNLKK G F+PGIRPGD+T+ +ID +LTR+T+VG
Sbjct: 313 VMLYAAAIMFFCFFYTALVFNARETADNLKKSGAFVPGIRPGDQTSRYIDKILTRLTLVG 372

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q Y+++ QYE + KK+ 
Sbjct: 373 AVYITLVCLLPEFLILRWNVPFYFGGTSLLIIVVVTMDFMTQVQAYVMSHQYESLLKKAN 432

Query: 439 SK 440
            K
Sbjct: 433 FK 434


>gi|237653976|ref|YP_002890290.1| preprotein translocase subunit SecY [Thauera sp. MZ1T]
 gi|237625223|gb|ACR01913.1| preprotein translocase, SecY subunit [Thauera sp. MZ1T]
          Length = 441

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 300/428 (70%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
              S  R  DLK R++F + ALIVYR G +IP+P ID    ++ FQS+  GI G+FN+FS
Sbjct: 7   TLGSPGRFGDLKRRLLFLVGALIVYRIGAHIPVPGIDPQGLAELFQSQQGGILGVFNLFS 66

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R  +F+LGIMPYISASII+QL+   VPSLE LKKEGE GR+ I QYTRY T++L 
Sbjct: 67  GGALSRFTIFALGIMPYISASIIMQLMTVAVPSLEALKKEGEAGRRKITQYTRYGTLVLA 126

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           + QA GIA+ L+   G+V +    F F T+ TL+ GTMFL+WLGEQIT RGIGNG+S+II
Sbjct: 127 LAQALGIAIALEGQAGLVLEPGLMFRFVTVATLVTGTMFLMWLGEQITERGIGNGISMII 186

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
           F+GI+AGLP+++  + EL R G++     L I    V V A V+F ER QR++L+ Y KR
Sbjct: 187 FAGIIAGLPAAIGGLFELVRTGAMHPFTALFICILVVLVTAFVVFVERGQRKILVNYAKR 246

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           QVGN+++    S+LPLKLN +GV+P IFASS++L PAT+  +   S    W+  +  +L 
Sbjct: 247 QVGNKVYGGQSSHLPLKLNMSGVIPPIFASSIILFPATLGQWFGSSEGMYWLRDIASTLS 306

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
            G+  Y++LY+V IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L 
Sbjct: 307 PGQPIYVMLYAVAIVFFCFFYTALVFNARETADNLKKSGAFVPGIRPGDQTARYIDKILM 366

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+T+ GA Y+  VC+ PE LI    VP    GTSLLI+V V +D + Q+Q ++++ QYE 
Sbjct: 367 RLTLAGAIYITLVCLLPEFLILKWNVPFYFGGTSLLILVVVTMDFMAQVQAFVMSHQYES 426

Query: 433 VFKKSRSK 440
           + KK+  K
Sbjct: 427 LLKKANFK 434


>gi|330430077|gb|AEC21411.1| preprotein translocase subunit SecY [Pusillimonas sp. T7-7]
          Length = 441

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/419 (53%), Positives = 303/419 (72%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK RIVF I+AL+VYR GT+IP+P I+  + +  FQ    GI GLFNMFSGGA+ER +V
Sbjct: 16  DLKRRIVFLILALVVYRLGTHIPVPGINPDALADMFQQNQGGILGLFNMFSGGALERFSV 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+A  VP+LE +KKEGE GR+ I QYTRY TV L ++QA GI+V
Sbjct: 76  FALGIMPYISASIIMQLMAVVVPTLEAIKKEGESGRRKITQYTRYGTVFLALIQAVGISV 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G++ D    F F+T++TL+ GTMFL+WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 136 ALESQPGLIIDPGMLFRFTTVVTLVTGTMFLMWLGEQITERGLGNGISILIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S+L  +L+L R  ++S    L IF   +AV   V+F ER QRR+ + Y KRQVGN+++  
Sbjct: 196 SALAGLLDLVRTDAMSVLSALFIFVMVIAVTYFVVFVERGQRRVTVNYAKRQVGNKIYGG 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN +GV+P IFASS++LLPAT+  +   + +  W+  L   L  G+  Y+ L
Sbjct: 256 QSSHLPLKLNMSGVIPPIFASSIILLPATVTSWFSSNPNMRWLGDLAAVLSPGQPLYITL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           YS  I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++T+ +ID +L R+T+ GA Y
Sbjct: 316 YSAAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTSRYIDKILMRLTLAGAIY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE + A   VP    GTSLLIIV V +D + Q Q Y+++ QY+ + KK+  K
Sbjct: 376 ITLVCLLPELMQARWNVPFYFGGTSLLIIVVVTMDFMAQAQAYMMSHQYDSLLKKANFK 434


>gi|307543845|ref|YP_003896324.1| preprotein translocase subunit SecY [Halomonas elongata DSM 2581]
 gi|307215869|emb|CBV41139.1| preprotein translocase subunit SecY [Halomonas elongata DSM 2581]
          Length = 443

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/424 (51%), Positives = 302/424 (71%), Gaps = 2/424 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F ++A++VYR G +IP+P I+    +  F+ +   I G+FNMFSGGA+ERM++
Sbjct: 16  ELWARLRFVLLAIVVYRIGAHIPVPGINPDQLAALFREQQGTILGMFNMFSGGALERMSI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TVLL ++QA G++V
Sbjct: 76  LALGIMPYISASIIMQLLTAVSPQLEQLKKEGEAGRRKISQYTRYGTVLLALVQATGMSV 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QGI   +D+ F F+ I+T + G +FL+WLGEQIT +GIGNG+SL+IFSGIVAGLP
Sbjct: 136 GLAS-QGIAYTADFSFYFTAIVTFVCGAVFLMWLGEQITEKGIGNGISLLIFSGIVAGLP 194

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSST-VAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
            ++    EL R       L LL  S+  +A +A V+F ER QRRL + YP+RQVGN+M+ 
Sbjct: 195 GAVGQAFELARNDGAWNVLPLLALSALGIATVAFVVFIERGQRRLTVNYPRRQVGNKMYA 254

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              SYLPLK+N AGV+P+IFASS+LL PA++  +I       W+     +LG G+  Y++
Sbjct: 255 GQSSYLPLKVNMAGVIPAIFASSILLFPASLGQWIGAGDGMEWLQRASQALGPGQPLYIL 314

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L++  +VFF FFYTA+VFNPK+ ADNLKK G F+PGIRPG++TA ++D V+TR+T+ GA 
Sbjct: 315 LFAAAVVFFCFFYTALVFNPKDVADNLKKSGAFLPGIRPGEQTARYVDKVMTRLTLFGAL 374

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  V + P+ LI    VP    GTSLLI+V V++D + Q+Q +L++ QYE V KKS  K
Sbjct: 375 YITAVSLMPQFLIVAWNVPFFFGGTSLLIVVVVIMDFMAQVQSHLMSHQYESVMKKSNLK 434

Query: 441 KKNS 444
              S
Sbjct: 435 GYGS 438


>gi|34499621|ref|NP_903836.1| preprotein translocase subunit SecY [Chromobacterium violaceum ATCC
           12472]
 gi|34105471|gb|AAQ61826.1| preprotein translocase secY subunit [Chromobacterium violaceum ATCC
           12472]
          Length = 439

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/426 (51%), Positives = 299/426 (70%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           A+ ++  DLK RI F I ALIVYR G +IP+P I+    +K F +   G+  +FNMFSGG
Sbjct: 8   ANANKFGDLKRRIWFLIGALIVYRIGAHIPVPGINPAELAKLFHTSQTGLLDMFNMFSGG 67

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ R  VF+LGIMPYISASII+QL A  +PSL+ LKKEG+ GR+ I QYTRYATV L   
Sbjct: 68  ALSRFTVFALGIMPYISASIILQLAAEVLPSLKQLKKEGDAGRRKITQYTRYATVALATF 127

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q++GIAV L     +V  + + F  +T+++L+ GTMFL+WLGEQIT RGIGNG+SLII +
Sbjct: 128 QSFGIAVMLYKQPNLVMTAQWEFYLTTVVSLVTGTMFLMWLGEQITERGIGNGISLIICA 187

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GI AG+P+++   L L   GS+     +L+F   + V  LV++ ER QR++L+ Y KRQV
Sbjct: 188 GIAAGVPAAIGKTLTLTSQGSLPILFAILLFVGVILVTFLVVYAERGQRKVLVNYAKRQV 247

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GNR+ Q   ++LPLKLN AGV+P IFASS++L PAT++G+        W+ G+ D L  G
Sbjct: 248 GNRVMQGQSTHLPLKLNMAGVIPPIFASSIILFPATVLGWFGQGEHMAWLKGVADKLHPG 307

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y++LY+  I+FF +FYTA+VFNPKE ADNLKK G FIPGIRPG++T+ +I+ ++ R+
Sbjct: 308 QPIYVLLYAAAIIFFCYFYTALVFNPKETADNLKKSGAFIPGIRPGEQTSRYIEKIILRL 367

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T++GA Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q Y+++ QYE + 
Sbjct: 368 TLIGAIYITLVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVLSHQYESLL 427

Query: 435 KKSRSK 440
           KK+  K
Sbjct: 428 KKANFK 433


>gi|329893619|ref|ZP_08269753.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
 gi|328923546|gb|EGG30858.1| Preprotein translocase secY subunit (TC 3.A.5.1.1) [gamma
           proteobacterium IMCC3088]
          Length = 443

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/438 (51%), Positives = 308/438 (70%), Gaps = 4/438 (0%)

Query: 7   QFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFG 66
           Q V  +N A      +L +R+ F ++ALI+YR GT+IP+P ID       F S    I G
Sbjct: 5   QQVPGMNTAGLG---ELFARLRFVLVALIIYRIGTHIPVPGIDPAQLQALFNSNQGTILG 61

Query: 67  LFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRY 126
           L NMFSGGA+ERM++ +LGIMPYISASII+QL++A  PSLE LKKEGE GR+ I+QYTRY
Sbjct: 62  LANMFSGGALERMSILALGIMPYISASIIMQLMSAVTPSLEQLKKEGESGRRKISQYTRY 121

Query: 127 ATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGN 186
            TV L I+QA G+ VG+ N     S S  F+V + I +L+ G +F++WLGEQIT RG+GN
Sbjct: 122 LTVGLAIIQATGMTVGMANQGMAYSVSPVFYVIA-ITSLVTGAIFMMWLGEQITERGVGN 180

Query: 187 GVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLL 246
           G+SL+IF+GIVAGLPS++   LE  R G ++  ++L I +  + VI L+IF ER QRR+ 
Sbjct: 181 GISLLIFAGIVAGLPSAIGQSLEQARQGELNILVLLGILALAIVVIYLIIFIERGQRRIT 240

Query: 247 IQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVG 306
           + Y K+Q GNRM+Q   S+LPLK+N AGV+P+IFASS+LL PA+I  +    +S  W+  
Sbjct: 241 VNYAKQQRGNRMYQAQSSHLPLKVNMAGVIPAIFASSILLFPASIAQWFGSGNSSDWLQD 300

Query: 307 LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALH 366
           L  ++G G+   ++L++VFIVFF FFYTA++FNP E +DNLK+ G FIPGIRPG +TA  
Sbjct: 301 LAVAIGPGQPLNILLFTVFIVFFCFFYTALMFNPVEVSDNLKRSGAFIPGIRPGQQTANF 360

Query: 367 IDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLI 426
           ID VLTR+TV GA Y+  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +++
Sbjct: 361 IDGVLTRLTVFGAAYIALVCLLPQFLVVTWNVPFYLGGTSLLIVVVVVMDFMAQVQSHMM 420

Query: 427 AQQYEGVFKKSRSKKKNS 444
           +QQY+ V KK+  K   S
Sbjct: 421 SQQYDSVMKKANLKNYGS 438


>gi|288942052|ref|YP_003444292.1| preprotein translocase subunit SecY [Allochromatium vinosum DSM
           180]
 gi|288897424|gb|ADC63260.1| preprotein translocase, SecY subunit [Allochromatium vinosum DSM
           180]
          Length = 450

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/423 (51%), Positives = 294/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+ R++F + AL+VYR GT+IP+P ++  + +  F      I  +FNMFSGGA+ER ++
Sbjct: 20  ELRRRLMFLLGALLVYRIGTFIPVPGVNPEALAILFDQNQGSILDMFNMFSGGALERASL 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LG+MPYISASIIVQL+ A VP LE LKKEGE GR+ I QYTRY TV L   QA GI++
Sbjct: 80  FALGVMPYISASIIVQLMTAVVPQLEQLKKEGEAGRRKITQYTRYGTVFLATFQAIGISM 139

Query: 142 GLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
            L+     G  +V+ S   FVF+  ++L+ GTMFL+WLGEQIT RGIGNG+S+IIF GIV
Sbjct: 140 ALQGQTAGGSALVAHSGVGFVFTATVSLVTGTMFLMWLGEQITERGIGNGISMIIFGGIV 199

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP++L   LEL R G ++   +L +F+  +AV A V+F ER QRR+ + Y +RQ G +
Sbjct: 200 AGLPAALGGTLELARTGEMNALAVLALFAMALAVTAFVVFVERGQRRITVNYARRQQGRK 259

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           M Q   ++LPLKLN AGV+P IFASS++L P T+  +   S    WI  +   L  G   
Sbjct: 260 MMQAQSTHLPLKLNMAGVIPPIFASSIILFPGTLGQWFGSSEDLRWIADITSKLAPGEPV 319

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFN KE ADNLK+ G FIPGIRPG++TA +ID V+TR+T  
Sbjct: 320 YVLLYASAIIFFCFFYTALVFNAKETADNLKRSGAFIPGIRPGEQTARYIDGVMTRLTAA 379

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE LI    VP    GTSLLI+V VV+D + Q+Q +L++ QYEG+ KK+
Sbjct: 380 GAIYITAVCLLPEFLIVGYNVPFYFGGTSLLIVVVVVMDFMAQVQAHLMSHQYEGLMKKA 439

Query: 438 RSK 440
             K
Sbjct: 440 NLK 442


>gi|307823462|ref|ZP_07653691.1| preprotein translocase, SecY subunit [Methylobacter tundripaludum
           SV96]
 gi|307735447|gb|EFO06295.1| preprotein translocase, SecY subunit [Methylobacter tundripaludum
           SV96]
          Length = 440

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/424 (51%), Positives = 304/424 (71%), Gaps = 4/424 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F + A  VYR G +IP+P ID  + +  F+ +S  I  +FNMFSGGA+ R+++
Sbjct: 17  ELKARLLFVLGAFFVYRVGAHIPVPGIDPKALAVMFEQQSGSILDMFNMFSGGALMRLSL 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P++E LKKEGE GR+ I+QYTR+ TV+L   QA GI++
Sbjct: 77  FALGIMPYISASIIMQLMTVVIPAMEQLKKEGESGRRKISQYTRFGTVVLATFQAIGISL 136

Query: 142 GLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
            L+N    G  +V      F+  T +TL+ GT+FL+WLGEQ+T RGIGNG+SLIIF+GIV
Sbjct: 137 ALQNQTAGGLSVVLSPGMSFIVITTVTLVAGTVFLMWLGEQVTERGIGNGISLIIFAGIV 196

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +GLP ++   LEL R G ++   ++L+F  +++V ALV+F ER QRR+LI YPKRQ G +
Sbjct: 197 SGLPKAIGGTLELARTGEMNGAFIILLFLLSISVTALVVFVERGQRRILINYPKRQQGRK 256

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           M+    S+LPLKLN AGV+P IFASS++L PATI G+   S   TW+  +   L  G+  
Sbjct: 257 MYAGQSSFLPLKLNMAGVIPPIFASSIILFPATIAGWFGNSEGFTWLQDVATMLSPGQPV 316

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++ Y+  IVFF FFYTA+VFN KE A+NLKK G F+PGIRPG +T+ +ID V+TR+T+ 
Sbjct: 317 YVIFYATAIVFFCFFYTALVFNSKETAENLKKSGAFLPGIRPGLQTSSYIDKVMTRLTLT 376

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D I Q+Q ++++QQY+G+ KK+
Sbjct: 377 GAFYITLVCLLPEFLIVYWNVPFYFGGTSLLIIVVVVMDFISQMQTHVMSQQYDGLMKKA 436

Query: 438 RSKK 441
             KK
Sbjct: 437 NLKK 440


>gi|114330593|ref|YP_746815.1| preprotein translocase subunit SecY [Nitrosomonas eutropha C91]
 gi|114307607|gb|ABI58850.1| protein translocase subunit secY/sec61 alpha [Nitrosomonas eutropha
           C91]
          Length = 440

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/432 (52%), Positives = 305/432 (70%)

Query: 9   VSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLF 68
           VS    A   R  DLK R+ F ++ALIVYR GT++P+P ID +     F S+  GI G+F
Sbjct: 2   VSKSKAALSDRFYDLKKRLWFLLLALIVYRIGTHVPVPGIDSVVLKDLFNSQEGGILGMF 61

Query: 69  NMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYAT 128
           NMFSGGA+ R ++F+LGIMPYISASII+QL    VP LE+LKKEGE GRK I QYTRY T
Sbjct: 62  NMFSGGALSRFSIFALGIMPYISASIIMQLGTVAVPYLESLKKEGESGRKKITQYTRYGT 121

Query: 129 VLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           +LL  LQ+YGI+  L++  G+V +    F+F+TIITL+ G++FL+WLGEQIT RGIGNG+
Sbjct: 122 LLLSTLQSYGISFALQSQPGLVVEPGMHFIFTTIITLVTGSIFLMWLGEQITERGIGNGI 181

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GI AG PS++   LEL   G++     L IF + +A+ ALV+F ER QR++L+ 
Sbjct: 182 SLIIFAGIAAGFPSAVGGTLELVNTGAMHFFTALFIFIAAIAITALVVFIERGQRKILVN 241

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KRQVG +M     S+LPLKLN +GV+P IFASS++L PAT+ G+   S S  W+    
Sbjct: 242 YAKRQVGKQMMGGQSSHLPLKLNMSGVIPPIFASSIILFPATLAGWFSDSLSLNWLKDFS 301

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
           ++L  G+  Y+ LY+  I+FF FFYTA+VFNPKE ADNLKK G FIPGIRPGD+T  +I+
Sbjct: 302 NTLAPGQPIYVALYAALIIFFCFFYTALVFNPKETADNLKKSGAFIPGIRPGDQTTKYIE 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            ++ R+T++G+ Y+  VC+ PE +I    VP    GTSLLIIV V +D + Q+Q ++++ 
Sbjct: 362 RIMLRLTLIGSIYVTLVCLLPEFMILKWNVPFYFGGTSLLIIVVVTMDFMAQVQSHVMSG 421

Query: 429 QYEGVFKKSRSK 440
           QYE + KK+  K
Sbjct: 422 QYESLLKKANFK 433


>gi|254468256|ref|ZP_05081662.1| preprotein translocase, SecY subunit [beta proteobacterium KB13]
 gi|207087066|gb|EDZ64349.1| preprotein translocase, SecY subunit [beta proteobacterium KB13]
          Length = 438

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 222/431 (51%), Positives = 306/431 (70%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           N  +FS   +LKSRI+F + ALIV+R G +IP+P ID +   K F S+S GI G+FNMFS
Sbjct: 4   NPLNFSGMTELKSRILFLLGALIVFRLGAHIPVPGIDPLELKKLFDSQSGGILGMFNMFS 63

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R  VF+LGIMPYISASII+ L+ A  P+L+ LKKEG+ G++ I +YT   T++L 
Sbjct: 64  GGALSRFTVFALGIMPYISASIIMNLLQAMSPTLKELKKEGKSGQEKIAKYTIQGTLVLA 123

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
             Q+ GI+V L+   G+V D  + F  + ++TL+ GTMFLVWLG QIT RGIGNG+S+II
Sbjct: 124 AFQSLGISVALEAQPGLVLDPGFMFRITAMLTLVTGTMFLVWLGTQITSRGIGNGISMII 183

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
           F+GIVAGLPS+L + LEL R G+ S PL+  + ++ V V A+V+F ERAQRR+ I Y KR
Sbjct: 184 FAGIVAGLPSALGNTLELARTGAYSIPLVFFLIAAVVLVTAIVVFIERAQRRITINYAKR 243

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           QVGN+++    S+LPLK+N AGV+P+IFASS++L PATI G+   S S  W+  +   L 
Sbjct: 244 QVGNKLYGGQSSHLPLKINQAGVIPAIFASSVILFPATIAGWFGSSESLFWLKDISALLS 303

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
            G+  Y+ L++V IVFF +FYTA+ FNPKE A+NLK+ G F+PGIRPG++TA  ID ++ 
Sbjct: 304 PGQPIYIFLFAVAIVFFCYFYTALQFNPKETAENLKRAGAFVPGIRPGEQTAKFIDTIMG 363

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+T+VGA Y+  VC+FPE LI     P    GTSLLIIV V +D + Q+Q  +++ QY+ 
Sbjct: 364 RLTLVGAIYITLVCLFPEFLILKFNTPFYFGGTSLLIIVVVAMDFMTQVQSQMMSYQYDS 423

Query: 433 VFKKSRSKKKN 443
           + KK+  + + 
Sbjct: 424 LLKKANFRGQQ 434


>gi|326388217|ref|ZP_08209820.1| preprotein translocase subunit SecY [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207383|gb|EGD58197.1| preprotein translocase subunit SecY [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 449

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 237/449 (52%), Positives = 311/449 (69%), Gaps = 9/449 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MAS  +   SNLN ++FS+A +L  RI FT+ ALIV+RF T++PLP I+  +  KAF  +
Sbjct: 1   MASRADNIASNLNLSNFSKATELHKRIWFTVGALIVFRFLTFVPLPGINPAAL-KAFSDQ 59

Query: 61  S-AGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKV 119
           +  GI  L NMFSGGA++  ++ +LG+MPYI+ASI+VQL A+  P+L   KKEGE GRK 
Sbjct: 60  TNGGILDLLNMFSGGALKNYSLIALGVMPYITASIVVQLAASLHPALAAYKKEGETGRKK 119

Query: 120 INQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQI 179
           +NQYTRY  V L ++Q   IA G    Q  V     F+    II+L+GGTMFL+WLGEQI
Sbjct: 120 LNQYTRYGAVFLTVVQGMAIARGAVGYQLEVLPEMMFYPIC-IISLIGGTMFLLWLGEQI 178

Query: 180 TMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFE 239
           T RGIGNG SLII +GIVA +P    ++ E GR G ++   ++ +    VAV+  + F E
Sbjct: 179 TSRGIGNGTSLIIMAGIVAQMPKFFGNLFEQGRTGQLNAFAIIGVMILLVAVVIFICFME 238

Query: 240 RAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSS 299
           RA RRLLIQYP+R   + M   D S+LPLKLNTAGV+P IFASSLLLLP TI      S 
Sbjct: 239 RATRRLLIQYPRRATQHGMMAADRSHLPLKLNTAGVIPPIFASSLLLLPLTITQLAGKSI 298

Query: 300 SPTWIVG-----LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFI 354
           SP  + G     L   LGHG+  YM+LY++ I+FF+FFYTA+VFNP+E ADNLK++GGFI
Sbjct: 299 SPDTMAGKIVVSLNQYLGHGKPAYMLLYALGIIFFSFFYTAVVFNPEETADNLKRNGGFI 358

Query: 355 PGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGV-PVSLSGTSLLIIVSV 413
           PGIRPG  TA ++DYVLTR+TV+GA Y+  VC+ PE ++A TG+  V   GTSLLI+V+V
Sbjct: 359 PGIRPGKNTANYLDYVLTRITVLGAAYITIVCVVPEWIMAETGMGTVFFGGTSLLIVVNV 418

Query: 414 VLDTIVQIQGYLIAQQYEGVFKKSRSKKK 442
            +DTI QIQ +L+A QY  + KK++ K +
Sbjct: 419 TVDTITQIQSHLLAHQYGDLIKKAKLKGR 447


>gi|291613256|ref|YP_003523413.1| preprotein translocase, SecY subunit [Sideroxydans lithotrophicus
           ES-1]
 gi|291583368|gb|ADE11026.1| preprotein translocase, SecY subunit [Sideroxydans lithotrophicus
           ES-1]
          Length = 435

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/419 (52%), Positives = 302/419 (72%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DL  R+ F ++ALIVYR G +IP+P ID    +  F+ ++ GI G+FNMFSGGA+ R  +
Sbjct: 12  DLGQRLWFLLLALIVYRIGAHIPVPGIDPNVLADLFKRQTGGILGMFNMFSGGALSRFTI 71

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL A  VP LE LKKEGE GR+ I QYTRY T++L + QA+GI+V
Sbjct: 72  FALGIMPYISASIIMQLAAIAVPQLEQLKKEGEAGRRKITQYTRYGTLVLALFQAFGISV 131

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G+V      F  +T++TL+ GTMFL+WLGEQIT RG+GNG+SLIIF+GI AGLP
Sbjct: 132 ALQSQAGLVLHPGSMFQITTVVTLVTGTMFLMWLGEQITERGLGNGISLIIFAGIAAGLP 191

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           ++L + LE+ R G+ S PL+L +F   + V  LV+F ER QR++L+ Y KRQVGN+++  
Sbjct: 192 NALGNTLEMARTGAFSIPLVLALFIGAILVTGLVVFVERGQRKILVNYAKRQVGNKVYGG 251

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN AGV+P IFASS++L PAT+ G+     S TW+  + + L  G+  Y++ 
Sbjct: 252 QSSHLPLKLNMAGVIPPIFASSIILFPATLAGWFGSGQSMTWLKDVSEKLSPGQPIYVLF 311

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+  IVFF FFYTA+VF+PKE A+NLKK G F+PGIRPG++TA +++ ++ R+T+VGA Y
Sbjct: 312 YAAAIVFFCFFYTALVFSPKETAENLKKSGAFLPGIRPGEQTAKYVEKIMLRLTLVGAVY 371

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE L+    VP    GTSLLI+V V +D + Q+Q Y++  QYE + KK+  K
Sbjct: 372 ITLVCLLPEFLVVKWNVPFYFGGTSLLILVVVTMDFMAQVQSYMMTHQYESLLKKANFK 430


>gi|119899686|ref|YP_934899.1| preprotein translocase subunit SecY [Azoarcus sp. BH72]
 gi|119672099|emb|CAL96013.1| preprotein translocase SecY subunit [Azoarcus sp. BH72]
          Length = 441

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 224/419 (53%), Positives = 297/419 (70%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R++F + ALIVYR G +IP+P ID    ++ FQS++ GI G+FN+FSGGA+ R  +
Sbjct: 16  DLKRRLLFLVGALIVYRIGAHIPVPGIDPARLAELFQSQAGGILGVFNLFSGGALSRFTI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   VP LE LKKEGE GR+ I QYTRY T++L + Q+ GIA+
Sbjct: 76  FALGIMPYISASIIMQLMTVAVPQLEALKKEGEAGRRKITQYTRYGTLVLAVAQSLGIAI 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V D    F F T+ TL+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLP
Sbjct: 136 ALEGQAGLVLDPGLMFRFVTLATLVTGTMFLMWLGEQITERGVGNGISIIIFAGIAAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           SS+  + EL R G++     LLI    V V   V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 196 SSIGGLFELVRTGAMHPFTALLICVLVVLVTGFVVFVERGQRKILVNYAKRQVGNKIYGG 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN AGV+P IFASS++L PAT+  +   S    W+  L  +L  G+  Y++L
Sbjct: 256 QSSHLPLKLNMAGVIPPIFASSIILFPATLGQWFGSSEGLYWLRDLASTLSPGQPVYVLL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L R+T+ GA Y
Sbjct: 316 YALAIVFFCFFYTALVFNARETADNLKKSGAFVPGIRPGDQTARYIDKILVRLTLAGAVY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q Y+++ QYE + KK+  K
Sbjct: 376 ITLVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMAQVQAYVMSHQYESLLKKANFK 434


>gi|117924175|ref|YP_864792.1| protein translocase subunit secY/sec61 alpha [Magnetococcus sp.
           MC-1]
 gi|117607931|gb|ABK43386.1| protein translocase subunit secY/sec61 alpha [Magnetococcus sp.
           MC-1]
          Length = 442

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 224/432 (51%), Positives = 301/432 (69%), Gaps = 9/432 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           +  +  +L+ RI+FT+  LIVYR G ++P P ID  + +  F+ +   + G+FNMFSGGA
Sbjct: 15  NLGKIPELRKRILFTLGMLIVYRIGAHVPTPGIDPQALATFFEQQQGSLLGMFNMFSGGA 74

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R+ VF+LGIMPYISASII+QL+ A  P LE +KKEGE GR+ I QYTRY T++L + Q
Sbjct: 75  LSRLTVFALGIMPYISASIIIQLMTAVFPKLEAIKKEGEAGRRKITQYTRYGTIVLALFQ 134

Query: 136 AYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191
            +GIA GL++    G  +V +    F   T++TL  GT FL+W+GEQIT RGIGNG+SLI
Sbjct: 135 GFGIAYGLESMKAGGLNVVIEPGMEFRLMTVLTLTAGTAFLMWVGEQITDRGIGNGISLI 194

Query: 192 IFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPK 251
           IFSGIVA LP +L + L+L R G ++  L+L + +  + V A +IF ERAQRR+ IQY K
Sbjct: 195 IFSGIVANLPVALFNTLQLARTGDLAPLLVLFLIAMAIVVTAFIIFMERAQRRITIQYAK 254

Query: 252 RQV-GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS 310
           RQV G RM   + S+LPLK+NTAGV+P IFASS++L P TI  F+       +       
Sbjct: 255 RQVSGRRMVGGESSHLPLKVNTAGVIPPIFASSIILFPVTIANFMPWEGFKEF----AAM 310

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
              G+  YMV YS  I+FF FFYTAIVFNP+E ADNL+K+GGFIPGIRPG RT+ ++D +
Sbjct: 311 FSPGQLGYMVFYSAAILFFCFFYTAIVFNPEETADNLRKYGGFIPGIRPGKRTSDYLDKI 370

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           L+R+T+VGA Y+  VC+ PE LIA   VP    GTS+LI+V V +DT  QIQ +LI++QY
Sbjct: 371 LSRLTLVGAIYVTAVCLLPEILIAQYNVPFYFGGTSMLIVVGVTMDTTAQIQSFLISRQY 430

Query: 431 EGVFKKSRSKKK 442
           EG+ KK++ K +
Sbjct: 431 EGLMKKAKIKGR 442


>gi|85706699|ref|ZP_01037791.1| preprotein translocase SecY [Roseovarius sp. 217]
 gi|85668757|gb|EAQ23626.1| preprotein translocase SecY [Roseovarius sp. 217]
          Length = 447

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 229/442 (51%), Positives = 321/442 (72%), Gaps = 11/442 (2%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++++  +A +L+ RI+FT+  LIVYR GT+IP+P ID I+  +  +   A I G+ +
Sbjct: 3   ANTSWSALGKATELRKRILFTLGLLIVYRLGTFIPVPGIDGIALREFMEGAQASIGGMLS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+ A VP+LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLMTAMVPALEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           +L  LQ+YG+AV L++G+ +V++   FF+ S +ITL+GGTMFL+WLGEQIT RG+GNG+S
Sbjct: 123 VLATLQSYGLAVSLQSGE-MVTNPGMFFIVSCMITLVGGTMFLMWLGEQITARGVGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P++L      GR G++S  +++ +    VAVIA V+F ER+ R++ IQY
Sbjct: 182 LIIFVGIIAEVPAALAQFFASGRSGAVSPAVIVGVMVMVVAVIAFVVFMERSLRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLPATI  F   +++P  +  ++ 
Sbjct: 242 PRRQVGMKIYDGGSSHLPVKVNPAGVIPAIFASSLLLLPATITTFSGSTTNPV-LSTVMA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ +++ IVFFA+FYT  + F   E ADNLK   GFIPGIRPG RTA ++D
Sbjct: 301 YFGPGQPLYLLFFTIMIVFFAYFYTFNVAFKTDEVADNLKNQNGFIPGIRPGKRTAEYLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+ RV V+G+ YL  VC+ PE L     +P    GTS+LI+VSV +DTI Q+Q +L+A 
Sbjct: 361 YVVARVLVLGSAYLAAVCLLPEVLRNQFAIPFYFGGTSVLIVVSVTMDTIQQVQSHLLAH 420

Query: 429 QYEGVFKKS--------RSKKK 442
           QYEG+ +KS        RS++K
Sbjct: 421 QYEGLIEKSQLSGKGKKRSRRK 442


>gi|89070533|ref|ZP_01157822.1| preprotein translocase SecY [Oceanicola granulosus HTCC2516]
 gi|89043840|gb|EAR50038.1| preprotein translocase SecY [Oceanicola granulosus HTCC2516]
          Length = 449

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 222/436 (50%), Positives = 308/436 (70%), Gaps = 3/436 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N+++ +F RA +L+ RI+FT+  LIVYR GTYIP+P ID  +     +  +AG+ G+ +
Sbjct: 3   ANMSWGAFGRATELRQRILFTLGLLIVYRLGTYIPVPGIDGGALRTFMEDAAAGLGGILS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+ +     + LKKEGEQGRK +NQYTRY TV
Sbjct: 63  MFTGGALSRMGIFALGIMPYISASIIVQLMGSMYEPWKQLKKEGEQGRKKLNQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           LL   QAYG+AV L+ G  + SD   FF  ST+ITL+GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 LLATFQAYGLAVSLEAGD-LASDPGLFFRASTVITLVGGTMFLMWLGEQITARGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P++L   L  GR G+IS  +++ +    +  +  V+F ERA R++ IQY
Sbjct: 182 LIIFVGIIAEIPAALAQFLSQGRAGAISPAVIIGVLLMVIVTLTFVVFMERALRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFAS+LLLLP TI  F    + P  +  ++ 
Sbjct: 242 PRRQVGMKVYDGGSSHLPIKVNPAGVIPAIFASALLLLPTTISTFSGGDTGPV-MSTMLA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIV-FNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ ++  IVFF FFYT  V F   + A+NLK   GF+PGIRPG RTA ++D
Sbjct: 301 YFGPGQPLYLLFFAAMIVFFTFFYTKEVSFKVDDVAENLKNQNGFVPGIRPGKRTAEYLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+TR+ V+G+GYL  V + PE L +   +P    GTS+LIIVSV +DTI Q+Q +L+A 
Sbjct: 361 YVVTRLLVLGSGYLALVALLPEILRSQMAIPFYFGGTSILIIVSVGMDTIQQVQSHLLAH 420

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ +KS+ + + S
Sbjct: 421 QYEGLIEKSQLRGRRS 436


>gi|92112574|ref|YP_572502.1| preprotein translocase subunit SecY [Chromohalobacter salexigens
           DSM 3043]
 gi|91795664|gb|ABE57803.1| protein translocase subunit secY/sec61 alpha [Chromohalobacter
           salexigens DSM 3043]
          Length = 443

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 220/431 (51%), Positives = 301/431 (69%), Gaps = 2/431 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           AS S   +L +R+ F  IA++VYR G +IP+P I+    +  F+     I G+FNMFSGG
Sbjct: 9   ASGSGLSELWARLRFVFIAIVVYRIGAHIPVPGINPDQLAALFRENQGTILGMFNMFSGG 68

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ RM++F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ INQYTRY TV+L ++
Sbjct: 69  ALSRMSIFALGIMPYISASIIMQLLTAVSPQLEQLKKEGEAGRRKINQYTRYGTVVLALI 128

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           QA G+AVGL  GQG+    D  F F+ I+T + G +FL+WLGEQIT +GIGNG+SLIIF+
Sbjct: 129 QATGMAVGLV-GQGVAYSGDLSFYFTAIVTFVAGAVFLMWLGEQITEKGIGNGISLIIFA 187

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSST-VAVIALVIFFERAQRRLLIQYPKRQ 253
           GIVAGLPS++     L R       L LL  +   +A +A V+F ER QRR+ + YP+RQ
Sbjct: 188 GIVAGLPSAIGQSFTLARNDGAWNILPLLALAVLGIATVAFVVFIERGQRRITVNYPRRQ 247

Query: 254 VGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGH 313
           VGN+M+    SYLPLK+N AGV+P IFASS+LL PA+I  ++    +  W+  +  ++G 
Sbjct: 248 VGNKMYAGQSSYLPLKVNMAGVIPPIFASSILLFPASIGQWVGEGQNMAWLQTVSQAMGP 307

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G+  Y++L++  ++FF FFYTA+VFNPK+ ADNLKK G F+PGIRPG++TA ++D V+TR
Sbjct: 308 GQPLYILLFAAAVLFFCFFYTALVFNPKDVADNLKKSGAFLPGIRPGEQTARYVDKVMTR 367

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV 433
           +T+ GA Y+  V + P+ L+    VP    GTSLLI+V VV+D + Q+Q +L++ QYE V
Sbjct: 368 LTLFGALYITAVSLMPQFLVVAWQVPFYFGGTSLLIVVVVVMDFMAQVQSHLMSNQYESV 427

Query: 434 FKKSRSKKKNS 444
            KKS  K   S
Sbjct: 428 MKKSNLKGYGS 438


>gi|254461313|ref|ZP_05074729.1| preprotein translocase, SecY subunit [Rhodobacterales bacterium
           HTCC2083]
 gi|206677902|gb|EDZ42389.1| preprotein translocase, SecY subunit [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 447

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/435 (50%), Positives = 313/435 (71%), Gaps = 3/435 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++A+  +A DL++RI+FT+  LIVYR GT+IP+P ID  +  +  +S   GI G+ +
Sbjct: 3   ANTSWAALGKATDLRNRILFTLGLLIVYRLGTFIPVPGIDGAALREFMESAGQGIGGMVS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP LE LKKEG+QG+K INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPQLEQLKKEGQQGQKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L  +QAYG+AV L+ G G+V++   +F  + +ITL+GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 ALATMQAYGLAVSLEAG-GLVTEGGLYFRAACLITLVGGTMFLMWLGEQITARGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P++L      GR G+IS  +++ +    V  IA V+F ERA R++ IQY
Sbjct: 182 LIIFVGIIAEVPAALAQFFASGRSGAISPAVIVGVILMVVVTIAFVVFMERALRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG R+ +   S+LP+K+N AGV+P+IFASSLLLLPATI  F   S+ P  +  L+ 
Sbjct: 242 PRRQVGMRVQEGSSSHLPVKVNPAGVIPAIFASSLLLLPATISTFSGNSTGPV-MSTLLA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ ++  IVFF FFYT  + F   + ADNLK   GF+PG+RPG +TA +++
Sbjct: 301 YFGPGQPLYLLFFAAMIVFFTFFYTFNVSFKVDDVADNLKNQNGFVPGVRPGKKTAEYLE 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           +V++R+ V+G+ YL  VC+ PE +     +P    GTS+LI+VSV +DTI Q+Q +L+A 
Sbjct: 361 FVVSRLLVLGSAYLTLVCLLPEIIRGQFAIPFYFGGTSVLIVVSVTMDTIQQVQSHLLAH 420

Query: 429 QYEGVFKKSRSKKKN 443
           QYEG+ +KS+ + K+
Sbjct: 421 QYEGLIQKSQLRGKS 435


>gi|152980370|ref|YP_001355081.1| preprotein translocase SecY subunit [Janthinobacterium sp.
           Marseille]
 gi|151280447|gb|ABR88857.1| preprotein translocase SecY subunit [Janthinobacterium sp.
           Marseille]
          Length = 443

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 222/419 (52%), Positives = 293/419 (69%), Gaps = 4/419 (0%)

Query: 26  RIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLG 85
           R+ F + AL+V+R G +IP+P ID    ++ F+    GI G+FNMFSGGA+ R  +F+LG
Sbjct: 19  RLWFLLGALVVFRIGAHIPVPGIDPEQLAQLFKQNQGGILGMFNMFSGGALSRFTIFALG 78

Query: 86  IMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKN 145
           IMPYISASII+QL++   P LE LKKEGE GR+ I QYTRY T+LL   Q  GIAV L++
Sbjct: 79  IMPYISASIIMQLMSVVSPQLEALKKEGESGRRKITQYTRYGTLLLATFQGLGIAVALES 138

Query: 146 GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLV 205
             G+V D    F  +T+ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLPS++ 
Sbjct: 139 QIGLVIDPGMAFRLTTVITLVTGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLPSAVA 198

Query: 206 SVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSY 265
            + EL R GS++    +LI     AV  LV+F ER QR++L+ Y KRQVGN+++    S+
Sbjct: 199 GLFELVRTGSMNALSAILICVVVAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSH 258

Query: 266 LPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVG----LVDSLGHGRSFYMVL 321
           LPLKLN AGV+P IFASS++L PATI  +     + +  VG    L  S+  G   + +L
Sbjct: 259 LPLKLNMAGVIPPIFASSIILFPATITSWFTSGETTSKFVGFLKDLAASMAPGEPIHALL 318

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+  IVFF FFYTA+VFN KE ADNLKK G F+PGIRPGD+TA +ID +LTR+T+ GA Y
Sbjct: 319 YAAAIVFFCFFYTALVFNSKETADNLKKSGAFVPGIRPGDQTARYIDKILTRLTLAGAVY 378

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE LIA   VP    GTSLLIIV V +D + Q+Q Y+++QQYE + +K+  K
Sbjct: 379 ITLVCLLPEFLIARWKVPFYFGGTSLLIIVVVTMDFMAQVQNYVMSQQYESLLRKANFK 437


>gi|82701920|ref|YP_411486.1| preprotein translocase subunit SecY [Nitrosospira multiformis ATCC
           25196]
 gi|82409985|gb|ABB74094.1| protein translocase subunit secY/sec61 alpha [Nitrosospira
           multiformis ATCC 25196]
          Length = 442

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/419 (51%), Positives = 298/419 (71%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R+ F ++AL+VYR G ++P+P ID +     F+S+  GI G+FNMFSGGA+ R ++
Sbjct: 16  DLKRRLWFLLLALVVYRIGAHVPVPGIDPVVLKDLFESQQGGILGMFNMFSGGALSRFSI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL     P LE LKKEGE GR+ I QYTRY T+ L ++Q YGI++
Sbjct: 76  FALGIMPYISASIIMQLGTVAFPYLEALKKEGESGRRKITQYTRYGTLGLALVQGYGISI 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G+V +    F+ +T+ITL+ GT+FL+WLGEQIT RGIGNG+SLIIF+GI AGLP
Sbjct: 136 ALQSQPGLVIEPGPMFLLTTVITLVTGTIFLMWLGEQITERGIGNGISLIIFAGIAAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++   LEL R G++   + L IF +   V   V+F ER QR++L+ Y KRQVG +++  
Sbjct: 196 SAIGGTLELVRTGAMHFLVALGIFVAATVVTGFVVFVERGQRKILVNYAKRQVGRKVYGG 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN +GV+P IFASS++L PAT+ G+     S  W+  +  +L  G+  Y+++
Sbjct: 256 QSSHLPLKLNMSGVIPPIFASSIILFPATLAGWFSTGESMDWLKDISGALSPGQPVYVIM 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+  I+FF FFYTA+VFNPKE A+NLKK G FIPGIRPGD+TA +I+ ++ R+T+ GA Y
Sbjct: 316 YAAMIIFFCFFYTALVFNPKETAENLKKSGAFIPGIRPGDQTARYIERIMLRLTLTGAIY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q Y+++ QYE + KK+  K
Sbjct: 376 VTLVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMAQVQAYIMSHQYESLLKKTNFK 434


>gi|254281598|ref|ZP_04956566.1| preprotein translocase, SecY subunit [gamma proteobacterium
           NOR51-B]
 gi|219677801|gb|EED34150.1| preprotein translocase, SecY subunit [gamma proteobacterium
           NOR51-B]
          Length = 441

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/417 (51%), Positives = 300/417 (71%), Gaps = 1/417 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +ALIVYR GT+IP+P ID    S  F      I GL N+FSGGA+ERM++
Sbjct: 15  ELFARLRFVFVALIVYRIGTHIPVPGIDPEQLSALFDQNQGTILGLANVFSGGALERMSI 74

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGI+PYISASII+QL+ A  PSLE LKKEGE GR+ I+Q TRY TVLL ++Q  G+ V
Sbjct: 75  LALGILPYISASIIMQLMTAVTPSLEQLKKEGESGRRKISQMTRYLTVLLALVQGTGMTV 134

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QG+  D+   F    I +L+ G +F++WLGEQIT +GIGNG+SL+IF+GIVAGLP
Sbjct: 135 GLAN-QGLTFDTSITFYVIAITSLVTGAVFMMWLGEQITEKGIGNGISLLIFAGIVAGLP 193

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++   +E  R G ++  ++L I +  +AVI LV+F ER QRRL + Y KRQ GN+ +Q 
Sbjct: 194 AAIGQSMEQARQGELNILVLLAIVALAIAVIYLVVFIERGQRRLTVNYAKRQQGNKQYQA 253

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   + +  W+  L  ++G G+   ++L
Sbjct: 254 QSSHLPLKVNMAGVIPAIFASSILLFPASVAQWFGSADNADWLQDLAVAIGPGQPLNIIL 313

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++ FI+FF FFYTA++FNP+E ADNLK+ G F+PGIRPG +TA +ID VLTR+TV G+ Y
Sbjct: 314 FTGFIIFFCFFYTALMFNPQEVADNLKRSGAFVPGIRPGKQTANYIDGVLTRLTVFGSAY 373

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           +  VC+ P+ L+ +  VP  L GTS+LI+V VV+D + Q+Q +L++ QYEGV KK+ 
Sbjct: 374 IALVCLLPQFLVVMFNVPFYLGGTSMLIVVVVVMDFMAQVQSHLMSHQYEGVMKKAN 430


>gi|259416875|ref|ZP_05740795.1| preprotein translocase, SecY subunit [Silicibacter sp. TrichCH4B]
 gi|259348314|gb|EEW60091.1| preprotein translocase, SecY subunit [Silicibacter sp. TrichCH4B]
          Length = 454

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 231/445 (51%), Positives = 316/445 (71%), Gaps = 2/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++A+  +A DL++RI+FTI  LIVYR GT+IP+P ID  +  +   + 
Sbjct: 1   MVSAAEQMAANTSWAALGKATDLRNRILFTIGLLIVYRLGTWIPVPGIDADALRQFMDTA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VP+LE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPALEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYG+A  L+ G  +  D   +F  S +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVVLATAQAYGLAASLEAGD-MAFDPGLYFRLSCMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++      GR G+IS  +++ +    VAVI  V+F ER
Sbjct: 180 NRGIGNGISLIIFVGIIAEIPAAIAQFFASGRSGAISPAVIIAVIVMVVAVIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F   S+S
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPTTISTFSQGSAS 299

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+ + G G+  Y++ ++  IVFFA+FYT  + F P E A NLK   GF+PGIRP
Sbjct: 300 SPVMSWLLANFGPGQPLYLLFFTGMIVFFAYFYTFNVSFKPDEVAQNLKNQNGFVPGIRP 359

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G +TA +I+YV+ R+ V+G+ YL  VC+ PE L     +PV   GTS+LI+VSV +DTI 
Sbjct: 360 GKKTAEYIEYVVNRILVLGSAYLALVCLLPEILRNNFAIPVYFGGTSVLIVVSVTMDTIQ 419

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           Q+Q +L+A QYEG+ +KS+ + +N 
Sbjct: 420 QVQSHLLAHQYEGLIEKSQLRGRNK 444


>gi|254516931|ref|ZP_05128989.1| preprotein translocase, SecY subunit [gamma proteobacterium NOR5-3]
 gi|219674436|gb|EED30804.1| preprotein translocase, SecY subunit [gamma proteobacterium NOR5-3]
          Length = 440

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 219/423 (51%), Positives = 303/423 (71%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F ++A+IVYR GT+IP+P ID    +  F      I GL NMFSGGA+ERM++
Sbjct: 14  ELFARLRFVLVAIIVYRIGTHIPVPGIDPNQLAALFNQNQGTILGLANMFSGGALERMSI 73

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL++A  P LE LKKEGE GR+ I+QYTRY TV+L I+QA G+ V
Sbjct: 74  LALGIMPYISASIIMQLMSAVTPQLEQLKKEGESGRRKISQYTRYLTVVLAIVQATGMTV 133

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           G+ N QG+  +S   F    I +L+ G +F++WLGEQIT +G+GNG+SL+IF+GIVAGLP
Sbjct: 134 GMAN-QGMSYNSGLLFFIIAITSLVTGAVFMMWLGEQITEKGVGNGISLLIFAGIVAGLP 192

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++   LE  R G I+   +LLI S  +AVI +++F ER QRR+ + Y KRQ G +M+Q 
Sbjct: 193 SAIGQSLEQARQGEINILALLLILSLAIAVIYMIVFIERGQRRITVNYAKRQQGRKMYQA 252

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA+I  +   S    W+  L  ++G G+   ++L
Sbjct: 253 QSSHLPLKVNMAGVIPAIFASSILLFPASIAQWFGQSGGADWLQDLAVAIGPGQPLNILL 312

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++FIVFF FFYTA++FNP+E ADNLKK G F+PGIRPG +TA +ID VLTR+TV G+ Y
Sbjct: 313 FTIFIVFFCFFYTALMFNPQEVADNLKKSGAFVPGIRPGQQTANYIDGVLTRLTVFGSAY 372

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q ++++ QY+ V KK+  K 
Sbjct: 373 IALVCLLPQFLVVTWNVPFYLGGTSLLIVVVVVMDFMAQVQSHMMSHQYDSVMKKANLKN 432

Query: 442 KNS 444
             S
Sbjct: 433 YGS 435


>gi|88704355|ref|ZP_01102069.1| preprotein translocase, SecY subunit [Congregibacter litoralis
           KT71]
 gi|88701406|gb|EAQ98511.1| preprotein translocase, SecY subunit [Congregibacter litoralis
           KT71]
          Length = 440

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/423 (51%), Positives = 303/423 (71%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F ++A+IVYR GT+IP+P ID    +  F      I GL NMFSGGA+ERM++
Sbjct: 14  ELFARLRFVLVAIIVYRIGTHIPVPGIDPNQLAALFNQNQGTILGLANMFSGGALERMSI 73

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL++A  P LE LKKEGE GR+ I+QYTRY TV+L I+QA G+ V
Sbjct: 74  LALGIMPYISASIIMQLMSAVTPQLEQLKKEGEAGRRKISQYTRYLTVVLAIVQATGMTV 133

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           G+ N QG+  +S   F    I +L+ G +F++WLGEQIT +G+GNG+SL+IF+GIVAGLP
Sbjct: 134 GMAN-QGMSYNSGLLFFIIAITSLVTGAVFMMWLGEQITEKGVGNGISLLIFAGIVAGLP 192

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++   LE  R G I+   +LLI +  +AVI +++F ER QRR+ + Y KRQ G +M+Q 
Sbjct: 193 SAIGQSLEQARQGEINILALLLILTLAIAVIYMIVFIERGQRRITVNYAKRQQGRKMYQA 252

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA+I  +   S    W+  L  ++G G+   ++L
Sbjct: 253 QSSHLPLKVNMAGVIPAIFASSILLFPASIAQWFGQSGGADWLQDLAVAIGPGQPLNILL 312

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++FIVFF FFYTA++FNP+E ADNLKK G F+PGIRPG +TA +ID VLTR+TV G+ Y
Sbjct: 313 FTIFIVFFCFFYTALMFNPQEVADNLKKSGAFVPGIRPGQQTANYIDGVLTRLTVFGSAY 372

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q ++++ QY+ V KK+  K 
Sbjct: 373 IALVCLLPQFLVVTWNVPFYLGGTSLLIVVVVVMDFMAQVQSHMMSHQYDSVMKKANLKN 432

Query: 442 KNS 444
             S
Sbjct: 433 YGS 435


>gi|254439610|ref|ZP_05053104.1| preprotein translocase, SecY subunit [Octadecabacter antarcticus
           307]
 gi|198255056|gb|EDY79370.1| preprotein translocase, SecY subunit [Octadecabacter antarcticus
           307]
          Length = 452

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 316/444 (71%), Gaps = 3/444 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N ++++F +AK+L+ RI+FT+  L+VYR GTYIP+P ID           
Sbjct: 1   MASAAEQMAANTSWSAFGQAKELRQRILFTLGLLVVYRIGTYIPVPGIDSDQLRSFMDEA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           +AGI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ A    L+NLKKEG+ GRK +
Sbjct: 61  AAGIGGILSMFTGGALARMGIFALGIMPYISASIIVQLLGAMWEPLKNLKKEGDAGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYG+A GL+ G G+V+D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVVLATFQAYGMASGLEAG-GLVTDPGLYFKIACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P++L   L  G+  + +  L+L +F+  + ++A V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEVPAALAGFLAQGQETN-NWGLVLGVFAMVIVILAFVVFMER 238

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           + R++ IQYP+RQVG ++F    S+LP+K+N AGV+P+IFAS+LLLLP T+  F    ++
Sbjct: 239 SLRKIHIQYPRRQVGMKVFDGGSSHLPIKVNPAGVIPAIFASALLLLPTTLSTFSGGETA 298

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+   G G+  Y++ ++  IVFF FFYT  + F   E ADNLK   GF+PGIRP
Sbjct: 299 GPVMSTLLAYFGPGQPLYLLFFTAMIVFFTFFYTREVAFKTDEVADNLKNQNGFVPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G RT  ++DYV+TR+ V+G+GYL  VC+ PE L +   +P    GTS+LIIVSV +DTI 
Sbjct: 359 GKRTQEYLDYVVTRILVLGSGYLALVCLLPEILRSQFSIPFYFGGTSVLIIVSVGMDTIQ 418

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKN 443
           QIQ +L+A QYEG+ +KS+ + K 
Sbjct: 419 QIQSHLLAHQYEGLIEKSQLRGKR 442


>gi|311693291|gb|ADP96164.1| SecY protein [marine bacterium HP15]
          Length = 440

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/419 (51%), Positives = 296/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+SR+ F  +AL+VYR G +IP+P I+    +  F+     I  +FNMFSGGA+ERM++
Sbjct: 17  ELRSRLWFVFLALLVYRIGAHIPVPGINPDRLAALFEQNQGTILSMFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++Q +GI+V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQGFGISV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+  +  + F F  +++ + G +F++WLGEQIT RG+GNG+SL+IF+GIVAGLP
Sbjct: 137 GLAS-QGVTFNDSFSFHFVAVVSFVSGAVFMMWLGEQITERGVGNGISLLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++   LE  R G +S  ++L I    VAVI  V+F ER QRRL I Y KRQ G R+F  
Sbjct: 196 GAIGQTLEQARNGEMSLLVVLGIGVLAVAVIGFVVFMERGQRRLTINYAKRQQGRRVFAQ 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA++  +        W+  +  +L   +  Y++L
Sbjct: 256 QSSHLPLKVNMAGVIPPIFASSILLFPASLGQWFGQGEGMEWLSDVSQALAPSQPLYIIL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++  +VFF FFYTA+++NPKE ADNLK+ G FIPGIRPGD+TA +ID VLTR+T+ GA Y
Sbjct: 316 FAAAVVFFCFFYTALMYNPKEVADNLKRSGAFIPGIRPGDQTAKYIDGVLTRLTLFGAMY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  V +FP+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KKS  K
Sbjct: 376 IAAVSLFPQFLMVAGNVPFYLGGTSLLIVVVVVMDFMAQVQSHLMSHQYESLMKKSNLK 434


>gi|149202864|ref|ZP_01879835.1| protein translocase subunit SecY [Roseovarius sp. TM1035]
 gi|149143410|gb|EDM31446.1| protein translocase subunit SecY [Roseovarius sp. TM1035]
          Length = 447

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 319/442 (72%), Gaps = 11/442 (2%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N ++++  +A +L+ RI+FT+  LIVYR GT+IP+P ID ++  +  +   A I G+ +
Sbjct: 3   ANTSWSALGKATELRKRILFTLGLLIVYRLGTFIPVPGIDGVALREFMEGAQASIGGMLS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM +F+LGIMPYISASIIVQL+ A VP+LE LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGIFALGIMPYISASIIVQLMTAMVPALEQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L  LQ+YG+AV L++G  +VS+   FF+ S +ITL+GGTMFL+WLGEQIT RG+GNG+S
Sbjct: 123 ALATLQSYGLAVSLQSGD-MVSNPGMFFIASCMITLIGGTMFLMWLGEQITARGVGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P++L      GR G++S  +++ +    VAVIA V+F ER+ R++ IQY
Sbjct: 182 LIIFVGIIAEVPAALAQFFASGRSGAVSPAVIVGVMLMVVAVIAFVVFMERSLRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLPATI  F   +++P  +  ++ 
Sbjct: 242 PRRQVGMKIYDGGSSHLPVKVNPAGVIPAIFASSLLLLPATITTFSGNTTNPV-LSTVMA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ +++ IVFFA+FYT  + F   + A+NLK   GFIPGIRPG RTA ++D
Sbjct: 301 YFGPGQPLYLLFFTIMIVFFAYFYTFNVAFKTDDVAENLKNQNGFIPGIRPGKRTAEYLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           +V+ RV V+G+ YL  VC+ PE L     +P    GTS+LI+VSV +DTI Q+Q +L+A 
Sbjct: 361 FVVNRVLVIGSAYLAAVCLLPEILRNQFAIPFYFGGTSVLIVVSVTMDTIQQVQSHLLAH 420

Query: 429 QYEGVFKKS--------RSKKK 442
           QYEG+ +KS        RS++K
Sbjct: 421 QYEGLIEKSQLSGKGKKRSRRK 442


>gi|255020785|ref|ZP_05292843.1| Preprotein translocase secY subunit [Acidithiobacillus caldus ATCC
           51756]
 gi|254969781|gb|EET27285.1| Preprotein translocase secY subunit [Acidithiobacillus caldus ATCC
           51756]
          Length = 443

 Score =  438 bits (1127), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 216/428 (50%), Positives = 303/428 (70%), Gaps = 4/428 (0%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +  +L++RI+F + AL+V+R G +IP+P ID  + +  F  +   I G+FNMFSGGA+ R
Sbjct: 16  KITELRNRILFLLGALLVFRIGAHIPVPGIDPAAMAAFFNQQRGTILGMFNMFSGGALSR 75

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           + VF+LGIMPYISASII QL  + VP +E LKKEGE GR+ I +YTRYATV+L +LQ  G
Sbjct: 76  LTVFALGIMPYISASIIFQLAGSVVPKIEELKKEGEAGRRKIMEYTRYATVVLSLLQGLG 135

Query: 139 IAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           IAV ++        +V D    F+F+T I+L  GT+FL+W+GEQIT RGIGNG+S+IIF+
Sbjct: 136 IAVAIEKMHAGNLPVVIDPGIGFLFTTTISLAAGTVFLMWIGEQITERGIGNGISMIIFA 195

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVAGLP ++ +  EL R G      +L++F   +AV+A V+F E AQRR+ IQY KRQV
Sbjct: 196 GIVAGLPEAIGTTFELMRTGQYQPLFVLMLFILALAVLAFVVFMESAQRRIPIQYAKRQV 255

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           G +++    +++PLK+N +GV+P IFASS++LLPAT+ G+        W+     +L  G
Sbjct: 256 GRKIYGGQSTHMPLKVNMSGVIPPIFASSIILLPATLSGWFANVPGMEWLARFGQALSPG 315

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
            + Y+V+++V IVFFAFFYTA+VFNP+E ADNLKK G F+PGIRPG++TA ++D VL+R+
Sbjct: 316 STLYVVVFTVAIVFFAFFYTAMVFNPRETADNLKKSGAFVPGIRPGEQTAKYMDRVLSRL 375

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T+ GA YL  VC+ PE LI    VP    GTSLLI+V V++D + QIQ +L+  QYEG+ 
Sbjct: 376 TLWGAIYLTLVCLLPEFLIVHYNVPFYFGGTSLLIVVVVMMDLMAQIQSHLLTHQYEGLL 435

Query: 435 KKSRSKKK 442
           +K+ +  +
Sbjct: 436 RKNPAGPR 443


>gi|89093595|ref|ZP_01166543.1| preprotein translocase, SecY subunit [Oceanospirillum sp. MED92]
 gi|89082285|gb|EAR61509.1| preprotein translocase, SecY subunit [Oceanospirillum sp. MED92]
          Length = 439

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/419 (51%), Positives = 296/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F ++A++VYR G +IP+P I+    +  F      I  LFNMFSGGA+ERM++
Sbjct: 17  ELKSRLLFVLLAIVVYRIGAHIPVPGINPDRLAAMFDQNQGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+    P+L  LKKEGE GR+ INQYTRY TVLL  +Q++G+AV
Sbjct: 77  LALGIMPYISASIIMQLMTVVSPTLAQLKKEGEAGRRKINQYTRYGTVLLATIQSFGMAV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QGI   +D  F F  ++TL+ G +FL+WLGEQ+T RGIGNG+S++IF+GIVAGLP
Sbjct: 137 GLAN-QGIAFSADISFYFVAVVTLVAGAVFLMWLGEQVTERGIGNGISILIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++    E  R G ++   +L I    +A +  V+F ER QRR+ I Y KRQ GNR+F  
Sbjct: 196 SAIGQAFEAARQGDLNILALLAIAVLAIATVGFVVFMERGQRRITINYAKRQQGNRVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA++  +   S    W+  +  +LG G+  Y++L
Sbjct: 256 QSSHLPLKVNMAGVIPPIFASSILLFPASMGQWFGNSEGMDWLQNVALALGPGQPLYILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S+ I+FF +FYTAIVFNPK+ ADNLKK G FIPGIRPG+++A +ID VL R+T+ GA Y
Sbjct: 316 FSIAIIFFCYFYTAIVFNPKDVADNLKKSGAFIPGIRPGEQSARYIDTVLGRLTLFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  V + P+ ++    VP    GTSLLI+V VV+D + Q+Q +L++ QYE + KKS  K
Sbjct: 376 ITAVSLMPQFMVVAANVPFYFGGTSLLIVVVVVMDFMAQVQSHLMSHQYESLMKKSNLK 434


>gi|84515656|ref|ZP_01003017.1| preprotein translocase SecY [Loktanella vestfoldensis SKA53]
 gi|84510098|gb|EAQ06554.1| preprotein translocase SecY [Loktanella vestfoldensis SKA53]
          Length = 446

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/436 (49%), Positives = 313/436 (71%), Gaps = 3/436 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           +N+++++F +A +L+ RI+FTI  L++YR GT+IP+P ID I+  +  +   AGI G+ +
Sbjct: 3   ANVSWSAFGKATELRQRILFTIGLLMIYRLGTFIPVPGIDGIALQQFMEDAQAGIGGILS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RMA+F+LGIMPYISASI++QL+ +    L+NLKKEGE GR+ +NQYTRY TV
Sbjct: 63  MFTGGALSRMAIFTLGIMPYISASIVMQLLGSMWEPLKNLKKEGEAGRRKLNQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           +L   QAYG+AV L+ G G+ SD  +FF  + +IT++GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 VLATAQAYGLAVSLEAG-GLASDPGFFFRAACVITIVGGTMFLMWLGEQITARGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GI+A +P++L   L  GR G+IS  +++ I    + V+  V+F ER+ R++ IQY
Sbjct: 182 LIIFVGIIAEIPAALAQFLSQGRTGAISPFVIIGILLMVIVVLTFVVFMERSLRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P++Q G +++    S+LP+K+N AGV+P+IFAS+LLLLP TI  F   +S P  +  ++ 
Sbjct: 242 PRQQRGMKIYDGSSSHLPIKVNPAGVIPAIFASALLLLPTTISTFSGGTSGPV-MSTILA 300

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ +   IVFF +FYT  + F  ++ A+NLK   GF+PGIRPG RT  ++D
Sbjct: 301 LFGPGQPLYLIFFGGMIVFFTYFYTREVAFKTEDVAENLKNQNGFVPGIRPGKRTEEYLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+TR+ V+G+GYL  V + PE + A   +P    GTS+LIIVSV +DTI Q+Q +L+A 
Sbjct: 361 YVVTRILVLGSGYLALVALLPEIIRAELSIPFYFGGTSVLIIVSVGMDTIQQVQSHLVAH 420

Query: 429 QYEGVFKKSRSKKKNS 444
           QYEG+ +KS+ + K S
Sbjct: 421 QYEGLIEKSQLRGKRS 436


>gi|300309476|ref|YP_003773568.1| preprotein translocase SecY transmembrane protein [Herbaspirillum
           seropedicae SmR1]
 gi|300072261|gb|ADJ61660.1| preprotein translocase SecY transmembrane protein [Herbaspirillum
           seropedicae SmR1]
          Length = 443

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/419 (52%), Positives = 295/419 (70%), Gaps = 4/419 (0%)

Query: 26  RIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLG 85
           R+ F + ALIVYR G +IP+P ID    ++ F+    GI G+FNMFSGGA+ R  +F+LG
Sbjct: 19  RLWFLLGALIVYRIGAHIPVPGIDPTQLAQLFKQNQGGILGMFNMFSGGALSRFTIFALG 78

Query: 86  IMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKN 145
           IMPYISASII+QL++   P LE LKKEGE GR+ I QYTRY T++L   QA GIAV L++
Sbjct: 79  IMPYISASIIMQLLSVVSPQLEALKKEGEAGRRKITQYTRYGTLVLATFQALGIAVALES 138

Query: 146 GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLV 205
             G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLP++L 
Sbjct: 139 QAGLVLDPGLAFRLTTVVTLITGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLPNALG 198

Query: 206 SVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSY 265
            + EL R GS++    +LI      V  LV+F ER QR++L+ Y KRQVGN+++    S+
Sbjct: 199 GLFELVRTGSMNALSAILICVIVALVTFLVVFIERGQRKILVNYAKRQVGNKIYGGQSSH 258

Query: 266 LPLKLNTAGVVPSIFASSLLLLPATIMGFIDV--SSSP--TWIVGLVDSLGHGRSFYMVL 321
           LPLKLN AGV+P IFASS++L PATI  +     +S+P   ++  L  S+  G   + +L
Sbjct: 259 LPLKLNMAGVIPPIFASSIILFPATITSWFTSGDTSNPFIRFLKDLAASMAPGEPIHALL 318

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+V IVFF FFYTA+VFN KE ADNLKK G F+PGIRPGD+TA +ID +L R+T+ GA Y
Sbjct: 319 YAVAIVFFCFFYTALVFNSKETADNLKKSGAFVPGIRPGDQTARYIDKILMRLTLAGAVY 378

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE LIA   VP    GTSLLIIV V +D + Q+Q Y+++QQYE + +K+  K
Sbjct: 379 ITLVCLLPEFLIARWKVPFYFGGTSLLIIVVVTMDFMAQVQNYVMSQQYESLLRKANFK 437


>gi|332107887|gb|EGJ09111.1| preprotein translocase subunit SecY [Rubrivivax benzoatilyticus
           JA2]
          Length = 436

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 308/440 (70%), Gaps = 6/440 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MA++  Q   +  F       DL+ RIVF ++AL+VYR G +IP+P ID     + FQ +
Sbjct: 1   MATSANQLAKSGKFG------DLRRRIVFLLLALVVYRIGAHIPVPGIDPNQLQQLFQGQ 54

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI  LFNMFSGGA+ R  VF+LGIMPYISASII+QL+   VPSLE LKKEGE GR+ I
Sbjct: 55  GGGILNLFNMFSGGALSRFTVFALGIMPYISASIIMQLMTYVVPSLEALKKEGEAGRRKI 114

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
            QYTRY T+ L I Q+ GIA+ L+  QG+V    + F  + +++L+ GTMFL+WLGEQIT
Sbjct: 115 TQYTRYGTLFLAIFQSLGIALALEGSQGLVLSPGFGFRMTAVVSLVAGTMFLMWLGEQIT 174

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RG+GNG+S++IF+GIVAGLPS++  + EL R G++S    L I +  VAV  +V+F ER
Sbjct: 175 ERGLGNGISILIFAGIVAGLPSAIGGLFELVRTGAMSIIASLFICAVVVAVTFVVVFVER 234

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
            QR++L+ Y KRQVGN+++    S+LPLKLN +GV+P IFASS++LLPATI+G+      
Sbjct: 235 GQRKILVNYAKRQVGNKVYGGQSSHLPLKLNMSGVIPPIFASSIILLPATIVGWFATGEG 294

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
             W+  +  +L  G+  Y++LY+  IVFF FFYTA+VFN +E ADNLKK G FIPGIRPG
Sbjct: 295 LRWLKDISAALSPGQPIYVMLYAGMIVFFCFFYTALVFNSRETADNLKKSGAFIPGIRPG 354

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           D+TA +ID +L+R+T+ GA Y+  VC+ PE L+    VP    GTSLLIIV V +D   Q
Sbjct: 355 DQTAKYIDRILSRLTLAGAVYITAVCLLPEFLVLKYNVPFYFGGTSLLIIVVVTMDFWAQ 414

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           +Q Y+++QQYE + KK+  K
Sbjct: 415 VQSYVMSQQYESLLKKANFK 434


>gi|134096301|ref|YP_001101376.1| preprotein translocase membrane subunit [Herminiimonas
           arsenicoxydans]
 gi|133740204|emb|CAL63255.1| Preprotein translocase SecY subunit [Herminiimonas arsenicoxydans]
          Length = 443

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/420 (52%), Positives = 295/420 (70%), Gaps = 4/420 (0%)

Query: 25  SRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSL 84
           +R+ F + ALIV+R G +IP+P I+    ++ F+    GI G+FNMFSGGA+ R  VF+L
Sbjct: 18  NRLWFLLGALIVFRIGAHIPVPGINPDELAQLFKQNQGGILGMFNMFSGGALSRFTVFAL 77

Query: 85  GIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLK 144
           GIMPYISASII+QL++   P +E LKKEGE GR+ I QYTRY T+LL   Q  GIAV L+
Sbjct: 78  GIMPYISASIIMQLMSVVSPQMEALKKEGESGRRKITQYTRYGTLLLATFQGLGIAVALE 137

Query: 145 NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSL 204
           +   +V D    F  +T+ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLPS++
Sbjct: 138 SQANLVIDPGMAFRLTTVITLVTGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLPSAV 197

Query: 205 VSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVS 264
             + EL R GS++    +LI     AV  LV+F ER QR++L+ Y KRQVGN+++    S
Sbjct: 198 AGLFELVRTGSMNALSAILICLVVAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSS 257

Query: 265 YLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV--SSSP--TWIVGLVDSLGHGRSFYMV 320
           +LPLKLN AGV+P IFASS++L PATI  +     ++SP   ++  L  S+  G   + +
Sbjct: 258 HLPLKLNMAGVIPPIFASSIILFPATITSWFTSGETTSPFVRFLKDLAASMAPGEPIHAL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  IVFF FFYTA+VFN KE ADNLKK G F+PGIRPGD+TA +ID +LTR+T+ GA 
Sbjct: 318 LYAAAIVFFCFFYTALVFNSKETADNLKKSGAFVPGIRPGDQTARYIDKILTRLTLAGAV 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ PE LIA   VP    GTSLLIIV V +D + Q+Q Y+++QQYE + +K+  K
Sbjct: 378 YITLVCLLPEFLIARWKVPFYFGGTSLLIIVVVTMDFMAQVQNYVMSQQYESLLRKANFK 437


>gi|149376664|ref|ZP_01894423.1| protein translocase subunit SecY [Marinobacter algicola DG893]
 gi|149359037|gb|EDM47502.1| protein translocase subunit SecY [Marinobacter algicola DG893]
          Length = 440

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 213/419 (50%), Positives = 297/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+SR+ F  +AL+VYR G +IP+P I+    +  F+     I  +FNMFSGGA+ERM++
Sbjct: 17  ELRSRLWFVFLALLVYRIGAHIPVPGINPDRLAALFEQNQGTILSMFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P+LE LKKEGE GR+ I+QYTRY TV+L ++Q +GI+V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPTLEQLKKEGEAGRRKISQYTRYGTVILALVQGFGISV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+  +  + F F  +++ + G +F++WLGEQIT RG+GNG+SL+IF+GIVAGLP
Sbjct: 137 GLAS-QGVTFNDSFSFHFVAVVSFVSGAVFMMWLGEQITERGVGNGISLLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++   LE  R G +S  ++L I    VAVI  V+F ER QRRL I Y KRQ G R+F  
Sbjct: 196 GAIGQTLEQARNGEMSLLVVLGIGILAVAVIGFVVFMERGQRRLTINYAKRQQGRRVFAQ 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA++  +        W+  +  +L   +  Y++L
Sbjct: 256 QSSHLPLKVNMAGVIPPIFASSILLFPASLGQWFGQGEGMEWLSDISQALAPSQPLYIIL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++  +VFF FFYTA+++NPKE ADNLK+ G FIPGIRPGD+TA +ID VLTR+T+ GA Y
Sbjct: 316 FAAAVVFFCFFYTALMYNPKEVADNLKRSGAFIPGIRPGDQTAKYIDGVLTRLTLFGAMY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  V +FP+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QY+ + KKS  K
Sbjct: 376 IAAVSLFPQFLMVAGNVPFYLGGTSLLIVVVVVMDFMAQVQSHLMSHQYDSLMKKSNLK 434


>gi|30248438|ref|NP_840508.1| preprotein translocase subunit SecY [Nitrosomonas europaea ATCC
           19718]
 gi|30138324|emb|CAD84332.1| SecY protein [Nitrosomonas europaea ATCC 19718]
          Length = 441

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 225/436 (51%), Positives = 301/436 (69%)

Query: 9   VSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLF 68
           VS    A   R  DLK R  F ++ALIVYR G + P+P ID +     F S+  GI G+F
Sbjct: 2   VSKSKAALTDRFYDLKKRFWFLVLALIVYRIGAHAPVPGIDPVVLKDLFDSQEGGILGMF 61

Query: 69  NMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYAT 128
           NMFSGGA+ R ++F+LGIMPYISASII+QL    VP LE+LKKEGE GRK I QYTRY T
Sbjct: 62  NMFSGGALSRFSIFALGIMPYISASIIMQLGTVAVPYLESLKKEGESGRKKITQYTRYGT 121

Query: 129 VLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           + L  LQ+YGI++ L++  G+V    ++FV +T+ITL+ GTMFL+WLGEQIT RGIGNG+
Sbjct: 122 LFLSTLQSYGISIALQSQPGLVIQPGFYFVVTTVITLVTGTMFLMWLGEQITERGIGNGI 181

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GI AGLPS++   LEL   G++     L IF + +A+   V+F ER QR++L+ 
Sbjct: 182 SLIIFAGIAAGLPSAIGGTLELVNTGAMHFLTALFIFVAAIAITYFVVFIERGQRKILVN 241

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KRQVG ++     S+LPLKLN +GV+P IFASS++L PAT+ G+   S S  W+    
Sbjct: 242 YAKRQVGKQVMGGQSSHLPLKLNMSGVIPPIFASSIILFPATLAGWFSDSLSLDWLKDFS 301

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
            +L  G+  Y+ LY+  I+FF FFYTA+VFNPKE ADNLKK G FIPGIRPGD+T  +I+
Sbjct: 302 SALTPGQPIYVALYAALIIFFCFFYTALVFNPKETADNLKKSGAFIPGIRPGDQTTRYIE 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            ++ R+T++G+ Y+  VC+ PE +I    VP    GTSLLIIV V +D + Q+Q ++++ 
Sbjct: 362 RIMLRLTLIGSIYVTLVCLLPEFMILKWNVPFYFGGTSLLIIVVVTMDFMAQVQSHVMSG 421

Query: 429 QYEGVFKKSRSKKKNS 444
           QYE + KK+  K   S
Sbjct: 422 QYESLLKKANFKAGGS 437


>gi|163859251|ref|YP_001633549.1| preprotein translocase subunit SecY [Bordetella petrii DSM 12804]
 gi|163262979|emb|CAP45282.1| secY [Bordetella petrii]
          Length = 442

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 307/423 (72%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           +R  DLK R+VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ 
Sbjct: 12  ARYGDLKRRLVFLVLALVVYRLGTHIPVPGINPDALADLFRQNQGGILGLFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL++  VPSLE LKKEGE GR+ I QYTRY TV+L ++QA 
Sbjct: 72  RFSIFALGIMPYISASIIMQLMSVVVPSLEALKKEGEAGRRKITQYTRYGTVVLALVQAV 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI+V L++  G+V D    F F+T++TLL GTMF++WLGEQIT RG+GNG+S++IF+GIV
Sbjct: 132 GISVALESQPGLVIDPGMLFRFTTVVTLLTGTMFIMWLGEQITERGLGNGISILIFAGIV 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLPS+L  +L+L R  ++S P  L I +  V V A V+F ER QR++ + Y KRQVGN+
Sbjct: 192 AGLPSALAGLLDLVRTNAMSVPSALFIVALVVLVTAFVVFVERGQRKITVNYAKRQVGNK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLKLN +GV+P IFASS++L PATI  +    +S  W+  L  +L   +  
Sbjct: 252 IYGGQSSHLPLKLNMSGVIPPIFASSIILFPATITSWFSTGNSMLWLRDLAAALEPRQPL 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ LYS  I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+V
Sbjct: 312 YITLYSAAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDRILMRLTLV 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+
Sbjct: 372 GALYITLVCLLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKA 431

Query: 438 RSK 440
             K
Sbjct: 432 NFK 434


>gi|77165768|ref|YP_344293.1| preprotein translocase subunit SecY [Nitrosococcus oceani ATCC
           19707]
 gi|254433550|ref|ZP_05047058.1| preprotein translocase, SecY subunit [Nitrosococcus oceani AFC27]
 gi|76884082|gb|ABA58763.1| protein translocase subunit secY/sec61 alpha [Nitrosococcus oceani
           ATCC 19707]
 gi|207089883|gb|EDZ67154.1| preprotein translocase, SecY subunit [Nitrosococcus oceani AFC27]
          Length = 453

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/434 (50%), Positives = 304/434 (70%), Gaps = 9/434 (2%)

Query: 16  SFSRAK-----DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNM 70
           SF R+      +L+ R++F I AL+VYR GT+IP+P ID ++ +  F+ +   I  +FNM
Sbjct: 9   SFDRSSSGKLVELRQRLLFVIGALLVYRVGTFIPVPGIDPVTLATLFEQQRGTILDMFNM 68

Query: 71  FSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVL 130
           FSGGA+ER++VF+LGIMPYISASII+QL+ A  P LE L+KEG  GR+ I QYTRY T++
Sbjct: 69  FSGGALERLSVFALGIMPYISASIIMQLLTAVHPKLEQLRKEGASGRRKITQYTRYGTLV 128

Query: 131 LGILQAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGN 186
           L  +QA G+ + L++    G  +V +    F  + +ITL+ G +FL+WLGEQIT RGIGN
Sbjct: 129 LSAIQAVGVTIALESQQVGGASVVIEPGLIFRVTAVITLVTGALFLMWLGEQITERGIGN 188

Query: 187 GVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLL 246
           G+SLIIF+ IVAGLPS+L   LEL R G + T  +L++ +  + V A V+F ERAQRR+L
Sbjct: 189 GISLIIFAAIVAGLPSALGGTLELARTGELHTFTVLVLLTLALLVTAFVVFMERAQRRIL 248

Query: 247 IQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVG 306
           + Y K+Q G ++F   VS+LPLK+N +GV+P IFASS++L PAT+  +   S    W+  
Sbjct: 249 VHYAKQQHGRKVFGGQVSHLPLKINMSGVIPPIFASSIILFPATVSSWFGASEGMGWLRD 308

Query: 307 LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALH 366
           L  +L  G+  Y++LY++ I+FF FFYTA+VFNPKE ADNLKK G FIPGIRPG +T  +
Sbjct: 309 LSATLSPGQPIYVLLYAIAIIFFCFFYTALVFNPKETADNLKKSGAFIPGIRPGVQTTRY 368

Query: 367 IDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLI 426
           ID V+ R+T+ GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D + Q+Q +L+
Sbjct: 369 IDTVMGRLTLGGAIYVTAVCLLPEFLILYWNVPFYFGGTSLLIIVVVVMDFVAQVQAHLM 428

Query: 427 AQQYEGVFKKSRSK 440
           + QYE + KKS+ K
Sbjct: 429 SHQYESLLKKSQLK 442


>gi|292492441|ref|YP_003527880.1| preprotein translocase subunit SecY [Nitrosococcus halophilus Nc4]
 gi|291581036|gb|ADE15493.1| preprotein translocase, SecY subunit [Nitrosococcus halophilus Nc4]
          Length = 453

 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/435 (49%), Positives = 305/435 (70%), Gaps = 4/435 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
            + +  +  +  +L+ R++F + AL+VYR GT+IP+P ID ++ +  F+ +   I  +FN
Sbjct: 8   KSFDQGTLGKLTELRQRLLFVLGALLVYRVGTFIPVPGIDPVTLAALFEQQRGTILDMFN 67

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MFSGGA+ER++VF+LGIMPYISASII+QL+    P LE ++KEG  GR+ I QYTRY T+
Sbjct: 68  MFSGGALERLSVFALGIMPYISASIIMQLLTVVHPKLEQMRKEGASGRRKITQYTRYGTL 127

Query: 130 LLGILQAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIG 185
           +L  +QA G+A+ L++    G  +V ++   F  + ++TL+ GT+FL+WLGEQIT RGIG
Sbjct: 128 VLATIQAIGVAIALESQQVGGASVVIEAGLVFRVTAVVTLVTGTLFLMWLGEQITERGIG 187

Query: 186 NGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRL 245
           NG+SLIIF+ IVAGLPS+L   LEL R G + T  +L++ +  + V A V+F ERAQRR+
Sbjct: 188 NGISLIIFAAIVAGLPSALGGTLELARTGELHTFTVLVLLTLALLVTAFVVFMERAQRRI 247

Query: 246 LIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV 305
            + Y K+Q G R++   VS+LPLK+N +GV+P IFASS++L PAT+  +   S    W+ 
Sbjct: 248 PVHYAKQQHGRRVYGGQVSHLPLKINMSGVIPPIFASSIILFPATVASWFGASEGMGWLR 307

Query: 306 GLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTAL 365
            L  +L  G+  Y++LY+V I+FF FFYTA+VFNPKE ADNLKK G FIPGIRPG +T  
Sbjct: 308 DLSATLSPGQPIYVLLYAVAIIFFCFFYTALVFNPKETADNLKKSGAFIPGIRPGAQTTR 367

Query: 366 HIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYL 425
           +ID V+ R+T+ GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D + Q+Q +L
Sbjct: 368 YIDTVMGRLTLGGAIYVTAVCLLPEFLILYWNVPFYFGGTSLLIIVVVVMDFVAQVQAHL 427

Query: 426 IAQQYEGVFKKSRSK 440
           ++ QYE + KKS+ K
Sbjct: 428 MSHQYESLLKKSQLK 442


>gi|303256470|ref|ZP_07342484.1| preprotein translocase, SecY subunit [Burkholderiales bacterium
           1_1_47]
 gi|331000664|ref|ZP_08324317.1| preprotein translocase, SecY subunit [Parasutterella
           excrementihominis YIT 11859]
 gi|302859961|gb|EFL83038.1| preprotein translocase, SecY subunit [Burkholderiales bacterium
           1_1_47]
 gi|329570876|gb|EGG52587.1| preprotein translocase, SecY subunit [Parasutterella
           excrementihominis YIT 11859]
          Length = 442

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 226/428 (52%), Positives = 304/428 (71%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
            N+   + S+  DL  R++F ++AL+VYR GT+IP+P ID  +  + F  +  GI GLFN
Sbjct: 3   KNIPAKAGSKYGDLYRRLIFLVLALVVYRIGTHIPVPGIDPDTLKELFNQQQGGILGLFN 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MFSGGA+ R +VF+LGIMPYISASII+Q+++  +PSLE+L+KEGE GR+ I QYTRY T+
Sbjct: 63  MFSGGALSRFSVFALGIMPYISASIIMQMLSYVLPSLESLRKEGESGRRKITQYTRYGTL 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           LLG+ QA GIAV L+   G+V D  +FF    +I+L+ GTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 LLGLFQALGIAVALETQPGLVIDPGFFFRSVCVISLVTGTMFLMWLGEQITERGIGNGIS 182

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           +IIF+GIVAGLP+++  + +L   G+I     + I +  + V A V+F ER QRR+ + Y
Sbjct: 183 IIIFAGIVAGLPAAVSGLFQLVSTGAIGPLSAIFIIAIVMLVTAFVVFIERGQRRITVNY 242

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KRQVGNR++    SYLPLK+N A V+P IFASSL+L PAT+  +     S  WI  L  
Sbjct: 243 AKRQVGNRIYGGQSSYLPLKINMANVIPPIFASSLILFPATLASWFTSGDSTRWIRDLAA 302

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
           SL  G+  Y +LY+  IVFFA+FYTA+VFNPKE A+NLKK G F+PGIRPG++T+ +ID 
Sbjct: 303 SLSPGQPLYTLLYAALIVFFAYFYTALVFNPKETAENLKKSGAFVPGIRPGEQTSRYIDK 362

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           VL R+T+ G+ YLV VC+ PE L     VP    GTSLLI+V V +D + Q+Q YL++ Q
Sbjct: 363 VLLRLTLAGSIYLVFVCLVPEFLNLRFNVPFYFGGTSLLIVVVVTMDFMSQVQAYLMSHQ 422

Query: 430 YEGVFKKS 437
           YE + KK+
Sbjct: 423 YESLLKKT 430


>gi|226939206|ref|YP_002794277.1| preprotein translocase subunit SecY [Laribacter hongkongensis
           HLHK9]
 gi|226714130|gb|ACO73268.1| SecY [Laribacter hongkongensis HLHK9]
          Length = 440

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/420 (51%), Positives = 302/420 (71%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK RI+F + ALIVYR G +IP+P I+    +K FQS   G+  +FNMFSGGA+ R  V
Sbjct: 15  DLKRRILFLVGALIVYRIGAHIPVPGINPAELAKLFQSSQTGLLDMFNMFSGGALSRFTV 74

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F++GIMPYISASII+QL +  +P L+ LKKEGEQGR+ I Q+TRYATVLL   Q++GIAV
Sbjct: 75  FAIGIMPYISASIILQLASEVLPQLKQLKKEGEQGRRKITQFTRYATVLLATFQSFGIAV 134

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L    G+V  S + F  +T++TL+ GTMFL+WLGEQIT RGIGNG+S+II +GI AG+P
Sbjct: 135 MLYKQPGLVMTSQFEFYLTTVVTLVTGTMFLMWLGEQITERGIGNGISMIICAGIAAGVP 194

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++   L L   GS+   L++++F   +A+  LV+F ER QR++L+ Y KRQVGNR+ Q 
Sbjct: 195 SAIGKTLTLTSQGSLPILLVIVLFIGVIAMTYLVVFVERGQRKVLVNYAKRQVGNRVMQG 254

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             +++PLKLN AGV+P IFASS++L PAT++G+        W+  + ++L  G+  Y++L
Sbjct: 255 QSTHMPLKLNMAGVIPPIFASSIILFPATVVGWFGDGEGLGWLKSVSNALHPGQPVYVLL 314

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+  I+FF +FYTA+VFNPKE ADNLKK G FIPGIRPG++T+ +I+ ++ R+T++GA Y
Sbjct: 315 YAAAIIFFCYFYTALVFNPKETADNLKKSGAFIPGIRPGEQTSRYIERIILRLTLIGAIY 374

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q YL++ QY+ + KK+  K 
Sbjct: 375 IALVCLVPEFLILKWNVPFYFGGTSLLIIVVVTMDFMAQVQSYLLSHQYDSLLKKANFKN 434


>gi|53803437|ref|YP_114768.1| preprotein translocase subunit SecY [Methylococcus capsulatus str.
           Bath]
 gi|53757198|gb|AAU91489.1| preprotein translocase, SecY subunit [Methylococcus capsulatus str.
           Bath]
          Length = 441

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 220/424 (51%), Positives = 297/424 (70%), Gaps = 4/424 (0%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           R  +L+ R++F + ALIV+R G +IP+P +D  + +  F  + + I  + NMFSGGA++R
Sbjct: 14  RFTELRQRLLFVVGALIVFRIGAHIPIPGVDPKALAAMFNQQGSSILDMVNMFSGGALKR 73

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           +++F+LGIMPYISASII+QL+   VP LE LKKEGE GRK INQYTRYATV+L   QA G
Sbjct: 74  LSIFALGIMPYISASIILQLMTIVVPKLEQLKKEGESGRKKINQYTRYATVVLASFQATG 133

Query: 139 IAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           +A+ L+N    G  IV    + FV  T I+L+ GTMFL+WLGEQ+T RG+GNG+S+IIF+
Sbjct: 134 VAMALQNQSAGGAPIVVSPGFQFVALTAISLVTGTMFLMWLGEQVTERGLGNGISIIIFA 193

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVAGLPS++   LEL R G +    ++ I +  VAV  LV+F E+ QRR+ I Y KRQ 
Sbjct: 194 GIVAGLPSAVGGTLELARTGELGAFSIIGIAAIAVAVTWLVVFVEKGQRRITINYAKRQE 253

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           G RM+    S+LPLKLN +GV+P IFASS++L PAT+ G+   S    W+  +  +L  G
Sbjct: 254 GRRMYAAQKSFLPLKLNMSGVIPPIFASSIILFPATLAGWFGNSEKLIWLQDIASTLSPG 313

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y++ Y+  I+FF FFY A+VFN  E A+NLKK G FIPGIRPG +TA ++D V+TR+
Sbjct: 314 QPLYVLCYAAAIMFFCFFYAALVFNSNETAENLKKSGAFIPGIRPGQQTARYVDTVMTRL 373

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T++G  Y+  VC+ PE LI    VP    GTSLLIIV VV+D + QIQ Y+I+QQYEG+ 
Sbjct: 374 TLIGGIYITAVCLLPEFLIVYWNVPFYFGGTSLLIIVVVVMDFMAQIQTYVISQQYEGLL 433

Query: 435 KKSR 438
           KK+ 
Sbjct: 434 KKTN 437


>gi|300114716|ref|YP_003761291.1| preprotein translocase subunit SecY [Nitrosococcus watsonii C-113]
 gi|299540653|gb|ADJ28970.1| preprotein translocase, SecY subunit [Nitrosococcus watsonii C-113]
          Length = 453

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/423 (51%), Positives = 300/423 (70%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+ R++F I AL+VYR GT+IP+P ID ++ +  F+ +   I  +FNMFSGGA+ER++V
Sbjct: 20  ELRQRLLFVIGALLVYRVGTFIPVPGIDPVTLATLFEQQRGTILDMFNMFSGGALERLSV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE L+KEG  GR+ I QYTRY T++L  +QA G+ +
Sbjct: 80  FALGIMPYISASIIMQLLTAVHPKLEQLRKEGASGRRKITQYTRYGTLVLSTIQAVGVTI 139

Query: 142 GLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
            L++    G  +V +    F  + +ITL+ G +FL+WLGEQIT RGIGNG+SLIIF+ IV
Sbjct: 140 ALESQQVGGASVVIEPGLIFRVTAVITLVTGALFLMWLGEQITERGIGNGISLIIFAAIV 199

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLPS+L   LEL R G + T  +L++ +  + V A V+F ERAQRR+L+ Y K+Q G +
Sbjct: 200 AGLPSALGGTLELARTGELHTFTVLVLLTLALLVTAFVVFMERAQRRILVHYAKQQHGRK 259

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           +F   VS+LPLK+N +GV+P IFASS++L PAT+  +   S    W+  L  +L  G+  
Sbjct: 260 VFGGQVSHLPLKINMSGVIPPIFASSIILFPATVSSWFGASEGMGWLRDLSATLSPGQPI 319

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY++ I+FF FFYTA+VFNPKE ADNLKK G FIPG+RPG +T  +ID V+ R+T+ 
Sbjct: 320 YVLLYAIAIIFFCFFYTALVFNPKETADNLKKSGAFIPGVRPGVQTTRYIDTVMGRLTLG 379

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D + Q+Q +L++ QYE + KKS
Sbjct: 380 GAIYVTAVCLLPEFLILYWNVPFYFGGTSLLIIVVVVMDFVAQVQAHLMSHQYESLLKKS 439

Query: 438 RSK 440
           + K
Sbjct: 440 QLK 442


>gi|120553672|ref|YP_958023.1| preprotein translocase subunit SecY [Marinobacter aquaeolei VT8]
 gi|120323521|gb|ABM17836.1| protein translocase subunit secY/sec61 alpha [Marinobacter
           aquaeolei VT8]
          Length = 440

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/419 (50%), Positives = 295/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+SR+ F  +AL+VYR G +IP+P I+    +  F      I  LFNMFSGGA+ERM++
Sbjct: 17  ELRSRLWFVFLALLVYRIGAHIPVPGINPDRLAALFDQNQGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++Q +GI+V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQGFGISV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+  +  + F F  +++ + G +F++WLGEQIT RGIGNG+SL+IF+GIVAGLP
Sbjct: 137 GLAS-QGVTFNDSFSFHFVAVVSFVCGAVFMMWLGEQITERGIGNGISLLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++   LE  R G +S  ++L I    +AV+  V+F ER QRRL I Y KRQ G R+F  
Sbjct: 196 GAIGQTLEQARNGEMSLLVVLGIGVLAIAVVGFVVFMERGQRRLTINYAKRQQGRRVFAQ 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA++  +        W+  +  +L   +  Y++L
Sbjct: 256 QSSHLPLKVNMAGVIPPIFASSILLFPASLGQWFGQGEGMEWLSDISQALAPSQPLYIIL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++  ++FF +FYTA+++NPKE ADNLK+ G FIPGIRPG++TA +ID VLTR+T+ GA Y
Sbjct: 316 FAAAVIFFCYFYTALMYNPKEVADNLKRSGAFIPGIRPGEQTAKYIDGVLTRLTLFGAMY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  V +FP+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KKS  K
Sbjct: 376 IAAVSLFPQFLMVAGNVPFYLGGTSLLIVVVVVMDFMAQVQSHLMSHQYESLMKKSNLK 434


>gi|146281190|ref|YP_001171343.1| preprotein translocase subunit SecY [Pseudomonas stutzeri A1501]
 gi|145569395|gb|ABP78501.1| secretion protein SecY [Pseudomonas stutzeri A1501]
 gi|327479343|gb|AEA82653.1| preprotein translocase subunit SecY [Pseudomonas stutzeri DSM 4166]
          Length = 442

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 298/423 (70%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    ++ F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFMAIIVYRIGAHIPVPGINPDRLAELFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY T++L I+QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTLVLAIVQAVGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL  GQG+   +D+ F F  I T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLA-GQGVAFSNDFGFYFVAITTFVSGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            +L    E  R G I+   +L +    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 GALGQSFESARQGDINIIALLAVGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S +  W+  +  ++  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGQWFGQSENMGWLADISQAIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QY+ + KK+  K 
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLMSHQYDSLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|124268607|ref|YP_001022611.1| preprotein translocase subunit SecY [Methylibium petroleiphilum
           PM1]
 gi|124261382|gb|ABM96376.1| protein translocase subunit secY/sec61 alpha [Methylibium
           petroleiphilum PM1]
          Length = 436

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/404 (52%), Positives = 284/404 (70%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P ID     + F+ +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGIDPNQLQQLFKDQQGGILSLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   VP+LE LKKEGE GR+ I QYTRY T+ L I Q+ GIA+ L++  G+V      
Sbjct: 91  QLMTYVVPTLEALKKEGEAGRRKITQYTRYGTLGLAIFQSLGIAIALESSAGLVISPGMG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLPS++  + EL R G++
Sbjct: 151 FRLTAVVSLVAGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLPSAIGGLFELVRTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    L I S  +AV  LV+F ER QR++L+ Y KRQVGNR++    S+LPLK+N +GV+
Sbjct: 211 SIVAALFIISIVIAVTYLVVFVERGQRKILVNYAKRQVGNRVYGGQSSHLPLKINMSGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPAT++G+        W+  L   L  G+  Y++LY+  IVFF FFYTA+
Sbjct: 271 PPIFASSIILLPATVVGWFATGDGLRWLKDLAALLSPGQPIYVMLYAAAIVFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPG++TA HID +L R+T+ GA Y+  VC+ PE L+   
Sbjct: 331 VFNSRETADNLKKSGAFIPGIRPGEQTAKHIDRILGRLTLGGAVYITAVCLLPEFLVLKY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLIIV V +D   Q+Q Y+++QQYE + KK+  K
Sbjct: 391 NVPFYFGGTSLLIIVVVTMDFWAQVQSYVMSQQYESLLKKANFK 434


>gi|126666793|ref|ZP_01737770.1| protein translocase subunit SecY [Marinobacter sp. ELB17]
 gi|126628838|gb|EAZ99458.1| protein translocase subunit SecY [Marinobacter sp. ELB17]
          Length = 440

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/419 (50%), Positives = 295/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+SR+ F  +AL+VYR G +IP+P I+    +  F+     I  +FNMFSGGA+ERM++
Sbjct: 17  ELRSRLWFVFLALLVYRIGAHIPVPGINPDRLAVLFEQNQGTILSMFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P+LE LKKEGE GR+ I+QYTRY TV+L +LQ  GI+V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPTLEQLKKEGEAGRRKISQYTRYGTVILALLQGTGISV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+  +    F F  +++ + G +F++WLGEQIT RG+GNG+SL+IF+GIVAGLP
Sbjct: 137 GLAS-QGVTFNDTLSFHFVAVVSFVSGAVFMMWLGEQITERGVGNGISLLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++   LE  R G +S  L+L I    +AVI  V+F ER QRRL I Y KRQ G R+F  
Sbjct: 196 GAIGQTLEQARNGEMSLLLVLGIGVLAIAVIGFVVFMERGQRRLTINYAKRQQGGRVFAQ 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA++  +        W+  +  +L   +  Y++L
Sbjct: 256 QSSHLPLKVNMAGVIPPIFASSILLFPASLGQWFGQGEGMEWLSDISQALAPSQPLYIIL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++  +VFF FFYTA+++NP+E ADNLK+ G FIPGIRPG++TA +ID VLTR+T+ GA Y
Sbjct: 316 FAAAVVFFCFFYTALMYNPREVADNLKRSGAFIPGIRPGEQTAKYIDGVLTRLTLFGAMY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  V +FP+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KKS  K
Sbjct: 376 IAAVSLFPQFLMVAGNVPFYLGGTSLLIVVVVVMDFMAQVQSHLMSHQYESLMKKSNLK 434


>gi|254453583|ref|ZP_05067020.1| preprotein translocase, SecY subunit [Octadecabacter antarcticus
           238]
 gi|198267989|gb|EDY92259.1| preprotein translocase, SecY subunit [Octadecabacter antarcticus
           238]
          Length = 452

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 224/445 (50%), Positives = 315/445 (70%), Gaps = 3/445 (0%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MASA EQ  +N ++++F +AK+L+ RI+F +  L+VYR GTYIP+P ID           
Sbjct: 1   MASAAEQMAANTSWSAFGQAKELRQRILFALGLLVVYRIGTYIPVPGIDSDQLRAFMDEA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
           ++GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ A    L+ LKKEG+ GRK +
Sbjct: 61  ASGIGGILSMFTGGALARMGIFALGIMPYISASIIVQLLGAMWEPLKQLKKEGDAGRKKL 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TV+L   QAYG+A GL+ G G+V+D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVVLATFQAYGMASGLEAG-GLVTDPGLYFKIACVITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P++L   L  G+  + +  L+L +F+  + ++A V+F ER
Sbjct: 180 ARGIGNGISLIIFVGIIAEVPAALAGFLAQGQETN-NWGLVLGVFAMVIVILAFVVFMER 238

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
           + R++ IQYP+RQVG ++F    S+LP+K+N AGV+P+IFAS+LLLLP T+  F    ++
Sbjct: 239 SLRKIHIQYPRRQVGMKVFDGGSSHLPIKVNPAGVIPAIFASALLLLPTTLSTFSGGETA 298

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRP 359
              +  L+   G G+  Y++ ++  IVFF +FYT  + F   E ADNLK   GF+PGIRP
Sbjct: 299 GPVMSTLLAYFGPGQPLYLLFFTGMIVFFTYFYTREVAFKTDEVADNLKNQNGFVPGIRP 358

Query: 360 GDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIV 419
           G RT  ++DYV+TR+ V+G+GYL  VC+ PE L +   +P    GTS+LIIVSV +DTI 
Sbjct: 359 GKRTQEYLDYVVTRILVLGSGYLALVCLLPEILRSQFSIPFYFGGTSVLIIVSVGMDTIQ 418

Query: 420 QIQGYLIAQQYEGVFKKSRSKKKNS 444
           QIQ +L+A QYEG+ +KS+ + K S
Sbjct: 419 QIQSHLLAHQYEGLIEKSQLRGKRS 443


>gi|229592883|ref|YP_002875002.1| preprotein translocase subunit SecY [Pseudomonas fluorescens SBW25]
 gi|312963348|ref|ZP_07777831.1| preprotein translocase SecY subunit [Pseudomonas fluorescens WH6]
 gi|229364749|emb|CAY52731.1| preprotein translocase SecY subunit [Pseudomonas fluorescens SBW25]
 gi|311282428|gb|EFQ61026.1| preprotein translocase SecY subunit [Pseudomonas fluorescens WH6]
          Length = 442

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 296/423 (69%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL  GQG+    D+ F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLA-GQGVAFTGDFGFHFVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S +  W+  L  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGTWFGQSENMGWLQDLSQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTLFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K 
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|119478111|ref|ZP_01618190.1| preprotein translocase, SecY subunit [marine gamma proteobacterium
           HTCC2143]
 gi|119448817|gb|EAW30060.1| preprotein translocase, SecY subunit [marine gamma proteobacterium
           HTCC2143]
          Length = 441

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/419 (50%), Positives = 304/419 (72%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F ++A+I+YR GT+IP+P ++    +  F      + GLFNMFSGGA+ERM++
Sbjct: 16  ELMARLRFVLLAIIIYRIGTHIPVPGMNPDQIAAMFDQSQGTVLGLFNMFSGGALERMSI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL++A  P LE LKKEGE GR+ I+QYTRY TV+L  +Q  G+ V
Sbjct: 76  LALGIMPYISASIIMQLMSAVSPQLEALKKEGEAGRRKISQYTRYLTVVLATVQGTGMVV 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N  G+       F F+ +++L+ G +F++WLGEQ+T RGIGNG+SL+IF+GIVAGLP
Sbjct: 136 GLAN-SGMAYSVGITFYFTAVVSLVTGAVFMMWLGEQVTERGIGNGISLLIFAGIVAGLP 194

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++   +E  R G I+  ++LLI +  VAVI LV+F ER QRR+ + Y KRQ GN++ Q 
Sbjct: 195 SAIGQSIEQARQGEINILILLLILTLAVAVIYLVVFIERGQRRITVNYAKRQQGNKVTQG 254

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LP+K+N AGV+P+IFASSLLL PA+I  +   S    W+  +  ++G G+   ++L
Sbjct: 255 QQSHLPMKVNMAGVIPAIFASSLLLFPASIAQWFGQSEGMEWLQEVSLAIGPGQPLNILL 314

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++ IVFF FFYTA++FNPKE ADNLK+ G F+PGIRPGD+TA +ID V+TR+T+ G+ Y
Sbjct: 315 FTMLIVFFCFFYTALMFNPKEMADNLKRSGAFLPGIRPGDQTANYIDNVMTRLTMFGSLY 374

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ P+ L+ +  VP  L GTSLLI+V VV+D + Q+Q +L++ QYEG+ KK+  K
Sbjct: 375 IAMVCLLPQFLVVMWNVPFYLGGTSLLIVVVVVMDFMSQVQSHLMSHQYEGMMKKANLK 433


>gi|160896491|ref|YP_001562073.1| preprotein translocase subunit SecY [Delftia acidovorans SPH-1]
 gi|160362075|gb|ABX33688.1| preprotein translocase, SecY subunit [Delftia acidovorans SPH-1]
          Length = 439

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 281/404 (69%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGIDPAQLQQLFNGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   VP+ E LKKEGE GR+ I QYTRY T+ L I Q+ GIAV L++  G+V    + 
Sbjct: 91  QLMTYVVPTFEQLKKEGESGRRKITQYTRYGTLGLAIFQSLGIAVALESSAGLVLSPGFG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  GTMFL+WLGEQIT RG+GNG+S++IF GI AGLPSS+  +LEL R G++
Sbjct: 151 FRLTAVVSLTAGTMFLMWLGEQITERGLGNGISILIFGGIAAGLPSSIGGLLELVRTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    + I     AV   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 SILAAIFIVLVVAAVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPAT++ +     S  W+  +  +L  G+  Y++LY+  I+FF FFYTA+
Sbjct: 271 PPIFASSIILLPATVVNWFSAGESMRWLKDIASTLTPGQPIYVMLYATAIIFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPGD+TA +ID +L R+T+ GA Y+  VC+ PE LI   
Sbjct: 331 VFNSRETADNLKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVYITFVCLLPEFLILKY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 391 NVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 434


>gi|120609321|ref|YP_968999.1| preprotein translocase subunit SecY [Acidovorax citrulli AAC00-1]
 gi|120587785|gb|ABM31225.1| protein translocase subunit secY/sec61 alpha [Acidovorax citrulli
           AAC00-1]
          Length = 439

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/406 (52%), Positives = 283/406 (69%)

Query: 35  IVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASI 94
           IVYR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASI
Sbjct: 29  IVYRIGAHIPVPGIDPAQLQQLFSGQHGGILNLFNMFSGGALSRFTVFALGIMPYISASI 88

Query: 95  IVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSD 154
           I+QL+   VP+ E LKKEGE GR+ I QYTRY T+ L I Q+ GIAV L++  G+V    
Sbjct: 89  IMQLMTYVVPTFEQLKKEGEAGRRKITQYTRYGTLGLAIFQSLGIAVALESSAGLVLSPG 148

Query: 155 YFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVG 214
           + F  + +++L  GTMFL+WLGEQIT RG+GNG+S++IFSGI AGLPSS+  +LEL R G
Sbjct: 149 FGFRLTAVVSLTAGTMFLMWLGEQITERGLGNGISILIFSGIAAGLPSSIGGLLELVRTG 208

Query: 215 SISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAG 274
           ++S    + I     AV   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AG
Sbjct: 209 AMSILAAIFIVLLVAAVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAG 268

Query: 275 VVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT 334
           V+P IFASS++LLPATI+ +     S  W+  +  +L  G+  Y++ Y+  IVFF FFYT
Sbjct: 269 VIPPIFASSIILLPATIVNWFSAGESMRWLRDISGALTPGQPVYVMFYAAAIVFFCFFYT 328

Query: 335 AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIA 394
           A+VFN +E ADNLKK G FIPGIRPG++TA +ID +L R+T+ GA Y+  VC+ PE LI 
Sbjct: 329 ALVFNSRETADNLKKSGAFIPGIRPGEQTARYIDKILVRLTLAGAVYITFVCLLPEFLIL 388

Query: 395 VTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
              VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 389 KYNVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 434


>gi|330812055|ref|YP_004356517.1| Putative Sec protein secretion system, subunit SecY [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327380163|gb|AEA71513.1| Putative Sec protein secretion system, subunit SecY [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 428

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 297/423 (70%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 3   ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 62

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL++A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G+++
Sbjct: 63  FALGIMPYISASIIMQLMSAVSPQLEQLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSI 122

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL  GQG+   +D+ F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 123 GLA-GQGVSFTADFSFHFVAVTTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 181

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 182 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 241

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 242 QTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILL 301

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 302 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 361

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K 
Sbjct: 362 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKG 421

Query: 442 KNS 444
             S
Sbjct: 422 YGS 424


>gi|332040533|gb|EGI76909.1| preprotein translocase subunit SecY [Hylemonella gracilis ATCC
           19624]
          Length = 439

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 285/404 (70%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P I+    ++ F+ +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGINPDQLAQLFKGQQGGILSLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   +P+ E LKKEGE GR+ I QYTRYAT+ L + Q+ GIA+ L++  G+V D    
Sbjct: 91  QLLTYVLPTFEQLKKEGEAGRRKITQYTRYATLGLAVFQSLGIAIALESSPGLVIDPGMG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F F+ ++TL  GTMFL+WLGEQIT RG+GNG+S++IF GI AGLP ++  +LEL R GS+
Sbjct: 151 FRFTAVVTLTAGTMFLMWLGEQITERGLGNGISILIFGGIAAGLPGAIGGLLELVRTGSM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    L I +  + V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 SIIAALFIVALVILVTWFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPAT++ +    +S  W+  +  SL  G+  Y+ LY+  I+FF FFYTA+
Sbjct: 271 PPIFASSIILLPATVVSWFSSGNSMLWLKDIAASLAPGQPVYVALYAAAIIFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPGD+TA +ID +L R+T+ GA Y+  VC+ PE LI   
Sbjct: 331 VFNSRETADNLKKGGAFIPGIRPGDQTAKYIDKILLRLTLAGAIYITFVCLLPEFLILEY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLI+V V +D + Q+Q YL++QQYE + KK+  K
Sbjct: 391 NVPFYFGGTSLLILVVVTMDFMAQVQNYLMSQQYESLLKKANFK 434


>gi|77461280|ref|YP_350787.1| preprotein translocase subunit SecY [Pseudomonas fluorescens Pf0-1]
 gi|77385283|gb|ABA76796.1| preprotein translocase SecY subunit [Pseudomonas fluorescens Pf0-1]
          Length = 442

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 295/423 (69%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G+++
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSI 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL  GQG+    D+ F F  + T + G MF++WLGEQIT RG+GNG+S++IFSGIVAGLP
Sbjct: 137 GLA-GQGVAFTGDFGFHFVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFSGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K 
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|70732863|ref|YP_262630.1| preprotein translocase subunit SecY [Pseudomonas fluorescens Pf-5]
 gi|68347162|gb|AAY94768.1| secretion protein SecY PA4243 [Pseudomonas fluorescens Pf-5]
          Length = 442

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 295/423 (69%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL  GQG+    D+ F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLA-GQGVAFTGDFGFHFVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K 
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|329905509|ref|ZP_08274148.1| Preprotein translocase secY subunit [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547577|gb|EGF32378.1| Preprotein translocase secY subunit [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 443

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 220/419 (52%), Positives = 295/419 (70%), Gaps = 4/419 (0%)

Query: 26  RIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLG 85
           R+ F + AL+VYR G +IP+P ID    ++ F+    GI G+FNMFSGGA+ R  VF+LG
Sbjct: 19  RLWFLLGALVVYRLGAHIPVPGIDPQQLAQLFKQNQGGILGMFNMFSGGALSRFTVFALG 78

Query: 86  IMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKN 145
           IMPYISASII+QL++   P LE LKKEGE GR+ I QYTRY T+ L + QA GIAV L++
Sbjct: 79  IMPYISASIIMQLMSIVSPQLEALKKEGESGRRKITQYTRYGTLFLALFQALGIAVALES 138

Query: 146 GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLV 205
             G+V D    F F+ ++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLP++L 
Sbjct: 139 QAGLVLDPGLAFRFTCVVTLVTGTMFLMWLGEQITERGLGNGISIIIFAGIAAGLPTALG 198

Query: 206 SVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSY 265
            + EL R GS+S    + I      V  +V+F ER QR++L+ Y KRQVGN+++    S+
Sbjct: 199 GLFELVRTGSMSAFSAIFICLVVAVVTFVVVFIERGQRKILVNYAKRQVGNKIYGGQSSH 258

Query: 266 LPLKLNTAGVVPSIFASSLLLLPATIMGFIDV--SSSP--TWIVGLVDSLGHGRSFYMVL 321
           LPLKLN AGV+P IFASS++L PATI  +     +S+P   ++  L  S+  G   + +L
Sbjct: 259 LPLKLNMAGVIPPIFASSIILFPATITSWFTAGDTSNPFVRFLKDLSSSMAPGEPIHALL 318

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ IVFF FFYTA+VFN KE ADNLKK G F+PGIRPGD+TA +ID +LTR+T+ GA Y
Sbjct: 319 YAIAIVFFCFFYTALVFNSKETADNLKKSGAFVPGIRPGDQTARYIDKILTRLTLAGAVY 378

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE L+A   VP    GTSLLIIV V +D + Q+Q Y+++QQYE + +K+  K
Sbjct: 379 ITLVCLLPEFLVAKYKVPFYFGGTSLLIIVVVTMDFMAQVQNYVMSQQYESLLRKANFK 437


>gi|262273359|ref|ZP_06051173.1| preprotein translocase SecY subunit [Grimontia hollisae CIP 101886]
 gi|262222337|gb|EEY73648.1| preprotein translocase SecY subunit [Grimontia hollisae CIP 101886]
          Length = 441

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/430 (50%), Positives = 302/430 (70%), Gaps = 5/430 (1%)

Query: 16  SFSRAK----DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMF 71
           +FS AK    +LKSR++F + AL+V+R G+++P+P ID    +  F+ +   I  LFNMF
Sbjct: 8   NFSSAKGGLAELKSRLLFVVGALLVFRAGSFVPIPGIDAAVLADLFEQQQGTIIELFNMF 67

Query: 72  SGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLL 131
           SGGA+ER ++ +LGIMPYISASIIVQL+    P+L  LKKEGE GR+ I+QYTRY T++L
Sbjct: 68  SGGALERASILALGIMPYISASIIVQLLTVVHPALAELKKEGESGRRKISQYTRYGTLVL 127

Query: 132 GILQAYGIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
              QA GIA GL +   G+V +    F F+ +++L+ GTMFL+WLGEQIT RGIGNG+SL
Sbjct: 128 ATFQAIGIATGLPSMIPGLVVNPGLGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISL 187

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           IIF+GIVAGLPS++    E  R G +   L+LLI     AVIA V+F ER QRR+++ Y 
Sbjct: 188 IIFAGIVAGLPSAIGQTAEQARQGELHVLLLLLIAVIAFAVIAFVVFVERGQRRIVVNYA 247

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS 310
           KRQ G R+F    ++LPLKLN AGV+P+IFASS++L P T+  +   S    W+  +  +
Sbjct: 248 KRQQGRRVFAAQSTHLPLKLNMAGVIPAIFASSIILFPGTLAQWFGQSEQLGWLADVSLA 307

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G+  Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V
Sbjct: 308 LSPGQPLYVILYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKV 367

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           +TR+T+ GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY
Sbjct: 368 MTRLTLAGALYITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQY 427

Query: 431 EGVFKKSRSK 440
           E V KK+  K
Sbjct: 428 ESVLKKANLK 437


>gi|33599044|ref|NP_886604.1| preprotein translocase subunit SecY [Bordetella bronchiseptica
           RB50]
 gi|33575090|emb|CAE30553.1| preprotein translocase SecY subunit [Bordetella bronchiseptica
           RB50]
          Length = 441

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 224/423 (52%), Positives = 304/423 (71%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           +R  DLK R+VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ 
Sbjct: 12  ARYGDLKRRLVFLVLALVVYRLGTHIPVPGINPDALADLFRQHEGGILGLFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL++  VPSLE LKKEGE GR+ I QYTRY TV+L ++QA 
Sbjct: 72  RFSIFALGIMPYISASIIMQLMSVVVPSLEALKKEGEAGRRKITQYTRYGTVVLALVQAV 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI+V L++  G+V D    F F+T++TL+ GTMF++WLGEQIT RG+GNG+S++IF+GIV
Sbjct: 132 GISVALESQPGLVIDPGMLFRFTTVVTLVTGTMFVMWLGEQITERGLGNGISILIFAGIV 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLPS+L  +L+L R  S+S    L I +  V V A V+F ER QR++ + Y KRQVGN+
Sbjct: 192 AGLPSALAGLLDLVRTNSMSVLSALFIVALVVLVTAFVVFVERGQRKITVNYAKRQVGNK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLKLN AGV+P IFASS++L PATI  +        W+  L  +L   +  
Sbjct: 252 VYGGQSSHLPLKLNMAGVIPPIFASSIILFPATITSWFSSGERMAWLRDLAAALEPRQPL 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ LYSV I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+ 
Sbjct: 312 YITLYSVAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLA 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+
Sbjct: 372 GAIYITLVCLLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKA 431

Query: 438 RSK 440
             K
Sbjct: 432 NFK 434


>gi|187476568|ref|YP_784592.1| preprotein translocase subunit SecY [Bordetella avium 197N]
 gi|115421154|emb|CAJ47638.1| preprotein translocase SecY subunit [Bordetella avium 197N]
          Length = 441

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 222/423 (52%), Positives = 303/423 (71%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           SR  DLK R+VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ 
Sbjct: 12  SRYGDLKRRLVFLVLALVVYRLGTHIPVPGINPDALADLFRQNQGGILGLFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL++  VPSLE LKKEGE GR+ I QYTRY T++L ++QA 
Sbjct: 72  RFSIFALGIMPYISASIIMQLMSVVVPSLEALKKEGEAGRRKITQYTRYGTLVLALVQAV 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI+V L++  G+V D    F F+T++TL+ GTMF++WLGEQIT RG+GNG+S++IF+GIV
Sbjct: 132 GISVALESQPGLVVDPGMLFRFTTLVTLVTGTMFVMWLGEQITERGLGNGISILIFTGIV 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLPS+L  +L+L R  S+S    L I +  V V A V+F ER QR++ + Y KRQVGN+
Sbjct: 192 AGLPSALAGLLDLVRTNSMSVVSALFILALVVLVTAFVVFVERGQRKITVNYAKRQVGNK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLKLN AGV+P IFASS++L PATI  +        W+  L  +L   +  
Sbjct: 252 VYGGQSSHLPLKLNMAGVIPPIFASSIILFPATITSWFSTGERMVWLRDLAAALEPRQPL 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ LY+  I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+ 
Sbjct: 312 YITLYAAAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLA 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+
Sbjct: 372 GALYITLVCLLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKA 431

Query: 438 RSK 440
             K
Sbjct: 432 NFK 434


>gi|326315410|ref|YP_004233082.1| preprotein translocase subunit SecY [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323372246|gb|ADX44515.1| preprotein translocase, SecY subunit [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 439

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/406 (52%), Positives = 282/406 (69%)

Query: 35  IVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASI 94
           IVYR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASI
Sbjct: 29  IVYRIGAHIPVPGIDPAQLQQLFSGQHGGILNLFNMFSGGALSRFTVFALGIMPYISASI 88

Query: 95  IVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSD 154
           I+QL+   +P+ E LKKEGE GR+ I QYTRY T+ L I Q+ GIAV L++  G+V    
Sbjct: 89  IMQLMTYVLPTFEQLKKEGEAGRRKITQYTRYGTLGLAIFQSLGIAVALESSAGLVLSPG 148

Query: 155 YFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVG 214
           + F  + +++L  GTMFL+WLGEQIT RG+GNG+S++IFSGI AGLPSS+  +LEL R G
Sbjct: 149 FGFRLTAVVSLTAGTMFLMWLGEQITERGLGNGISILIFSGIAAGLPSSIGGLLELVRTG 208

Query: 215 SISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAG 274
           ++S    + I      V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AG
Sbjct: 209 AMSILAAIFIVLLVALVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAG 268

Query: 275 VVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT 334
           V+P IFASS++LLPATI+ +     S  W+  +  +L  G+  Y++ Y+  IVFF FFYT
Sbjct: 269 VIPPIFASSIILLPATIVNWFSAGESMRWLRDISGALTPGQPIYVMFYAAAIVFFCFFYT 328

Query: 335 AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIA 394
           A+VFN +E ADNLKK G FIPGIRPGD+TA +ID +L R+T+ GA Y+  VC+ PE LI 
Sbjct: 329 ALVFNSRETADNLKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVYITFVCLLPEFLIL 388

Query: 395 VTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
              VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 389 KYNVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 434


>gi|89902970|ref|YP_525441.1| preprotein translocase subunit SecY [Rhodoferax ferrireducens T118]
 gi|89347707|gb|ABD71910.1| protein translocase subunit secY/sec61 alpha [Rhodoferax
           ferrireducens T118]
          Length = 436

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 222/440 (50%), Positives = 303/440 (68%), Gaps = 6/440 (1%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           MA+   Q   N  F       DL+ R+VF ++AL+VYR G +IP+P ID +  ++ F+ +
Sbjct: 1   MATNATQLAKNGKFG------DLRRRLVFLLLALVVYRVGAHIPVPGIDPVQLAQFFKGQ 54

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+FNMFSGGA+ R  VF+LGIMPYISASII+QL+   +P+ E LKKEGE GR+ I
Sbjct: 55  QGGILGMFNMFSGGALSRFTVFALGIMPYISASIIMQLLTYVLPAFEQLKKEGEAGRRKI 114

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
            QYTRY T+ L + Q+ GIA+ L++  G+V    + F  + I+TL  GT+FL+WLGEQIT
Sbjct: 115 TQYTRYGTLGLALFQSMGIAIALESSPGLVIAPGFGFRMTAIVTLTSGTLFLMWLGEQIT 174

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RG+GNG+S++IF GI AGLP+++  +LEL R G++S  + L I      V   V+F ER
Sbjct: 175 ERGLGNGISILIFGGIAAGLPNAIGGLLELVRTGAMSIIVALFIVILVALVTYFVVFVER 234

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS 300
            QR++L+ Y +RQVGN+++    S+LPLKLN AGV+P IFASS++LLPAT++G+     S
Sbjct: 235 GQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILLPATVVGWFSAGES 294

Query: 301 PTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPG 360
             W+  +  SL  G+  Y++LY+  I+FF FFYTA+VFN +E ADNLKK G FIPGIRPG
Sbjct: 295 MRWLKDIAGSLTPGQPIYVMLYAAAIIFFCFFYTALVFNSRETADNLKKSGAFIPGIRPG 354

Query: 361 DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQ 420
           D TA +ID +L R+T  GA Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q
Sbjct: 355 DHTAKYIDKILLRLTFAGAIYITMVCLLPEFLILKYNVPFYFGGTSLLIIVVVTMDFMAQ 414

Query: 421 IQGYLIAQQYEGVFKKSRSK 440
           +Q Y+++QQYE + KK+  K
Sbjct: 415 VQNYMMSQQYESLLKKANFK 434


>gi|160872417|ref|ZP_02062549.1| preprotein translocase, SecY subunit [Rickettsiella grylli]
 gi|159121216|gb|EDP46554.1| preprotein translocase, SecY subunit [Rickettsiella grylli]
          Length = 452

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/417 (51%), Positives = 289/417 (69%), Gaps = 1/417 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F ++ALIVYR G +IP+P +D    +  F  +S  I GLFNMFSGGA+ R  V
Sbjct: 24  ELKARLLFVLLALIVYRIGAHIPVPGLDPHRLADLFSHQSNSILGLFNMFSGGALSRFTV 83

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LG++PYIS SIIVQL+ A  P+LE LKKEGE GR+ +NQYTRY T LL  +QA G+A 
Sbjct: 84  FALGLLPYISVSIIVQLLTAVTPALEELKKEGESGRRKLNQYTRYGTALLAFVQAVGMAK 143

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L  G  +V +  +FF F   ITL+ GTMFL+WLGEQIT  GIGNG+SLIIFSGIV+GLP
Sbjct: 144 WLV-GNHVVLNPGFFFYFVATITLVTGTMFLMWLGEQITEHGIGNGISLIIFSGIVSGLP 202

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++   LE  R G +    +L I +  + V A V+F ER QRR+ + YP+RQ G +++  
Sbjct: 203 VAMAKSLEQFRQGQVQFLTLLCILAVILLVTAFVVFMERGQRRITVNYPQRQQGRKIYSA 262

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS++LLP T   +        W+  L   L  G+  Y++L
Sbjct: 263 QTSHLPLKINMAGVIPPIFASSIMLLPGTFANWFANLKGMGWLGKLSFWLSPGQPLYILL 322

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++  I+FF+FFYTA+VFNP+E ADNLKK G FIPGIRPG+++A +ID  +TR+T++G+ Y
Sbjct: 323 FAAAIIFFSFFYTALVFNPRETADNLKKSGAFIPGIRPGEQSARYIDTTMTRLTLIGSLY 382

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           LV V + PE +I    VP    GTSLLIIV V++D + Q+Q  L++ QYE + KK+ 
Sbjct: 383 LVLVALLPEFMIFTWHVPFYFGGTSLLIIVVVIMDFMTQVQSLLMSHQYESLLKKAN 439


>gi|88812737|ref|ZP_01127983.1| preprotein translocase SecY [Nitrococcus mobilis Nb-231]
 gi|88789975|gb|EAR21096.1| preprotein translocase SecY [Nitrococcus mobilis Nb-231]
          Length = 421

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/408 (51%), Positives = 288/408 (70%), Gaps = 1/408 (0%)

Query: 31  IIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYI 90
           ++AL+VYRFG ++ +P ID  + +  F+ +   I  +FNMFSGGA+ R++VF+LG+MPYI
Sbjct: 2   LLALVVYRFGAHLTIPGIDQAALAAMFERQQGTILDMFNMFSGGALRRLSVFALGVMPYI 61

Query: 91  SASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIV 150
           SASII+QL++A VP+LE ++KEGEQGR+ I +YTRY T+LL   Q  GI V L+N Q +V
Sbjct: 62  SASIIMQLMSAVVPALEQMRKEGEQGRRQITKYTRYGTLLLATFQGVGITVALQN-QAVV 120

Query: 151 SDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLEL 210
                 F+F    TL+ GTMFL+WLGEQIT RGIGNG+SL+IF GIVAGLPS+L   +EL
Sbjct: 121 LSPGPSFIFIGTATLVTGTMFLMWLGEQITERGIGNGISLLIFGGIVAGLPSALAGTVEL 180

Query: 211 GRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKL 270
            R G +    +L + +  VAV+ +++F ER QRR+ + Y +RQ G R++    S+LPLKL
Sbjct: 181 ARTGELGVGTILFLLTLAVAVVWVIVFIERGQRRITVNYARRQQGRRLYAAQSSHLPLKL 240

Query: 271 NTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFA 330
           N AGV+P IFASS++L PAT+  +   S   +W+  L  +L  G+  Y+  Y+  I FF 
Sbjct: 241 NMAGVIPPIFASSIILFPATLGQWFGSSEGLSWLNRLGQTLSPGQPLYIAFYAGAIAFFC 300

Query: 331 FFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPE 390
           FFYTA+VFN +E ADNLKK G FI GIRPG++TA +ID V+TR+T+ GA YL+ VC+ PE
Sbjct: 301 FFYTALVFNSRETADNLKKSGAFIAGIRPGEQTARYIDKVMTRLTLAGAIYLIAVCLLPE 360

Query: 391 ALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
            LI    VP    GTSLLIIV V++D + Q+Q +L++ QYE + KK++
Sbjct: 361 FLILYYNVPFYFGGTSLLIIVVVIMDFMSQVQAHLLSHQYEPLMKKAK 408


>gi|330966891|gb|EGH67151.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 444

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/419 (49%), Positives = 294/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    ++ F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAELFRQNEGAILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+    D  F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGVAFSGDLGFHFVAVTTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGLGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|84685398|ref|ZP_01013296.1| preprotein translocase SecY [Maritimibacter alkaliphilus HTCC2654]
 gi|84666555|gb|EAQ13027.1| preprotein translocase SecY [Rhodobacterales bacterium HTCC2654]
          Length = 451

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/435 (51%), Positives = 306/435 (70%), Gaps = 2/435 (0%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           SNL++ +  +A DL+ RI +TI  LI+YR GTYIP+P ID  +     +  +AGI G+ +
Sbjct: 3   SNLSWGALGKATDLRKRIFYTIGLLIIYRIGTYIPVPGIDAGALRDFMEQAAAGIGGILS 62

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MF+GGA+ RM VF+LGIMPYISASIIVQL+A+    L+ LKKEGEQGRK INQYTRY TV
Sbjct: 63  MFTGGALGRMGVFALGIMPYISASIIVQLLASMWEPLKQLKKEGEQGRKKINQYTRYGTV 122

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
            L   QA+ +A  L+ G  +VS    FF+ S ++TL+GGTMFL+WLGEQIT RGIGNG+S
Sbjct: 123 ALATGQAFALANSLQAGD-LVSTPGPFFIASAVVTLVGGTMFLMWLGEQITARGIGNGIS 181

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF GIVA LP++    L  GR G+IS  +++ +    +AVIA V+F ERA R++ IQY
Sbjct: 182 LIIFVGIVAELPAAAAQFLSQGRSGAISPAVIIGVLVMVMAVIAFVVFMERALRKIHIQY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
           P+RQVG +M+    S+LP+K+N AGV+P+IFAS+LLLLP T+  F    ++   +  L+ 
Sbjct: 242 PRRQVGMKMYDGGSSHLPIKVNPAGVIPAIFASALLLLPTTLSTFNQDGNAGPVMSTLLA 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             G G+  Y++ ++  IVFF FFYT  + F  ++ ADNLK   GF+PGIRPG +TA ++D
Sbjct: 302 YFGPGQPLYLLFFTAMIVFFTFFYTKEVAFKTEDVADNLKNQNGFVPGIRPGKKTAEYLD 361

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
           YV+TR+  +G+ YL  VC+ PE L +   VP    GTS+LIIVSV +DTI Q+Q +L+A 
Sbjct: 362 YVVTRILTLGSIYLAAVCLLPEILRSQLAVPFYFGGTSVLIIVSVTMDTIQQVQSHLLAH 421

Query: 429 QYEGVFKKSRSKKKN 443
           QYEG+ +KS+ + K 
Sbjct: 422 QYEGLIEKSQLRGKR 436


>gi|15599439|ref|NP_252933.1| preprotein translocase subunit SecY [Pseudomonas aeruginosa PAO1]
 gi|107103758|ref|ZP_01367676.1| hypothetical protein PaerPA_01004829 [Pseudomonas aeruginosa PACS2]
 gi|116052278|ref|YP_788876.1| preprotein translocase subunit SecY [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152983770|ref|YP_001346243.1| preprotein translocase subunit SecY [Pseudomonas aeruginosa PA7]
 gi|218889429|ref|YP_002438293.1| preprotein translocase subunit SecY [Pseudomonas aeruginosa LESB58]
 gi|296387200|ref|ZP_06876699.1| preprotein translocase subunit SecY [Pseudomonas aeruginosa PAb1]
 gi|313111397|ref|ZP_07797202.1| secretion protein SecY [Pseudomonas aeruginosa 39016]
 gi|81783585|sp|Q9HWF5|SECY_PSEAE RecName: Full=Preprotein translocase subunit secY
 gi|9950460|gb|AAG07631.1|AE004841_9 secretion protein SecY [Pseudomonas aeruginosa PAO1]
 gi|115587499|gb|ABJ13514.1| secretion protein SecY [Pseudomonas aeruginosa UCBPP-PA14]
 gi|150958928|gb|ABR80953.1| secretion protein SecY [Pseudomonas aeruginosa PA7]
 gi|218769652|emb|CAW25412.1| secretion protein SecY [Pseudomonas aeruginosa LESB58]
 gi|310883704|gb|EFQ42298.1| secretion protein SecY [Pseudomonas aeruginosa 39016]
          Length = 442

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 297/423 (70%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAALFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAISPQLEQLKKEGESGRRKISQYTRYGTVVLALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+   +D+ F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLGS-QGVAFSNDFGFYFVAVTTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ +    VA+IA V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALIGVGLLAVAIIAFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  ++  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGLGWLQDVAQAIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++  IVFF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FTAGIVFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K 
Sbjct: 376 MTAVCLLPQFLVVAAHVPFYLGGTSLLIVVVVVMDFMAQVQSHLVSHQYESLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|33594501|ref|NP_882145.1| preprotein translocase subunit SecY [Bordetella pertussis Tohama I]
 gi|33564577|emb|CAE43893.1| preprotein translocase SecY subunit [Bordetella pertussis Tohama I]
          Length = 441

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 223/423 (52%), Positives = 303/423 (71%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           +R  DLK R+VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ 
Sbjct: 12  ARYGDLKRRLVFLVLALVVYRLGTHIPVPGINPDALADLFRQHEGGILGLFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYIS SII+QL++  VPSLE LKKEGE GR+ I QYTRY TV+L ++QA 
Sbjct: 72  RFSIFALGIMPYISTSIIMQLMSVVVPSLEALKKEGEAGRRKITQYTRYGTVVLALVQAV 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI+V L++  G+V D    F F+T++TL+ GTMF++WLGEQIT RG+GNG+S++IF+GIV
Sbjct: 132 GISVALESQPGLVIDPGMLFRFTTVVTLVTGTMFVMWLGEQITERGLGNGISILIFAGIV 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLPS+L  +L+L R  S+S    L I +  V V A V+F ER QR++ + Y KRQVGN+
Sbjct: 192 AGLPSALAGLLDLVRTNSMSVLSALFIVALVVLVTAFVVFVERGQRKITVNYAKRQVGNK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLKLN AGV+P IFASS++L PATI  +        W+  L  +L   +  
Sbjct: 252 VYGGQSSHLPLKLNMAGVIPPIFASSIILFPATITSWFSSGERMAWLRDLAAALEPRQPL 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ LYSV I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+ 
Sbjct: 312 YITLYSVAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLA 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+
Sbjct: 372 GAIYITLVCLLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKA 431

Query: 438 RSK 440
             K
Sbjct: 432 NFK 434


>gi|28867874|ref|NP_790493.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|66047755|ref|YP_237596.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           syringae B728a]
 gi|71737231|ref|YP_276686.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213969234|ref|ZP_03397372.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tomato T1]
 gi|257483205|ref|ZP_05637246.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289623829|ref|ZP_06456783.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289648922|ref|ZP_06480265.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289675508|ref|ZP_06496398.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           syringae FF5]
 gi|298489076|ref|ZP_07007098.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301381741|ref|ZP_07230159.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tomato Max13]
 gi|302061059|ref|ZP_07252600.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tomato K40]
 gi|302130800|ref|ZP_07256790.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|302189297|ref|ZP_07265970.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           syringae 642]
 gi|28851110|gb|AAO54188.1| preprotein translocase, SecY subunit [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|63258462|gb|AAY39558.1| SecY protein [Pseudomonas syringae pv. syringae B728a]
 gi|71557784|gb|AAZ36995.1| preprotein translocase, SecY subunit [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|213925912|gb|EEB59469.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tomato T1]
 gi|298156388|gb|EFH97486.1| preprotein translocase subunit [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322302|gb|EFW78396.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331960|gb|EFW87896.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330869411|gb|EGH04120.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330879422|gb|EGH13571.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330953177|gb|EGH53437.1| preprotein translocase subunit SecY [Pseudomonas syringae Cit 7]
 gi|330962505|gb|EGH62765.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330969801|gb|EGH69867.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           aceris str. M302273PT]
 gi|330976660|gb|EGH76703.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|330988262|gb|EGH86365.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331012433|gb|EGH92489.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331018180|gb|EGH98236.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 444

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/419 (49%), Positives = 294/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    ++ F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAELFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+    D  F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGVAFSGDLGFHFVAVTTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGLGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|330899716|gb|EGH31135.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 444

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/419 (49%), Positives = 294/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    ++ F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAELFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+    D  F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGVAFSGDLGFHFVAVTTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGLGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTLFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|146308903|ref|YP_001189368.1| preprotein translocase subunit SecY [Pseudomonas mendocina ymp]
 gi|145577104|gb|ABP86636.1| protein translocase subunit secY/sec61 alpha [Pseudomonas mendocina
           ymp]
          Length = 442

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 295/423 (69%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFMAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY T++L  +QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTLVLAFVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+    D+ F F  I T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGVAFSVDFGFHFVAITTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 SAIGQSFESARQGDINIFALIAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASSLLL PA++  +   S    W+  +  ++  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSLLLFPASLGAWFGQSEGLGWLQDISQAIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QY+ + KK+  K 
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYDSLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|297537551|ref|YP_003673320.1| preprotein translocase subunit SecY [Methylotenera sp. 301]
 gi|297256898|gb|ADI28743.1| preprotein translocase, SecY subunit [Methylotenera sp. 301]
          Length = 441

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 220/426 (51%), Positives = 303/426 (71%), Gaps = 3/426 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  +LKSR++F + ALIVYR G ++P+P ID +  +K F+S+S GI G+FNMFSGGA+ 
Sbjct: 11  SKMGELKSRLLFVLGALIVYRLGAHVPVPGIDPVVLAKLFESQSGGILGMFNMFSGGALS 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R  VF+LGIMPYISASII+QL++A  P LE LKKEGE GR+ I ++TRY TV+L   QA 
Sbjct: 71  RFTVFALGIMPYISASIIMQLLSAVSPKLEQLKKEGEAGRRTITKWTRYGTVVLAAFQAL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GIA+ L+   G+V D    F  + +ITL+ GTMF++WLGEQIT RGIGNG+S+IIF+GIV
Sbjct: 131 GIAIALEGQPGLVLDPGLAFRLTAVITLVSGTMFIMWLGEQITERGIGNGISIIIFAGIV 190

Query: 198 AGLPSSLVSVLELGRVGSIST--PLML-LIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           AGLP ++ S +E+   G      PL+L  +  + V V ALV+F ER QR++ + Y KRQV
Sbjct: 191 AGLPKAIGSSVEMANSGGFGAAGPLILFFLLVTIVLVTALVVFVERGQRKITVNYAKRQV 250

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           GN+++    ++LPLKLN AGV+P IFASS++L PAT+  +     S  W+  + ++L  G
Sbjct: 251 GNKVYGGQTTHLPLKLNMAGVIPPIFASSIILFPATLANWFSGKESMYWLKDISNALSPG 310

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y++ ++V IVFF FFYTA+ FNPK+ ADNLKK G F+PGIRPGD+TA +ID ++ R+
Sbjct: 311 QPIYILFFTVAIVFFCFFYTALQFNPKDTADNLKKSGAFVPGIRPGDQTAKYIDRIMGRL 370

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T++GA Y+  VC+ PE L      P    GTSLLIIV V +D + Q+Q +L++ QYEG+ 
Sbjct: 371 TLIGAIYITLVCLLPEFLRLKFNTPFYFGGTSLLIIVVVTMDFMTQVQSHLMSNQYEGLL 430

Query: 435 KKSRSK 440
           KK+  K
Sbjct: 431 KKANFK 436


>gi|224827037|ref|ZP_03700134.1| preprotein translocase, SecY subunit [Lutiella nitroferrum 2002]
 gi|224600703|gb|EEG06889.1| preprotein translocase, SecY subunit [Lutiella nitroferrum 2002]
          Length = 439

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/437 (50%), Positives = 303/437 (69%), Gaps = 5/437 (1%)

Query: 4   AVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAG 63
           A    VSN N     +  DLK R++F I ALIVYR G +IP+P I+    +K F +   G
Sbjct: 2   ANTSLVSNGN-----KFADLKRRVLFLIGALIVYRIGAHIPVPGINPAELAKLFHTSQTG 56

Query: 64  IFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQY 123
           +  +FNMFSGGA+ R  VF++GIMPYISASII+QL +  VP L+ LKKEG+ GR+ I QY
Sbjct: 57  LLDMFNMFSGGALSRFTVFAIGIMPYISASIILQLGSEIVPMLKELKKEGDAGRRKITQY 116

Query: 124 TRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRG 183
           TRYATVLL   Q++GIAV L     +V    + F  +T++TL+ GTMFL+WLGEQ+T RG
Sbjct: 117 TRYATVLLATFQSFGIAVMLYKQPNLVVTPQWEFYLTTVVTLVTGTMFLMWLGEQMTERG 176

Query: 184 IGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQR 243
           IGNG+SLII +GI AG+P+++   L L   GS+     +++F+S + V  LV+F ER QR
Sbjct: 177 IGNGISLIICAGIAAGVPAAIGKTLTLTSQGSLPILFAIVLFASVILVTYLVVFAERGQR 236

Query: 244 RLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTW 303
           ++L+ Y KRQVGNR+ Q   +++PLKLN AGV+P IFASS++L PAT++G+   +    W
Sbjct: 237 KVLVNYAKRQVGNRVMQGQSTHMPLKLNMAGVIPPIFASSIILFPATVIGWFGNTEGMGW 296

Query: 304 IVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRT 363
           +  + D L  G+  Y++LY+  I+FF +FYTA+VFNPKE ADNLKK G FIPGIRPG++T
Sbjct: 297 LKSVADKLHPGQPIYVLLYATAIIFFCYFYTALVFNPKETADNLKKSGAFIPGIRPGEQT 356

Query: 364 ALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQG 423
           + +I+ ++ R+T++GA Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q 
Sbjct: 357 SRYIEKIILRLTLIGAIYITLVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMAQVQS 416

Query: 424 YLIAQQYEGVFKKSRSK 440
           Y+++ QYE + KK+  K
Sbjct: 417 YILSHQYESLLKKANFK 433


>gi|114561356|ref|YP_748869.1| preprotein translocase subunit SecY [Shewanella frigidimarina NCIMB
           400]
 gi|114332649|gb|ABI70031.1| protein translocase subunit secY/sec61 alpha [Shewanella
           frigidimarina NCIMB 400]
          Length = 446

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/418 (50%), Positives = 300/418 (71%), Gaps = 1/418 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQKDTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG LQ+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTLQSVGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V++  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLMPGLVANPGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++ S  E  R G ++  ++LL+     AV  LV+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGSTAEQARQGDMNVLVLLLLAVIVFAVTYLVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGSNESMSWLSDFALAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYATAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           Y+  +C+ PE ++    V     GTSLLIIV V++D + Q+Q ++++ QYE V KK+ 
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYESVMKKAN 434


>gi|171060599|ref|YP_001792948.1| preprotein translocase subunit SecY [Leptothrix cholodnii SP-6]
 gi|170778044|gb|ACB36183.1| preprotein translocase, SecY subunit [Leptothrix cholodnii SP-6]
          Length = 436

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/406 (51%), Positives = 285/406 (70%)

Query: 35  IVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASI 94
           +VYR G +IP+P I+    ++ F+ +  GI  LFNMFSGGA+ R  VF+LGIMPYISASI
Sbjct: 29  VVYRVGAHIPVPGINPDQLAELFKGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASI 88

Query: 95  IVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSD 154
           I+QL+   +P+LE+LKKEGE GR+ I QYTRY T+ L I Q+ GIA+ ++   G+V D  
Sbjct: 89  IMQLMTHVLPALESLKKEGEAGRRKITQYTRYGTLGLAIFQSLGIALAIEGSPGLVIDPG 148

Query: 155 YFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVG 214
             F    +++L  GTMFL+WLGEQIT RG+GNG+S++IF GI AGLPS++  +L L   G
Sbjct: 149 PMFRIGAMVSLTAGTMFLMWLGEQITERGLGNGISILIFGGIAAGLPSAIGGLLNLVNTG 208

Query: 215 SISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAG 274
           S+S    L I +  + V  +V+F ER QR++L+ Y KRQVGN+++    S+LPLK+N +G
Sbjct: 209 SMSIIAALFIVAIVIGVTFVVVFVERGQRKILVNYAKRQVGNKVYGGQSSHLPLKINMSG 268

Query: 275 VVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT 334
           V+P IFASS++LLPAT++G+     S  W+  +  +L  G+  Y++LY+  IVFF FFYT
Sbjct: 269 VIPPIFASSIILLPATVVGWFATGESLVWLKDISAALSPGQPIYVLLYAAMIVFFCFFYT 328

Query: 335 AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIA 394
           A+VFN +E ADNLKK G FIPGIRPGD+TA HID +L R+T+ GA Y+  VC+ PE L+ 
Sbjct: 329 ALVFNSRETADNLKKSGAFIPGIRPGDQTARHIDKILARLTLGGAVYITAVCLLPEFLVL 388

Query: 395 VTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
              VP    GTSLLIIV V +D   Q+Q Y+++QQYE + KK+  K
Sbjct: 389 KYNVPFYFGGTSLLIIVVVTMDFWAQVQSYVMSQQYESLLKKASFK 434


>gi|91791559|ref|YP_561210.1| preprotein translocase subunit SecY [Shewanella denitrificans
           OS217]
 gi|91713561|gb|ABE53487.1| protein translocase subunit secY/sec61 alpha [Shewanella
           denitrificans OS217]
          Length = 446

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/422 (49%), Positives = 302/422 (71%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQKDTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG LQ+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTLQSIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V+++ + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLMPGLVANAGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++ S  E  R G ++  ++LL+     AV  LV+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGSTAEQARQGDLNVLVLLLLAVIVFAVTYLVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTLAQWFGANESMSWLSDFALAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYATAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLIIV V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|33594772|ref|NP_882415.1| preprotein translocase subunit SecY [Bordetella parapertussis
           12822]
 gi|33564848|emb|CAE39792.1| preprotein translocase SecY subunit [Bordetella parapertussis]
          Length = 441

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 223/423 (52%), Positives = 303/423 (71%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           +R  DLK R+VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ 
Sbjct: 12  ARYGDLKRRLVFLVLALVVYRLGTHIPVPGINPDALADLFRQHEGGILGLFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL++  VPSLE LKKEGE GR+ I QYTRY TV+L ++QA 
Sbjct: 72  RFSIFALGIMPYISASIIMQLMSVVVPSLEALKKEGEAGRRKITQYTRYGTVVLALVQAV 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI+V L++  G+V D    F F+T++TL+ GTMF++WLGEQIT RG+GNG+S++IF+GIV
Sbjct: 132 GISVALESQPGLVIDPGMLFRFTTVVTLVTGTMFVMWLGEQITERGLGNGISILIFAGIV 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLPS+L  +L+L R  S+S    L I +  V V A V+F ER QR++ + Y K QVGN+
Sbjct: 192 AGLPSALAGLLDLVRTNSMSVLSALFIVALVVLVTAFVVFVERGQRKITVNYAKCQVGNK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLKLN AGV+P IFASS++L PATI  +        W+  L  +L   +  
Sbjct: 252 VYGGQSSHLPLKLNMAGVIPPIFASSIILFPATITSWFSSGERMAWLHDLAAALEPRQPL 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ LYSV I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+ 
Sbjct: 312 YITLYSVAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLA 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+
Sbjct: 372 GAIYITLVCLLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKA 431

Query: 438 RSK 440
             K
Sbjct: 432 NFK 434


>gi|332142186|ref|YP_004427924.1| preprotein translocase subunit SecY [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327552208|gb|AEA98926.1| preprotein translocase subunit SecY [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 439

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/430 (48%), Positives = 304/430 (70%), Gaps = 1/430 (0%)

Query: 12  LNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMF 71
           L+  + S   +LK+R++F + A++V+R G+Y+P+P ID    +  F+ +   I  +FNMF
Sbjct: 6   LDSGAKSGLSELKARLLFVLGAIVVFRLGSYVPIPGIDPAVLADLFEQQKGTIVEMFNMF 65

Query: 72  SGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLL 131
           SGGA+ER +V +LGIMPYI+ASII+QL++   P +  LKKEGE GR+ I+QYTRY T++L
Sbjct: 66  SGGALERASVLALGIMPYITASIIMQLLSVVHPPMVELKKEGEAGRRKISQYTRYLTLVL 125

Query: 132 GILQAYGIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
            I Q+ GI+ GL N   G+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S+
Sbjct: 126 AIFQSIGISTGLPNLINGLVINPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISI 185

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           +IF+GIVAGLP+++    E  R G I+   +LLI +  +A+  LV+F ER QRR+++ Y 
Sbjct: 186 LIFAGIVAGLPTAIGQTAEQARQGDINLLFLLLIGAIVIALTYLVVFVERGQRRIVVNYA 245

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS 310
           KRQ G ++F    ++LPLK+N AGV+P IFASS++L P TI G+   + S  W+  +   
Sbjct: 246 KRQQGRQVFAAQSTHLPLKVNIAGVIPPIFASSIILFPGTIAGWFGQNESTAWLQDVALM 305

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G+  Y++LY+  I+FF FFYTA+VFNP++ ADNLKK G FIPGIRPG++T+ +ID V
Sbjct: 306 LSPGQPLYVMLYAAAIIFFCFFYTALVFNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKV 365

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           +TR+T+ GA Y+  +C+ PE ++    VP    GTSLLIIV V++D + Q+Q +L++ QY
Sbjct: 366 MTRLTLAGALYITFICLVPEFMLIAWNVPFYFGGTSLLIIVVVIMDFMAQVQTHLMSSQY 425

Query: 431 EGVFKKSRSK 440
           E V KK+  K
Sbjct: 426 ESVLKKANLK 435


>gi|254495732|ref|ZP_05108647.1| preprotein translocase subunit SecY [Legionella drancourtii LLAP12]
 gi|254355045|gb|EET13665.1| preprotein translocase subunit SecY [Legionella drancourtii LLAP12]
          Length = 442

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/419 (50%), Positives = 298/419 (71%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I+ ++VYR G +IP+P +D    +  F  +   IFGLFNMFSGGA+ R+ V
Sbjct: 17  ELKSRLLFVILGILVYRLGAHIPVPGLDPARLANFFNEQQNTIFGLFNMFSGGALSRVTV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F++GIMPYISASII+QL +   P LE LKKEGE GR+ INQYTRY T++L I Q+ G+A 
Sbjct: 77  FAIGIMPYISASIIIQLFSVVSPKLEQLKKEGESGRRKINQYTRYLTLVLSIFQSLGMAR 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L  GQ I  + D  F F+ +ITL+ GTMFL+WLGEQIT +GIGNG+SLIIFSGIV+ +P
Sbjct: 137 WLA-GQQIALNPDMSFYFTAVITLVTGTMFLMWLGEQITEKGIGNGISLIIFSGIVSSMP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++ SVL+  + G +    ++++    V V   V+F ERAQRR+ + Y +R  G +++  
Sbjct: 196 SAIASVLQQVKEGQMQALTLIIVAVIVVVVTGFVVFMERAQRRIRVNYAQRTQGRKVYAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N +GV+P IFASS++LLPAT+  F   +    W+  +  +L  G+  Y+++
Sbjct: 256 QTSHLPLKINMSGVIPPIFASSIILLPATLAQFFSHTKGLGWLSDVGMALSPGQPLYLIV 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ I+FFAFFY A+VFNPK+ A+NLKK G +IPGIRPG++T  +ID V+TR+T++GA Y
Sbjct: 316 YAMAILFFAFFYAALVFNPKDTAENLKKSGAYIPGIRPGEQTTKYIDAVMTRLTLIGAIY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           LV VC+ P+ L+    VP    GTSLLIIV V++D + QIQ +L+ QQY+ + KK+  K
Sbjct: 376 LVLVCLLPQILMYTWHVPFYFGGTSLLIIVVVIMDFVAQIQAHLMTQQYDSLMKKANFK 434


>gi|221133736|ref|ZP_03560041.1| preprotein translocase subunit SecY [Glaciecola sp. HTCC2999]
          Length = 439

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/420 (49%), Positives = 299/420 (71%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+SR+ F + A+IV+R G+Y+P+P ID    S+ F+ +   I  +FNMFSGGA+ER +V
Sbjct: 16  ELRSRLFFVLGAIIVFRLGSYVPIPGIDAAVLSQLFEQQKGTIVEMFNMFSGGALERASV 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYI+ASII+QL+ A  P +  LKKEGE GR+ I+QYTRY T++L   Q+ G+A 
Sbjct: 76  LALGIMPYITASIIIQLLTAVHPPMMELKKEGEAGRRKISQYTRYLTLVLATFQSIGVAT 135

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 136 GLPNLISGLVINPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 195

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++    E  R G I+   +LLI +  + +  LV+F ERAQRR+++ Y KRQ G ++ Q
Sbjct: 196 PTAIGQTAEQARQGEINLLFLLLIAAIVIGLTYLVVFVERAQRRIVVNYAKRQQGRKVMQ 255

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P IFASS++L P+TI G+   + + +W+  +   L  G+  Y+ 
Sbjct: 256 AQSSHLPLKVNMAGVIPPIFASSIILFPSTIAGWFGQNEATSWLQDVALLLSPGQPLYVG 315

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+ FNP+E ADNLKK G F+PGIRPG++T+ ++D V+TR+T+ GA 
Sbjct: 316 LYAAAIIFFCFFYTALTFNPRETADNLKKSGAFVPGIRPGEQTSRYLDKVMTRLTLAGAL 375

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ PE L+    VP    GTSLLIIV V++D + Q+Q +L++ QYE V KK+  K
Sbjct: 376 YITFVCLVPEFLLLTWNVPFYFGGTSLLIIVVVIMDFMAQVQTHLMSSQYESVLKKANLK 435


>gi|237797452|ref|ZP_04585913.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331020302|gb|EGI00359.1| preprotein translocase subunit SecY [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 444

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/419 (49%), Positives = 293/419 (69%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    ++ F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAELFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTVVSPQLEQLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+    D  F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGVAFSGDLGFHFVAVTTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGLGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|294142913|ref|YP_003558891.1| preprotein translocase subunit SecY [Shewanella violacea DSS12]
 gi|293329382|dbj|BAJ04113.1| preprotein translocase, SecY subunit [Shewanella violacea DSS12]
          Length = 446

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/422 (49%), Positives = 298/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFNQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG  QA GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGETGRKKISQYTRYGTLVLGTFQAIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLIPGLVVNLGFSFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LLI     AV  LV+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLIAVIVFAVTFLVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTLAQWFGQNESLSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYASAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLITWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|116749010|ref|YP_845697.1| preprotein translocase subunit SecY [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698074|gb|ABK17262.1| protein translocase subunit secY/sec61 alpha [Syntrophobacter
           fumaroxidans MPOB]
          Length = 435

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/436 (48%), Positives = 304/436 (69%), Gaps = 9/436 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
            FA+  R  +LK RI+ T+  L VYR G +IP P I+  + +  F+  S  + GLF+MFS
Sbjct: 4   GFANIGRIPELKRRILVTLALLAVYRVGAHIPTPGINGDALAAFFKQLSGTLLGLFDMFS 63

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ +++VFSLGIMPYISASII+QL+   +P+LE L KEG+ GR+ I QYTRY TV+L 
Sbjct: 64  GGALSQLSVFSLGIMPYISASIILQLLTVVIPTLERLSKEGDAGRRKITQYTRYGTVILS 123

Query: 133 ILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNG 187
           ++Q + I VGL+      G+ +V    + F  +T++TL  GT F++WLGEQIT RGIGNG
Sbjct: 124 VIQGFAIGVGLEGMTGPGGEIVVLHPGWGFRLTTVLTLTAGTAFIMWLGEQITERGIGNG 183

Query: 188 VSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLI 247
           +SLIIF+GIVAG+P++L + + +  +G +S  L+L + +  +AV+A++IF ER QRR+ +
Sbjct: 184 ISLIIFAGIVAGIPNALENTVRMVTMGEMSAFLLLGLAAFMLAVVAVIIFMERGQRRIPV 243

Query: 248 QYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGL 307
           QY KR VG R++    +++PLK+NT+GV+P IFASS+++ P T+  FI       W+  +
Sbjct: 244 QYAKRVVGRRVYGGQNTHIPLKINTSGVIPPIFASSIMMFPGTVGSFIKTP----WMEWI 299

Query: 308 VDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
            ++LG G+  + +LY   IVFF FFYTAIVFNP + ADN+KK+GGFIPGIRPG  TA +I
Sbjct: 300 ANALGPGQWLHSILYVALIVFFCFFYTAIVFNPLDVADNMKKYGGFIPGIRPGRPTAEYI 359

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           D VL+R+TV GA Y+  VC+ P  LI+   VP    GT+LLI++ V +DT+ QI+ ++++
Sbjct: 360 DKVLSRITVGGAVYISAVCVLPTILISRFAVPFYFGGTALLIVIGVAMDTLAQIEAHMLS 419

Query: 428 QQYEGVFKKSRSKKKN 443
           + YEG  KK R + + 
Sbjct: 420 RHYEGFLKKGRLRGRR 435


>gi|119502944|ref|ZP_01625029.1| protein translocase subunit SecY [marine gamma proteobacterium
           HTCC2080]
 gi|119461290|gb|EAW42380.1| protein translocase subunit SecY [marine gamma proteobacterium
           HTCC2080]
          Length = 434

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/417 (49%), Positives = 296/417 (70%), Gaps = 1/417 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F ++ALI+YR GT+IP+P ID    +  F      I GL N+FSGGA+ERM++
Sbjct: 8   ELFARLRFVLVALIIYRIGTHIPVPGIDPEQLAALFDQNQGTILGLANVFSGGALERMSI 67

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGI+PYISASII+ L++A  P LE +KKEGE GR+ I+QYTRY TV L ++QA G+ V
Sbjct: 68  LALGILPYISASIIMNLMSAVSPQLEQIKKEGEAGRRKISQYTRYLTVALALVQATGMTV 127

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QG+  D+   F    I +L+ G +F++WLGEQIT RGIGNG+SL+IF+GI AGLP
Sbjct: 128 GLAN-QGLAFDTSVSFYVIAITSLVTGAVFMMWLGEQITERGIGNGISLLIFAGIAAGLP 186

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++   LE  R G ++  ++L I +  V VI LV+F ER QRR+ + Y KRQ G + +Q 
Sbjct: 187 SAVGQSLEQARQGELNILVLLAIVALAVIVIYLVVFIERGQRRVTVNYAKRQQGRQSYQA 246

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N +GV+P+IFASS+LL PA++  +     S  W+     ++G G+   ++L
Sbjct: 247 QSSHLPLKVNMSGVIPAIFASSILLFPASLAQWFGSGDSSDWLQDFAVAIGPGQPLNIML 306

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++ FI+FF FFYTA+++NPK+ ADNLK+ G F+PGIRPG +TA ++D VLTR+TV G+ Y
Sbjct: 307 FTGFIIFFCFFYTALMYNPKDVADNLKRSGAFVPGIRPGQQTANYLDGVLTRLTVFGSAY 366

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           +  VC+ P+ L+ +  VP  L GTS+LI+V VV+D + Q+Q +L++ QYEGV KK+ 
Sbjct: 367 IALVCLLPQFLVVMFNVPFYLGGTSMLIVVVVVMDFMAQVQSHLMSHQYEGVMKKAN 423


>gi|221064824|ref|ZP_03540929.1| preprotein translocase, SecY subunit [Comamonas testosteroni KF-1]
 gi|264680565|ref|YP_003280475.1| preprotein translocase, SecY subunit [Comamonas testosteroni CNB-2]
 gi|299532871|ref|ZP_07046258.1| preprotein translocase subunit SecY [Comamonas testosteroni S44]
 gi|220709847|gb|EED65215.1| preprotein translocase, SecY subunit [Comamonas testosteroni KF-1]
 gi|262211081|gb|ACY35179.1| preprotein translocase, SecY subunit [Comamonas testosteroni CNB-2]
 gi|298719095|gb|EFI60065.1| preprotein translocase subunit SecY [Comamonas testosteroni S44]
          Length = 437

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/404 (50%), Positives = 282/404 (69%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGIDPAQLQQLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   VP+ E +KKEGE GR+ I QYTRY T+ L + Q+ GIAV L++  G+V +  + 
Sbjct: 91  QLMTYVVPTFEQMKKEGEAGRRKITQYTRYGTLGLALFQSLGIAVALESSAGLVLNPGFG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  GT+FL+WLGEQIT RG+GNG+S++IF GI AGLPSS+  +LEL R G++
Sbjct: 151 FRMTAVVSLTAGTLFLMWLGEQITERGLGNGISILIFGGIAAGLPSSIGGLLELVRTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    + I     AV   V++ ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 SILAAIFIVLVVAAVTYFVVYVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPAT++ +     S  W+  +  +L  G+  Y++LY+  I+FF FFYTA+
Sbjct: 271 PPIFASSIILLPATVVNWFSAGESMRWLKDIASTLTPGQPIYVILYAAAIIFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPG++TA +ID +L R+T+ GA Y+  VC+ PE LI   
Sbjct: 331 VFNSRETADNLKKSGAFIPGIRPGEQTARYIDKILVRLTLAGAIYITFVCLLPEFLILKY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 391 NVPFYFGGTSLLIIVVVTMDFMAQVQNYVMSQQYESLLKKANFK 434


>gi|330505187|ref|YP_004382056.1| preprotein translocase subunit SecY [Pseudomonas mendocina NK-01]
 gi|328919473|gb|AEB60304.1| preprotein translocase subunit SecY [Pseudomonas mendocina NK-01]
          Length = 442

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 294/423 (69%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY T++L  +QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTLVLAFVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+    D+ F F  I T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGVAFSVDFGFHFVAITTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 SAIGQSFESARQGDINIFALIAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASSLLL PA++  +   S    W+  +  ++  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSLLLFPASLGTWFGQSEGLGWLQDISQAIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTLFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L     VP  L GTSLLI+V VV+D + Q+Q +L++ QY+ + KK+  K 
Sbjct: 376 MTAVCLLPQFLQVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYDSLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|198282657|ref|YP_002218978.1| preprotein translocase subunit SecY [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667727|ref|YP_002424850.1| preprotein translocase, SecY subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247178|gb|ACH82771.1| preprotein translocase, SecY subunit [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519940|gb|ACK80526.1| preprotein translocase, SecY subunit [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 443

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 294/423 (69%), Gaps = 4/423 (0%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +  +L++RI+F + AL+V+R G +IP+P ID  + +  F  +   I G+FNMFSGGA+ R
Sbjct: 16  KINELRNRILFLLGALLVFRVGAHIPVPGIDPAAMATFFNQQRGTILGMFNMFSGGALSR 75

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           + VF+LGIMPYISASII QL  +  P LE LKKEGE GR+ I +YTRYATV+L ++Q  G
Sbjct: 76  LTVFALGIMPYISASIIFQLAGSVFPKLEELKKEGEAGRRKITEYTRYATVILALMQGLG 135

Query: 139 IAVGLKNGQG----IVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           IA+ ++        +V      F+F+T I+L  GT+FL+W+GEQIT RGIGNG+S+IIF+
Sbjct: 136 IAIAIEKMHAGTVPVVISPGPLFLFTTTISLACGTVFLMWIGEQITERGIGNGISMIIFA 195

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GIVAGLP ++ +  EL + G      ++ +F   +AV   V+F E AQRR+ IQY KRQV
Sbjct: 196 GIVAGLPDAIGTTFELMKTGQFQPLFVVALFVLALAVTGFVVFMESAQRRIPIQYAKRQV 255

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
           G +++    +++PLK+N +GV+P IFASS++LLPAT+ G+        W+     +L  G
Sbjct: 256 GRKVYGGQSTHMPLKVNMSGVIPPIFASSIILLPATLSGWFANVPGMEWLARFGQALSPG 315

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
            + Y+V+++  IVFFAFFYTA+VFNP+E ADNLKK G F+PGIRPG+ TA ++D +LTR+
Sbjct: 316 SALYVVVFTTAIVFFAFFYTAMVFNPRETADNLKKSGAFVPGIRPGEHTAKYMDRILTRL 375

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T+ GA YL  VC+ PE LI    VP    GTSLLI+V V++D + QIQ +L+  QYEG+ 
Sbjct: 376 TLWGAIYLTLVCLLPEFLIVQYNVPFYFGGTSLLIVVVVMMDLMGQIQSHLLTHQYEGLI 435

Query: 435 KKS 437
           +K+
Sbjct: 436 RKN 438


>gi|330940910|gb|EGH43861.1| preprotein translocase subunit SecY [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 444

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/419 (49%), Positives = 293/419 (69%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    ++ F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAELFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G++V
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVVLALVQAIGMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+    D  F F  + T + G MF++WLG QIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGVAFSGDLGFHFVAVTTFVAGAMFMMWLGGQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGLGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MTAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|237749535|ref|ZP_04580015.1| preprotein translocase SecY subunit [Oxalobacter formigenes OXCC13]
 gi|229380897|gb|EEO30988.1| preprotein translocase SecY subunit [Oxalobacter formigenes OXCC13]
          Length = 441

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 291/423 (68%), Gaps = 5/423 (1%)

Query: 26  RIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLG 85
           R+ F + AL+V+R G +IP+P ID    +  F     GI G+FNMFSGGA+ R  +F+LG
Sbjct: 19  RLFFLLGALVVFRIGAHIPVPGIDSEQLALLFNQNQGGILGMFNMFSGGALSRFTIFALG 78

Query: 86  IMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKN 145
           IMPYISASII+Q++    P+++ LKKEGE GR+ + QYTRY T++L   Q  GIAV L++
Sbjct: 79  IMPYISASIIMQMLGIVSPAIDALKKEGEAGRRKMTQYTRYGTLVLAAFQGLGIAVALES 138

Query: 146 GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLV 205
             G+V D    F F+ ++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLP+++ 
Sbjct: 139 QPGLVIDPGMAFRFTAVVTLVTGTMFLMWLGEQITERGLGNGISMIIFAGIAAGLPNAIG 198

Query: 206 SVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSY 265
            ++EL R GS+ST   ++I      V  LV++ E  QRR+L+ Y KRQVGN+++    S+
Sbjct: 199 GLIELVRTGSMSTLTAIIICVIVALVTYLVVYIESGQRRILVNYAKRQVGNKIYGGQSSF 258

Query: 266 LPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT-----WIVGLVDSLGHGRSFYMV 320
           LPLK+N AGV+P IFASS++L PATI G+    S        ++  L  SL  G   + +
Sbjct: 259 LPLKVNMAGVIPPIFASSIILFPATIAGWFATGSESDNMFVRFLKDLSASLAPGEPVHAI 318

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFN +E ADNLKK G FIPGIRPG++TA ++D +L R+T+ GA 
Sbjct: 319 LYAAAIIFFCFFYTALVFNSRETADNLKKSGAFIPGIRPGEQTARYVDKILMRLTLAGAI 378

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ PE L+A   VP    GTSLLIIV V +D + QIQ Y+++QQY+ + +KS  K
Sbjct: 379 YVTLVCLLPEFLVARWQVPFYFGGTSLLIIVVVTMDFMAQIQNYVMSQQYDSLLRKSNFK 438

Query: 441 KKN 443
             N
Sbjct: 439 SNN 441


>gi|104779775|ref|YP_606273.1| preprotein translocase subunit SecY [Pseudomonas entomophila L48]
 gi|148545759|ref|YP_001265861.1| preprotein translocase subunit SecY [Pseudomonas putida F1]
 gi|170723886|ref|YP_001751574.1| preprotein translocase subunit SecY [Pseudomonas putida W619]
 gi|95108762|emb|CAK13456.1| secretion protein SecY [Pseudomonas entomophila L48]
 gi|148509817|gb|ABQ76677.1| protein translocase subunit secY/sec61 alpha [Pseudomonas putida
           F1]
 gi|169761889|gb|ACA75205.1| preprotein translocase, SecY subunit [Pseudomonas putida W619]
          Length = 443

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 293/419 (69%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFMAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G+++
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQAIGMSI 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QG+   +   F    + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAN-QGVAFSAGLGFHVVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARTGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           ++ VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MMAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|170728989|ref|YP_001763015.1| preprotein translocase subunit SecY [Shewanella woodyi ATCC 51908]
 gi|169814336|gb|ACA88920.1| preprotein translocase, SecY subunit [Shewanella woodyi ATCC 51908]
          Length = 446

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/422 (49%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFNQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG  QA GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTFQAVGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNLGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LLI     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLIAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESLSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYASAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLITWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|157377430|ref|YP_001476030.1| preprotein translocase subunit SecY [Shewanella sediminis HAW-EB3]
 gi|157319804|gb|ABV38902.1| preprotein translocase, SecY subunit [Shewanella sediminis HAW-EB3]
          Length = 446

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/422 (49%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFNQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG  QA GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTFQAIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNLGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LLI     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLIAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESLSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYASAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLITWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|261854970|ref|YP_003262253.1| preprotein translocase, SecY subunit [Halothiobacillus neapolitanus
           c2]
 gi|261835439|gb|ACX95206.1| preprotein translocase, SecY subunit [Halothiobacillus neapolitanus
           c2]
          Length = 444

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 221/440 (50%), Positives = 300/440 (68%), Gaps = 7/440 (1%)

Query: 9   VSNLNFASFS---RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIF 65
           +SN   AS +   R  +L+ RI F I+ L+VYR GT+IPLP ID       F   S GI 
Sbjct: 3   LSNAGVASLAGAGRLTELRQRIFFVIMVLVVYRIGTFIPLPGIDVDVMRTLFTQHSGGIL 62

Query: 66  GLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTR 125
           G+ NMFSGGA+ RM++F+LG+MPYISASIIVQL+++ +PSLE +KKEGE GR+ I QYTR
Sbjct: 63  GMMNMFSGGALSRMSLFALGVMPYISASIIVQLLSSVLPSLERIKKEGEAGRRKITQYTR 122

Query: 126 YATVLLGILQAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITM 181
           Y T+ LG++QA G+++ L+     GQ +V    + F+F   +TLL GTM LVWLGEQIT 
Sbjct: 123 YGTLGLGLVQALGVSIALQGQSVGGQSLVYTPGFGFLFVATMTLLTGTMLLVWLGEQITE 182

Query: 182 RGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERA 241
           RG+GNG+SLIIF+GIVAGLP+++    EL R G +    +L++    VAV A V+F ER 
Sbjct: 183 RGVGNGISLIIFAGIVAGLPTAIGGTAELVRTGELGVITLLILAVLIVAVTAFVVFVERG 242

Query: 242 QRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSP 301
           QRR+ + Y +RQ G  M     S+LPLKLN AGV+P IFASS++L PAT+  ++    + 
Sbjct: 243 QRRITVNYARRQQGRGMAGQQSSHLPLKLNMAGVIPPIFASSIILFPATLGNWLGQQENM 302

Query: 302 TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGD 361
            W+  +  +L  G+  Y+ LY+  I+FF FFYTA+VFN +E ADNLK+ G F+PGIRPG+
Sbjct: 303 AWLRSVSTALSPGQPLYVGLYATAIIFFCFFYTALVFNSRETADNLKRSGAFVPGIRPGE 362

Query: 362 RTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQI 421
            TA +ID VLTR+T  GA Y+  VC+ PE LI    VP    GTSLLIIV V++D + Q+
Sbjct: 363 HTARYIDKVLTRLTFWGALYITAVCLLPEFLILYWNVPFYFGGTSLLIIVVVLMDFMAQV 422

Query: 422 QGYLIAQQYEGVFKKSRSKK 441
           Q +L++ QY+ + +K+  K 
Sbjct: 423 QSHLVSHQYDSLVRKAHFKS 442


>gi|257095020|ref|YP_003168661.1| preprotein translocase subunit SecY [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047544|gb|ACV36732.1| preprotein translocase, SecY subunit [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 441

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 221/419 (52%), Positives = 295/419 (70%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R+ F + AL+VYR G++IP+P ID    S+ F  +  GI G+FNMFSGGA+ R  +
Sbjct: 16  DLKRRLWFLLGALVVYRIGSHIPVPGIDPQVLSELFNKQQGGILGMFNMFSGGALSRFTI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P LE LKKEGE GR+ I QYTRY TV L + Q  GIAV
Sbjct: 76  FALGIMPYISASIIMQLMTHASPQLEALKKEGEAGRRKITQYTRYGTVFLALFQGIGIAV 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            +++  G+V D    F F T+ TLL GTMFL+WLGEQ+T RG+GNG+S+IIF+GI AGLP
Sbjct: 136 AVESQPGLVLDPGMMFRFVTVTTLLTGTMFLMWLGEQVTERGLGNGISIIIFAGIAAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  +LEL R G++     ++I    V V A V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 196 NAIGGLLELVRTGAMHPLTAIVISLLVVVVTAFVVFVERGQRKILVNYAKRQVGNKIYGG 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN AGV+P IFASS++L PATI G+     S  W+  +  +L  G+  Y++L
Sbjct: 256 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFGSGESVRWLKDIAGALSPGQPIYVML 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+  I+FF FFYTA+VFN +E ADNLK+ G F+PGIRPG++TA +ID +L R+T+VGAGY
Sbjct: 316 YAAAIIFFCFFYTALVFNSRETADNLKRSGAFVPGIRPGEQTARYIDRILMRLTLVGAGY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q Y ++ QYE + KK+  K
Sbjct: 376 ITIVCLLPEFLILKWNVPFYFGGTSLLIIVVVTMDFMTQVQAYAMSHQYESLLKKANFK 434


>gi|325981825|ref|YP_004294227.1| preprotein translocase, SecY subunit [Nitrosomonas sp. AL212]
 gi|325531344|gb|ADZ26065.1| preprotein translocase, SecY subunit [Nitrosomonas sp. AL212]
          Length = 443

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/426 (49%), Positives = 301/426 (70%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
            +  DLK R+ F ++ALIVYR G ++P+P ID I     F+S+ +G+ G+FNMFSGGA+ 
Sbjct: 12  DKFSDLKRRLWFLLLALIVYRIGAHVPVPGIDSIVLKDLFESQESGVLGMFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL    VP LE LKKEGE GR+ I QYTRY T+ L ++Q+Y
Sbjct: 72  RFSIFALGIMPYISASIIMQLGTVAVPYLEALKKEGENGRRKITQYTRYGTLALALVQSY 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI++ L++  G+V +    F  +T+ITL+ GT+FL+WLGEQIT RGIGNG+SLIIF+GI 
Sbjct: 132 GISIALQSQNGLVIEPGGMFTLTTVITLVTGTIFLMWLGEQITERGIGNGISLIIFAGIA 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLPS++   L+L   GS+   + L IF +   V   V+F E+ QRR+L+ Y KRQ+G +
Sbjct: 192 AGLPSAIGGTLDLVSTGSMHFIIALGIFIAAALVTWFVVFVEKGQRRILVNYAKRQIGQK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLK+N AGV+P IFASS++L PAT+ G+   + S   +  +  +L  G+  
Sbjct: 252 IYGGQSSHLPLKINMAGVIPPIFASSIILFPATLAGWFANNESMIILRDISAALAPGQPI 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY++ I+FF FFYTA+VFNPKE ADNLKK G FIPGIRPG++T  +I+ ++ R+T+ 
Sbjct: 312 YVMLYAIMIIFFCFFYTALVFNPKETADNLKKSGAFIPGIRPGEQTTRYIEKIMLRLTLA 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           G+ Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q ++++ QY+ + KK+
Sbjct: 372 GSIYVTLVCLLPEFLILKWNVPFYFGGTSLLIIVIVTMDFMSQVQSHVMSSQYDSLLKKT 431

Query: 438 RSKKKN 443
             K  +
Sbjct: 432 NLKTNS 437


>gi|254483418|ref|ZP_05096647.1| preprotein translocase, SecY subunit [marine gamma proteobacterium
           HTCC2148]
 gi|214036292|gb|EEB76970.1| preprotein translocase, SecY subunit [marine gamma proteobacterium
           HTCC2148]
          Length = 442

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 214/420 (50%), Positives = 302/420 (71%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F ++A+IVYR GT+IP+P ID    +  F      I GL NMFSGGA+ERM++
Sbjct: 16  ELFARLRFVLLAIIVYRIGTHIPVPGIDPNQLAALFNQNQGTILGLANMFSGGALERMSI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL++A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G+ V
Sbjct: 76  LALGIMPYISASIIMQLMSAVTPQLEQLKKEGESGRRKISQYTRYLTVVLAVIQATGMTV 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           G+ N QG+  D+   F    I +L+ G +F++WLGEQIT +G+GNG+SL+IF+GIVAGLP
Sbjct: 136 GMAN-QGMSYDTSLLFYVIAITSLVTGAVFMMWLGEQITEKGVGNGISLLIFAGIVAGLP 194

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++   LE  R G ++  ++L I +  +AVI L++F ER QRR+ + Y KRQ G +M+Q 
Sbjct: 195 AAIGQSLEQARQGELNILVLLFILALAIAVIYLIVFIERGQRRITVNYAKRQQGRKMYQA 254

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA+I  +   S    W+  L  ++G G+   ++L
Sbjct: 255 QSSHLPLKVNMAGVIPAIFASSILLFPASIAQWFGSSGGADWLQDLAVAIGPGQPLNILL 314

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++VF+VFF FFYTA++FNP E ADNLK+ G F+PGIRPG +TA +ID VLTR+TV G+ Y
Sbjct: 315 FTVFVVFFCFFYTALMFNPVEVADNLKRSGAFVPGIRPGQQTANYIDGVLTRLTVFGSAY 374

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+ +  VP  L GTSLLI+V VV+D + Q+Q +L++ QY+ V KK+  K 
Sbjct: 375 IALVCLMPQFLVVMWNVPFYLGGTSLLIVVVVVMDFMAQVQSHLMSHQYDSVMKKANLKN 434


>gi|308272959|emb|CBX29563.1| Preprotein translocase subunit secY [uncultured Desulfobacterium
           sp.]
          Length = 438

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/436 (48%), Positives = 300/436 (68%), Gaps = 9/436 (2%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
            F +  +  +LK R++ T+  ++VYR G ++P+P ID ++ +  F      + GLF+MFS
Sbjct: 5   GFQNIFKIPELKKRVIVTLGLILVYRIGVHVPVPGIDSVALASFFAKAKGTLLGLFDMFS 64

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA E+++VF+LGIMPYISASII+QL+   VP LE L KEGEQGRK I QYTRY TVLL 
Sbjct: 65  GGAFEKLSVFALGIMPYISASIILQLLTVAVPHLERLSKEGEQGRKKITQYTRYGTVLLS 124

Query: 133 ILQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNG 187
           I+Q +GI++GL++     G  IV    + F   T+ITL  GT F++WLGEQIT RGIGNG
Sbjct: 125 IIQGFGISIGLESMTSPGGAAIVIFPGWGFRLITVITLTAGTAFIMWLGEQITERGIGNG 184

Query: 188 VSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLI 247
           +SLIIF+GI+  +P+++ +  +L   G +S  L++L+    VAV+A++IF E+ QRR+ +
Sbjct: 185 ISLIIFAGIICRMPNAIANTFKLVSTGEMSIFLVILLLIFMVAVVAVIIFAEQGQRRIPV 244

Query: 248 QYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGL 307
           QY KR +G +M+    ++LPLKLNT+GV+P IFASS+++ PATI  FI + +   +    
Sbjct: 245 QYAKRIIGRKMYGGQSTHLPLKLNTSGVIPPIFASSIMMFPATIASFIKIDTMQNF---- 300

Query: 308 VDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
             SL  G   Y +L+   I+FF +FYTAI FNP + A+N+KKHGG+IPGIRPG RT+ +I
Sbjct: 301 AKSLTPGSLIYEILFVGLIIFFCYFYTAITFNPVDVAENMKKHGGYIPGIRPGKRTSDYI 360

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           D VL R+T+ GA Y+ C+C+ P  LI+   VP    GT+LLI+V V +DTI QI+ ++I+
Sbjct: 361 DKVLNRITLGGAIYISCICVLPSILISKLKVPFYFGGTALLIVVGVAIDTISQIESHMIS 420

Query: 428 QQYEGVFKKSRSKKKN 443
           + YEG  KK  ++ K 
Sbjct: 421 RNYEGFLKKGGTRVKG 436


>gi|270157890|ref|ZP_06186547.1| preprotein translocase SecY subunit [Legionella longbeachae D-4968]
 gi|289163850|ref|YP_003453988.1| preprotein translocase, SecY subunit [Legionella longbeachae
           NSW150]
 gi|269989915|gb|EEZ96169.1| preprotein translocase SecY subunit [Legionella longbeachae D-4968]
 gi|288857023|emb|CBJ10837.1| preprotein translocase, SecY subunit [Legionella longbeachae
           NSW150]
          Length = 444

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/419 (50%), Positives = 296/419 (70%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR+ F ++ ++VYR G +IP+P +D    +  F  +   IFGLFNMFSGGA+ R+ V
Sbjct: 19  ELKSRLFFVVLGILVYRLGAHIPVPGLDPARLANFFNEQQNTIFGLFNMFSGGALSRVTV 78

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F++GIMPYISASII+QL     P LE LKKEGE GR+ INQYTRY T+LL I Q+ G+A 
Sbjct: 79  FAIGIMPYISASIILQLFTVVSPKLEQLKKEGESGRRKINQYTRYLTLLLSIFQSLGMAR 138

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L  GQ I   +D+ F F+ ++TL+ GTMFL+WLGEQIT +G+GNG+SLIIFSGIV+ +P
Sbjct: 139 WLA-GQQIALQADFSFYFTAVVTLVTGTMFLMWLGEQITEKGVGNGISLIIFSGIVSSMP 197

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++ SVL+  + G +    +++I    V V   V+F ERAQRR+ + Y +R  G +++  
Sbjct: 198 TAIASVLQQVKEGQMQALTLVIIAVVVVVVTGFVVFMERAQRRIRVNYAQRTQGRKVYAA 257

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N +GV+P IFASS++LLPAT+  F   +    W+  +  +L  G+  Y+++
Sbjct: 258 QTSHLPLKINMSGVIPPIFASSIILLPATLAQFFSHTKGMGWLADVGMALSPGQPLYLIV 317

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+V I+FFAFFY A+VFNPK+ ADNLKK G +IPGIRPG++T  +ID V+TR+T VG+ Y
Sbjct: 318 YAVAIIFFAFFYAALVFNPKDTADNLKKSGAYIPGIRPGEQTTKYIDAVMTRLTFVGSIY 377

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           LV VC+ P+ L+    VP    GTSLLIIV V++D + Q+Q +L+ QQY+ + KK+  K
Sbjct: 378 LVLVCLLPQILMYTWHVPFYFGGTSLLIIVVVIMDFVAQVQAHLMTQQYDSLMKKANFK 436


>gi|26987215|ref|NP_742640.1| preprotein translocase subunit SecY [Pseudomonas putida KT2440]
 gi|24981853|gb|AAN66104.1|AE016238_22 Sec-dependent secretion protein SecY [Pseudomonas putida KT2440]
          Length = 443

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 292/419 (69%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFMAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G+++
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQAIGMSI 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QG+       F    + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAN-QGVAFSVGLGFHIVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARTGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           ++ VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MMAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|119773374|ref|YP_926114.1| preprotein translocase subunit SecY [Shewanella amazonensis SB2B]
 gi|119765874|gb|ABL98444.1| protein translocase subunit secY/sec61 alpha [Shewanella
           amazonensis SB2B]
          Length = 446

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/418 (49%), Positives = 298/418 (71%), Gaps = 1/418 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKARLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GR+ I+QYTR+ T++LG  Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRRKISQYTRWGTLVLGTFQSVGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  I++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNPGFGFYFVAIVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LLI     AV   V+F ER QRR+++ Y KRQ GN++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLIGVIVFAVTYFVVFVERGQRRIVVNYAKRQQGNKIFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + + +W+  +  ++  G+  Y +
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTLAQWFGQNEALSWLSDISLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+ 
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKAN 434


>gi|121603255|ref|YP_980584.1| preprotein translocase subunit SecY [Polaromonas naphthalenivorans
           CJ2]
 gi|120592224|gb|ABM35663.1| protein translocase subunit secY/sec61 alpha [Polaromonas
           naphthalenivorans CJ2]
          Length = 435

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 217/419 (51%), Positives = 300/419 (71%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DL++R+VF ++AL+VYR G +IP+P ID     + F+ +  GI  LFNMFSGGA+ R  V
Sbjct: 16  DLRNRLVFLLLALVVYRVGAHIPVPGIDPGQLKELFKGQQGGILNLFNMFSGGALSRFTV 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   VP+ E +KKEGE GR+ I QYTRY T+ L + Q+ GIAV
Sbjct: 76  FALGIMPYISASIIMQLLTYVVPTFEQMKKEGESGRRKITQYTRYGTLGLALFQSMGIAV 135

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G+V    + F  + + +L  GTMFL+WLGEQIT RG+GNG+S++IF+GI AGLP
Sbjct: 136 ALESSPGLVLMPGFGFRMTAVFSLTAGTMFLMWLGEQITERGLGNGISILIFAGIAAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S+L  +LEL R G++S  + ++I +  V V   V+F ER QR++L+ Y +RQVGN+++  
Sbjct: 196 SALGGLLELVRTGAMSILIAIVIVAVVVLVTYFVVFVERGQRKILVNYARRQVGNKVYGG 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLKLN AGV+P IFASS++LLPAT++G+     S  W+  +  +L  G+  Y++L
Sbjct: 256 QSSHLPLKLNMAGVIPPIFASSIILLPATVVGWFSTGESMRWLKDIASTLTPGQPIYVML 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y+  I+FF FFYTA+VFN +E ADNLKK G FIPGIRPGD+TA +ID +L R+T+ GA Y
Sbjct: 316 YASAIIFFCFFYTALVFNSRETADNLKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +  VC+ PE LI    VP    GTSL+IIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 376 ITFVCLLPEFLILKYNVPFYFGGTSLMIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 434


>gi|167031520|ref|YP_001666751.1| preprotein translocase subunit SecY [Pseudomonas putida GB-1]
 gi|325272028|ref|ZP_08138471.1| preprotein translocase subunit SecY [Pseudomonas sp. TJI-51]
 gi|166858008|gb|ABY96415.1| preprotein translocase, SecY subunit [Pseudomonas putida GB-1]
 gi|324102832|gb|EGC00236.1| preprotein translocase subunit SecY [Pseudomonas sp. TJI-51]
          Length = 443

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 292/419 (69%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFMAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G+++
Sbjct: 77  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQAIGMSI 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QG+       F    + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLAN-QGVAFSVGLGFHVVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARTGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           ++ VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 376 MMAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 434


>gi|237747385|ref|ZP_04577865.1| preprotein translocase SecY subunit [Oxalobacter formigenes HOxBLS]
 gi|229378736|gb|EEO28827.1| preprotein translocase SecY subunit [Oxalobacter formigenes HOxBLS]
          Length = 444

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 216/424 (50%), Positives = 296/424 (69%), Gaps = 7/424 (1%)

Query: 26  RIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLG 85
           R++F + AL+V+R G +IP+P ID    +  F+    GI G+FNMFSGGA+ R  VF+LG
Sbjct: 19  RLLFLLGALVVFRIGAHIPVPGIDSEQLALLFRQNQGGILGMFNMFSGGALSRFTVFALG 78

Query: 86  IMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKN 145
           IMPYISASII+Q++    P ++ LKKEGE GR+ + QYTRY T++L   Q  GIAV L++
Sbjct: 79  IMPYISASIIMQMLGIVSPQIDALKKEGEAGRRKMTQYTRYGTLVLAAFQGLGIAVALES 138

Query: 146 GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLV 205
             G+V D    F F+ ++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF+GI AGLP+++ 
Sbjct: 139 QPGLVIDPGLAFRFTAVVTLVTGTMFLMWLGEQITERGLGNGISMIIFAGIAAGLPNAIG 198

Query: 206 SVLELGRVGSISTPLMLLIFSSTVAVIA-LVIFFERAQRRLLIQYPKRQVGNRMFQDDVS 264
            ++EL R GS++T L  LI    VA++  LV+F E  QRR+L+ Y KRQVGN+++    S
Sbjct: 199 GLVELVRTGSMNT-LTALIICVIVAIVTFLVVFIESGQRRILVNYAKRQVGNKIYGGQSS 257

Query: 265 YLPLKLNTAGVVPSIFASSLLLLPATIMGFI--DVSSSPTWIVGLVD---SLGHGRSFYM 319
           +LPLK+N AGV+P IFASS++L PATI G+      S   +I  L D   SL  G   + 
Sbjct: 258 FLPLKVNMAGVIPPIFASSIILFPATIAGWFATGAESDNVFIRFLKDLSASLAPGEPVHA 317

Query: 320 VLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGA 379
           +LY+  I+FF FFYTA+VFN +E ADNLKK G FIPGIRPG++TA +ID +L R+T+ GA
Sbjct: 318 ILYAAAIIFFCFFYTALVFNSRETADNLKKSGAFIPGIRPGEQTAKYIDKILMRLTLAGA 377

Query: 380 GYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRS 439
            Y+  +C+ PE L+A   VP    GTSLLIIV V +D + QIQ Y+++QQY+ + KK+  
Sbjct: 378 IYVTLICLLPEFLVARWQVPFYFGGTSLLIIVVVTMDFMAQIQNYIMSQQYDSLLKKANF 437

Query: 440 KKKN 443
           K  +
Sbjct: 438 KSNS 441


>gi|319778705|ref|YP_004129618.1| Preprotein translocase secY subunit [Taylorella equigenitalis MCE9]
 gi|317108729|gb|ADU91475.1| Preprotein translocase secY subunit [Taylorella equigenitalis MCE9]
          Length = 455

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 219/422 (51%), Positives = 296/422 (70%), Gaps = 5/422 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DL SR+VF ++AL+VYR GT+IP+  I+     + F S+S GI G FNMFSGGA+ R +V
Sbjct: 26  DLTSRLVFLLLALVVYRLGTHIPVSGINPNVMEQLFSSQSGGIIGFFNMFSGGALSRFSV 85

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYIS+SII+QL+ +T+PSLE LKKEG+ GR+ I QYTRY TVL+  LQA  IA 
Sbjct: 86  FALGIMPYISSSIIMQLMTSTIPSLEALKKEGDAGRRKITQYTRYGTVLIATLQALAIAS 145

Query: 142 GLK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
            L+       G++      FVF+T+I+L+ GTMF++WLGEQIT RG+GNG+S+IIF+GIV
Sbjct: 146 TLQGYMQQYPGLIYTPGPMFVFTTVISLVTGTMFVMWLGEQITERGLGNGISIIIFAGIV 205

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP++L  + EL     IS    ++I +  + V  LV+F ERAQRR+ + Y KRQVGN+
Sbjct: 206 AGLPTALAGIFELVSQNQISALATMIIIALVIGVTMLVVFVERAQRRITVNYAKRQVGNK 265

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           +     S+LPLK+N AGV+P IFASS++LLPAT + +   +    W+  L  SL  G+  
Sbjct: 266 IMGGQSSHLPLKINMAGVIPPIFASSIILLPATAIQWFSGAKQVRWLSDLSASLHPGQPL 325

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y  L++  ++FF FFYTA+VFN +E ADNLKK G F+PGIRPG  TA +ID +L R+T+V
Sbjct: 326 YTTLFAALVIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGQNTAKYIDKILMRLTLV 385

Query: 378 GAGYLVCVCIFPEAL-IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
           GA Y+  VC+ PE L +    VP +  GTSLLIIV V +D + Q+Q YL++ QY+ + KK
Sbjct: 386 GAIYITLVCLMPEFLRMQWRNVPFNFGGTSLLIIVVVAMDFMAQVQAYLMSHQYDALLKK 445

Query: 437 SR 438
           S 
Sbjct: 446 SN 447


>gi|313496839|gb|ADR58205.1| SecY [Pseudomonas putida BIRD-1]
          Length = 429

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 292/419 (69%), Gaps = 1/419 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 3   ELWARLRFLFMAIIVYRIGAHIPVPGINPDRLADLFRQNEGTILSLFNMFSGGALERMSI 62

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY TV+L ++QA G+++
Sbjct: 63  FALGIMPYISASIIMQLMTAVSPQLEQLKKEGEAGRRKISQYTRYGTVILALVQAIGMSI 122

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QG+       F    + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 123 GLAN-QGVAFSVGLGFHVVAVSTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 181

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ I    VA+I  V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 182 RAIGQSFESARTGDINIFALVAIGLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAA 241

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  S+  G+   ++L
Sbjct: 242 QTSHLPLKVNMAGVIPAIFASSILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILL 301

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +S  I+FF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 302 FSAGIIFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 361

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           ++ VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K
Sbjct: 362 MMAVCLLPQFLVVAANVPFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLK 420


>gi|127511112|ref|YP_001092309.1| preprotein translocase subunit SecY [Shewanella loihica PV-4]
 gi|126636407|gb|ABO22050.1| protein translocase subunit secY/sec61 alpha [Shewanella loihica
           PV-4]
          Length = 446

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/422 (49%), Positives = 296/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKARLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFNQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG  QA GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTFQAIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNLGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LLI     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLIAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   +   +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTLAQWFGQNEGLSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYATAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|121592833|ref|YP_984729.1| preprotein translocase subunit SecY [Acidovorax sp. JS42]
 gi|222109613|ref|YP_002551877.1| preprotein translocase subunit SecFY [Acidovorax ebreus TPSY]
 gi|120604913|gb|ABM40653.1| protein translocase subunit secY/sec61 alpha [Acidovorax sp. JS42]
 gi|221729057|gb|ACM31877.1| preprotein translocase, SecY subunit [Acidovorax ebreus TPSY]
          Length = 439

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/404 (51%), Positives = 279/404 (69%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGIDPAQLQQLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   VP+ E LKKEGE GR+ I QYTRY T+ L I Q+ GIAV L++  G+V    + 
Sbjct: 91  QLMTYVVPTFEQLKKEGEAGRRKITQYTRYGTLGLAIFQSLGIAVALESSAGLVLSPGFG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  GTMFL+WLGEQIT RG+GNG+S++IF+GI AGLPSS+  +LEL R G++
Sbjct: 151 FRLTAVVSLTAGTMFLMWLGEQITERGLGNGISILIFAGIAAGLPSSIGGLLELVRTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    + I      V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 SILAAIFIVIVVGLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPATI+ +     S  W+  +  +L  G+  Y++ Y+  I+FF FFYTA+
Sbjct: 271 PPIFASSIILLPATIVNWFSAGESMRWLRDISAALTPGQPVYVMFYAAAIIFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPG+ TA +ID +L R+T+ GA Y+  VC+ PE LI   
Sbjct: 331 VFNSRETADNLKKSGAFIPGIRPGEHTARYIDKILVRLTLAGAVYITFVCLLPEFLILKY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 391 NVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 434


>gi|212634849|ref|YP_002311374.1| preprotein translocase subunit SecY [Shewanella piezotolerans WP3]
 gi|212556333|gb|ACJ28787.1| Preprotein translocase, SecY subunit [Shewanella piezotolerans WP3]
          Length = 446

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/422 (49%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFNQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG  QA GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTFQAIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNLGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G IS  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDISVLVLLLLAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYATAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWQVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|91786405|ref|YP_547357.1| preprotein translocase subunit SecY [Polaromonas sp. JS666]
 gi|91695630|gb|ABE42459.1| protein translocase subunit secY/sec61 alpha [Polaromonas sp.
           JS666]
          Length = 439

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 218/432 (50%), Positives = 303/432 (70%)

Query: 9   VSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLF 68
            S+   A   +  DL++R+VF ++AL+VYR G +IP+P ID     + F+ +  GI  LF
Sbjct: 3   TSSAQIAKTGKYGDLRNRLVFLLLALVVYRIGAHIPVPGIDPGQLKELFKGQQGGILNLF 62

Query: 69  NMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYAT 128
           NMFSGGA+ R  VF+LGIMPYISASII+QL+   VP+ E +KKEGE GR+ I QYTRY T
Sbjct: 63  NMFSGGALSRFTVFALGIMPYISASIIMQLLTYVVPTFEQMKKEGESGRRKITQYTRYGT 122

Query: 129 VLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           + L + Q+ GIAV L++  G+V    + F  + + +L  GTMFL+WLGEQIT RG+GNG+
Sbjct: 123 LALALFQSMGIAVALESSPGLVLVPGFGFRMTAVFSLTAGTMFLMWLGEQITERGLGNGI 182

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           S++IF+GI AGLP ++  +LEL R G++S  + ++I +  V V   V+F ER QR++L+ 
Sbjct: 183 SILIFAGIAAGLPGAMGGLLELVRTGAMSVLVAIVIVAVVVLVTYFVVFVERGQRKILVN 242

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y +RQVGN+++    S+LPLKLN AGV+P IFASS++LLPAT++G+     S  W+  + 
Sbjct: 243 YARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILLPATVVGWFSSGESMRWLKDIA 302

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
            +L  G+  Y++LY+  IVFF FFYTA+VFN +E ADNLKK G FIPGIRPGD+TA +ID
Sbjct: 303 GTLTPGQPIYVMLYASAIVFFCFFYTALVFNSRETADNLKKSGAFIPGIRPGDQTARYID 362

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            +L R+T+ GA Y+  VC+ PE LI    VP    GTSL+IIV V +D + Q+Q Y+++Q
Sbjct: 363 KILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGTSLMIIVVVTMDFMAQVQNYMMSQ 422

Query: 429 QYEGVFKKSRSK 440
           QYE + KK+  K
Sbjct: 423 QYESLLKKANFK 434


>gi|253995738|ref|YP_003047802.1| preprotein translocase subunit SecY [Methylotenera mobilis JLW8]
 gi|253982417|gb|ACT47275.1| preprotein translocase, SecY subunit [Methylotenera mobilis JLW8]
          Length = 440

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 221/423 (52%), Positives = 301/423 (71%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           ++  +LKSR++F + AL+VYR G +IP+P I+    +K F S+S GI G+FNMFSGGA+ 
Sbjct: 11  AKMGELKSRLLFVLGALVVYRLGAHIPVPGINPDELAKLFASQSGGILGMFNMFSGGALS 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R  VF+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I +YTRY TV+L + QA 
Sbjct: 71  RFTVFALGIMPYISASIIMQLMTAVSPRLEQLKKEGEAGRRAITKYTRYGTVVLAMFQAL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GIA+ L+    +V D    F  + +ITL+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIV
Sbjct: 131 GIAIMLEGQPNLVFDPGMAFRLTAVITLVSGTMFLMWLGEQITERGIGNGISIIIFAGIV 190

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP ++ S  E+   G+ S PL   +  +TV V ALV+F ER QR++ + Y KRQVGN+
Sbjct: 191 AGLPHAIGSTAEMVNTGAFSIPLAFFLLVATVLVTALVVFVERGQRKITVNYAKRQVGNK 250

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    ++LP+KLN AGV+P IFASS++L PAT+ G+   S S  W+  +  +L  G+  
Sbjct: 251 VYGGQTTHLPMKLNMAGVIPPIFASSIILFPATLAGWFGSSESTFWLKDVAAALSPGQPI 310

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++L++  I FF FFYTA+ FNPK+ ADNLKK G F+PGIRPGD+TA +ID ++ R+T+V
Sbjct: 311 YILLFAAAIFFFCFFYTALQFNPKDTADNLKKSGAFVPGIRPGDQTAKYIDRIMGRLTLV 370

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE LI     P    GTSLLIIV V +D + Q+Q +L++ QYEG+ +K+
Sbjct: 371 GAAYITLVCLLPEFLILKFNTPFYFGGTSLLIIVVVTMDFMTQVQSHLMSHQYEGLLRKA 430

Query: 438 RSK 440
             K
Sbjct: 431 NFK 433


>gi|254253498|ref|ZP_04946816.1| SecY protein [Burkholderia dolosa AUO158]
 gi|124896107|gb|EAY69987.1| SecY protein [Burkholderia dolosa AUO158]
          Length = 425

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 225/422 (53%), Positives = 304/422 (72%), Gaps = 7/422 (1%)

Query: 28  VFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIM 87
           +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA+ R  +F+LGIM
Sbjct: 1   MFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIM 60

Query: 88  PYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQ 147
           PYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   QA+GIA  L+N  
Sbjct: 61  PYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQAFGIAAALENQP 120

Query: 148 GIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSV 207
           G+V+D    F  +TI+TL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AG P+++  +
Sbjct: 121 GLVTDPGMLFRLTTIVTLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVGGL 180

Query: 208 LELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLP 267
            EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVGN+++    S+LP
Sbjct: 181 FELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLP 240

Query: 268 LKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIV----GLVDSLGHGRSFYMVL 321
           LKLN +GV+P IFASS++L PATI+G+   +  PT  WI      + ++L  G+  Y++L
Sbjct: 241 LKLNMSGVIPPIFASSIILFPATILGWFS-TGQPTGSWISNTLHNVAEALKPGQPVYVLL 299

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +LTR+T+ GA Y
Sbjct: 300 YTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDRILTRLTLAGAIY 359

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K 
Sbjct: 360 IVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKG 419

Query: 442 KN 443
            N
Sbjct: 420 GN 421


>gi|241763530|ref|ZP_04761582.1| preprotein translocase, SecY subunit [Acidovorax delafieldii 2AN]
 gi|241367261|gb|EER61601.1| preprotein translocase, SecY subunit [Acidovorax delafieldii 2AN]
          Length = 439

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/404 (51%), Positives = 280/404 (69%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRVGAHIPVPGIDPAQLQQLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   VP+ E LKKEGE GR+ I QYTRY T+ L + Q+ GIAV L++  G+V    + 
Sbjct: 91  QLMTYVVPTFEQLKKEGEAGRRKITQYTRYGTLGLALFQSLGIAVALESSVGLVLSPGFG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  GTMFL+WLGEQIT RG+GNG+S++IF+GI AGLPSS+  +LEL R G++
Sbjct: 151 FRMTAVVSLTAGTMFLMWLGEQITERGLGNGISILIFAGIAAGLPSSIGGLLELVRTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    + I      V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 SILAAIFIVLVVGLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPAT++ +     S  W+  +  +L  G+  Y++ Y+  IVFF FFYTA+
Sbjct: 271 PPIFASSIILLPATVVNWFSAGESMRWLKDISGALTPGQPIYVMFYAAAIVFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPG++TA +ID +L R+T+ GA Y+  VC+ PE LI   
Sbjct: 331 VFNSRETADNLKKSGAFIPGIRPGEQTARYIDKILVRLTLAGAVYITFVCLLPEFLILKY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 391 NVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 434


>gi|260914660|ref|ZP_05921126.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
 gi|260631259|gb|EEX49444.1| preprotein translocase [Pasteurella dagmatis ATCC 43325]
          Length = 441

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/420 (48%), Positives = 299/420 (71%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F +IALIV+R G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKNRLLFVLIALIVFRIGSFIPVPGIDAAVLAQLIEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GR+ I++YTRY+T++L  LQA GIA 
Sbjct: 78  FALGIMPYISASIIIQLLTTVHPALAELKKEGETGRRKISKYTRYSTLVLATLQAVGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V + D +F  + +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPNMLPGLVPNLDIWFYITAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   ++LLI     AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PSAIGQTIEQARQGQMHPLVLLLIAVIVFAVTYFVVFVERGQRRIKVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L PAT+  ++   SS  W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMAGVIPAIFASSIILFPATLAQWLGEGSSLEWLTDLSMLLHPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D I Q+Q +L++ +YE   KK+  K
Sbjct: 378 YITFVCLVPYVMTSAWNVQFYFGGTSLLIVVVVIMDFIAQVQSHLMSTKYESALKKANLK 437


>gi|319764619|ref|YP_004128556.1| preprotein translocase, secy subunit [Alicycliphilus denitrificans
           BC]
 gi|330826876|ref|YP_004390179.1| preprotein translocase subunit SecY [Alicycliphilus denitrificans
           K601]
 gi|317119180|gb|ADV01669.1| preprotein translocase, SecY subunit [Alicycliphilus denitrificans
           BC]
 gi|329312248|gb|AEB86663.1| preprotein translocase, SecY subunit [Alicycliphilus denitrificans
           K601]
          Length = 439

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 279/404 (69%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRVGAHIPVPGIDPAQLQQLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   +P+ E +KKEGE GR+ I QYTRY TV L + Q+ GIAV L++  G+V    + 
Sbjct: 91  QLMTYVLPTFEQMKKEGEAGRRKITQYTRYGTVGLAVFQSLGIAVALESSAGLVLSPGFG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  GTMFL+WLGEQIT RG+GNG+S++IF+GI AGLPSS+  +LEL R G++
Sbjct: 151 FRMTAMVSLTAGTMFLMWLGEQITERGLGNGISILIFAGIAAGLPSSIGGLLELVRTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    + I      V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN +GV+
Sbjct: 211 SILAAIFIVIVVALVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMSGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPATI+ +     S  W+  +  +L  G+  Y++ Y+  IVFF FFYTA+
Sbjct: 271 PPIFASSIILLPATIVNWFSAGESMRWLRDISGALTPGQPVYVMFYAAAIVFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPG+ TA +ID +L R+T+ GA Y+  VC+ PE LI   
Sbjct: 331 VFNSRETADNLKKSGAFIPGIRPGEHTARYIDKILVRLTLAGAVYITFVCLLPEFLILKY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 391 NVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 434


>gi|152978161|ref|YP_001343790.1| preprotein translocase subunit SecY [Actinobacillus succinogenes
           130Z]
 gi|150839884|gb|ABR73855.1| preprotein translocase, SecY subunit [Actinobacillus succinogenes
           130Z]
          Length = 441

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 305/429 (71%), Gaps = 1/429 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           N ++ +   +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFS
Sbjct: 9   NRSTQNGGNELKSRLLFVLGALIVFRIGSFIPVPGIDAAVLSQLIEQQKGTIIDMFNMFS 68

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R ++F+LGIMPYISASII+QL+A   P+L  L+KEGE GR+ I++YTRYAT+ L 
Sbjct: 69  GGALSRASIFALGIMPYISASIIIQLLATVSPTLGELRKEGESGRRKISKYTRYATLGLA 128

Query: 133 ILQAYGIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191
            LQA GI+ GL N   G+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+SLI
Sbjct: 129 TLQAIGISTGLPNMLPGLVPNLGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISLI 188

Query: 192 IFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPK 251
           IF+GIVAGLPS++   +E  R G +   ++LLI +   AV   V+F ER QRR+ ++Y K
Sbjct: 189 IFAGIVAGLPSAIGQTIEQARQGQMHPLVLLLIAAVVFAVTYFVVFVERGQRRIKVEYAK 248

Query: 252 RQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSL 311
           RQ G ++     ++LPLK+N A V+P+IFASS++L PAT++ +   SSS  W+  L   L
Sbjct: 249 RQQGRQILGGHSTHLPLKVNMASVMPAIFASSIILFPATLVSWFGESSSLEWLTNLSMML 308

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y+++Y++ I+FF+FFY+A+ FNP++ ADNLKK G FIPGIRPG++T+ +ID ++
Sbjct: 309 QPGQPIYLIVYAIAIMFFSFFYSAMQFNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIM 368

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T++G  Y+V VC+ P  +++   V     GTSLLI+V V++D I QIQ +L++ +YE
Sbjct: 369 TRLTLIGGLYVVFVCLVPYIMMSAWNVQFYFGGTSLLIVVVVIMDFIAQIQSHLMSSKYE 428

Query: 432 GVFKKSRSK 440
              KK+  K
Sbjct: 429 SALKKANLK 437


>gi|326793578|ref|YP_004311398.1| preprotein translocase, SecY subunit [Marinomonas mediterranea
           MMB-1]
 gi|326544342|gb|ADZ89562.1| preprotein translocase, SecY subunit [Marinomonas mediterranea
           MMB-1]
          Length = 443

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/417 (50%), Positives = 289/417 (69%), Gaps = 1/417 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L SRI F  +A+IVYR G +IP+P I+    S  F      I  LFN+FSGGA+ERM++
Sbjct: 17  ELWSRIRFVFLAIIVYRIGAHIPVPGINPDRLSALFDQNEGTILSLFNVFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGI+PYISASII+QL+    P LE LKKEGE GR+ I QYTRY TVLL ++Q+  +AV
Sbjct: 77  FALGILPYISASIIMQLLTVVSPQLEQLKKEGEAGRRKITQYTRYGTVLLALVQSASMAV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QGI   S   F    ++TL+ GT+FL+WLGEQ+T +GIGNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGISFSSGIEFYAVAVVTLVAGTVFLMWLGEQVTEKGIGNGISILIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S+L    E  R G I+   +LLI    +A +A V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 SALGQSFESARQGDINILALLLIGVLAIATVAFVVFIERGQRRITVNYAKRQQGKKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA+I  +        W+  +  +L  G+  Y++L
Sbjct: 256 QKSHLPLKVNMAGVIPPIFASSILLFPASIGQWFGQGEGMEWLQNVSLALAPGQPLYVLL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++ IVFF FFYTA+VFNPK+ ADNLKK G F+PGIRPGD TA +ID V+TR+T+ GA Y
Sbjct: 316 FAIAIVFFCFFYTALVFNPKDVADNLKKSGAFLPGIRPGDHTARYIDGVMTRLTLFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           +  V + P+  + +  VP    GTS+LI+V VV+D + Q+Q +L++ QYE + KKS 
Sbjct: 376 ITLVSLMPQFFVVLWNVPFYFGGTSMLIVVVVVMDFMSQVQSHLMSHQYESLMKKSN 432


>gi|167626019|ref|YP_001676313.1| preprotein translocase subunit SecY [Shewanella halifaxensis
           HAW-EB4]
 gi|167356041|gb|ABZ78654.1| preprotein translocase, SecY subunit [Shewanella halifaxensis
           HAW-EB4]
          Length = 446

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/422 (49%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFNQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG  QA GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTFQAIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNLGFSFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLLAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLKLN AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKLNMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYATAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|42524357|ref|NP_969737.1| preprotein translocase subunit SecY [Bdellovibrio bacteriovorus
           HD100]
 gi|39576566|emb|CAE80730.1| preprotein translocase SecY subunit [Bdellovibrio bacteriovorus
           HD100]
          Length = 442

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 219/438 (50%), Positives = 293/438 (66%), Gaps = 16/438 (3%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ RI+FT+  L +YR G ++P P +D  +    FQ++S GIFGLFN F+GGA
Sbjct: 6   SIAKNSDLRKRILFTLALLAIYRIGVHVPTPGVDGSAVLSFFQAQSQGIFGLFNTFTGGA 65

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + + ++F+LGIMPYIS+SII QL+ + +P LE LKKEGEQGR+ INQYTRYATV L I+Q
Sbjct: 66  LSQFSIFALGIMPYISSSIIFQLLTSAIPYLEALKKEGEQGRRKINQYTRYATVALAIIQ 125

Query: 136 AYGIAVGLKNGQG------IVSDSDYFFVFS--TIITLLGGTMFLVWLGEQITMRGIGNG 187
            YGI+  L N         +++ +  F  F   TIITL  GT F++WLGEQIT RGIGNG
Sbjct: 126 GYGISTWLMNSTSPDGHPLVIAPTVAFLPFQIMTIITLTAGTCFIMWLGEQITERGIGNG 185

Query: 188 VSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLI 247
            SLIIF+GI A +P     + EL R G +   L+LL+ +  VA+IA VI+ E AQRR+ +
Sbjct: 186 TSLIIFTGIAAAIPGGAQQLWELVRTGEMRFALVLLLVAFMVAIIAAVIYMEVAQRRITV 245

Query: 248 QYPKRQVGNRM--FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV 305
           QY +RQ G  M   Q   S+LP+KLN +GV+P IFASSLL+ PAT+  F++      W+ 
Sbjct: 246 QYSQRQGGGGMQSMQTPTSHLPIKLNISGVIPPIFASSLLMFPATMAQFVNTP----WLK 301

Query: 306 GLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTAL 365
            L DSL    + + +++   IVFF+FFYT IVFNP + A+NLKK+GGF+PG+R G  TA 
Sbjct: 302 ALQDSLNPSGAIFNIMFVALIVFFSFFYTEIVFNPNDVAENLKKYGGFVPGVRAGKSTAD 361

Query: 366 HIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYL 425
           +I  VL RV VVG  YL  +CI P  +++   VP    GTSLLI+V V LDT  QIQ ++
Sbjct: 362 YIQRVLERVNVVGCIYLCTICILPGIMVSQFNVPFQFGGTSLLILVGVALDTAQQIQSHM 421

Query: 426 IAQQYEGVFK--KSRSKK 441
           I Q+YEG  K  K RS++
Sbjct: 422 ITQKYEGFLKGAKIRSRR 439


>gi|255067438|ref|ZP_05319293.1| preprotein translocase, SecY subunit [Neisseria sicca ATCC 29256]
 gi|255048233|gb|EET43697.1| preprotein translocase, SecY subunit [Neisseria sicca ATCC 29256]
          Length = 448

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/433 (48%), Positives = 304/433 (70%), Gaps = 5/433 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           + +  S+  DLK R+ F + ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFS
Sbjct: 17  SLSGLSKFGDLKKRLTFLLGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGMLNMFS 76

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ER ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL 
Sbjct: 77  GGSLERFSIFAIGIMPYISASIIVQLASEIIPSLKALKKEGEAGRKVITKYTRYGTVLLA 136

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           ILQ++G+A  +   QG+V  +   F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII
Sbjct: 137 ILQSFGVATFVFQ-QGVVVTNSLEFHISTVVSLVTGTMFLMWLGEQITERGIGNGISLII 195

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
            +GI AG+PS +  +L L   GSI  P  + I    + +I +V++FE AQR++ + Y KR
Sbjct: 196 TAGIAAGIPSGIARLLALTSQGSIGMPTAVSIVIGALLLIYIVVYFESAQRKVPVHYAKR 255

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           Q+G+ + Q   +++P KLN AGV+P IFASS++L P+T++ +   + + + +  +   L 
Sbjct: 256 QIGSGVMQGSNTHMPFKLNMAGVIPPIFASSIILFPSTLLSWFGSNDTGSLLHKIAGLLQ 315

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
           HG++ Y++L++V I+FF +FYTA+VF+PKE A+NLKK G F+PGIRPG +T+ +++ V+ 
Sbjct: 316 HGQALYILLFTVTIIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGKQTSQYLEQVVL 375

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE- 431
           R+T+ GA Y+  +C+ PE L     VP  L GTSLLI+V V +D   QI  Y + QQYE 
Sbjct: 376 RLTLFGALYITTICLIPEFLTTALNVPFYLGGTSLLILVVVTMDFSTQINSYRMTQQYES 435

Query: 432 ---GVFKKSRSKK 441
              G+  KS S+K
Sbjct: 436 LMSGLDMKSLSRK 448


>gi|59710864|ref|YP_203640.1| preprotein translocase subunit SecY [Vibrio fischeri ES114]
 gi|197334051|ref|YP_002155016.1| preprotein translocase, SecY subunit [Vibrio fischeri MJ11]
 gi|59478965|gb|AAW84752.1| preprotein translocase membrane subunit [Vibrio fischeri ES114]
 gi|197315541|gb|ACH64988.1| preprotein translocase, SecY subunit [Vibrio fischeri MJ11]
          Length = 443

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/422 (49%), Positives = 295/422 (69%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  LFNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQQGTIIELFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P L  LKKEGE GR+ INQYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPPLAELKKEGESGRRKINQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+V++ D  F  +  ++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPSMIPGLVANPDMMFYLTATVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   ++  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PPAIGETIQQARQGELHVLLLLLIAVISFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIVGLVDSLGHGRSFY 318
              ++LPLK+N AGV+P+IFASS++L P T+  +   +   T  W+  +  +L  G+  Y
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGGNGEGTFGWLTDVSMALSPGQPLY 317

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++T  +ID V+TR+T+ G
Sbjct: 318 VMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTTKYIDKVMTRLTLAG 377

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQYE V KK+ 
Sbjct: 378 AMYITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKAN 437

Query: 439 SK 440
            K
Sbjct: 438 LK 439


>gi|225076415|ref|ZP_03719614.1| hypothetical protein NEIFLAOT_01460 [Neisseria flavescens
           NRL30031/H210]
 gi|224952263|gb|EEG33472.1| hypothetical protein NEIFLAOT_01460 [Neisseria flavescens
           NRL30031/H210]
          Length = 437

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 303/428 (70%), Gaps = 1/428 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           + +  S+  DLK R+VF + AL+V+R G +IP+P +D ++ +K ++  + GIFG+ NMFS
Sbjct: 6   SLSGLSKFGDLKKRLVFLLGALVVFRIGAHIPVPGVDAVALAKLYEGAANGIFGMLNMFS 65

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ER ++F++GIMPYISASIIVQL +  VPSL+ LKKEGE GRK+I +YTRY TVLL 
Sbjct: 66  GGSLERFSIFAIGIMPYISASIIVQLASEIVPSLKALKKEGEAGRKIITKYTRYGTVLLA 125

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           +LQ++G+A  +   QG+V  S   F  ST++ L+ GTMFL+WLGEQIT RGIGNG+SLII
Sbjct: 126 VLQSFGVATFVYQ-QGVVVTSSLEFHISTVVCLVTGTMFLMWLGEQITERGIGNGISLII 184

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
            +GIV+G+PS +V +L L   GS+S  + + I    + +I  V++FE AQR++ + Y KR
Sbjct: 185 TAGIVSGIPSGIVRMLTLTEQGSMSMLMAVSIVIGILLLIYAVVYFESAQRKVPVHYAKR 244

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           Q G+ M      ++P KLN AGV+P IFASS++L P+T++G+   +S+ +++  +   L 
Sbjct: 245 QFGSGMMPGQSIHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSNSTNSFLHKVAAMLQ 304

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
           HG+S Y++L++  I+FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ 
Sbjct: 305 HGQSLYIILFATTIIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVL 364

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+T+ GA Y+  +C+ PE L     VP  L GTSLLI+V V +D   QI  Y ++ QYE 
Sbjct: 365 RLTLFGALYITTICLIPEFLTTALKVPFYLGGTSLLILVVVTMDFRTQINSYRMSSQYED 424

Query: 433 VFKKSRSK 440
           +  +   K
Sbjct: 425 LMSRPDMK 432


>gi|260222208|emb|CBA31541.1| Preprotein translocase subunit secY [Curvibacter putative symbiont
           of Hydra magnipapillata]
          Length = 404

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 280/401 (69%)

Query: 40  GTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLI 99
           G +IP+P ID     + F+ +  GI  LFNMFSGGA+ R  +F+LGIMPYISASII+QL+
Sbjct: 2   GAHIPVPGIDPAQLQQLFKGQQGGILSLFNMFSGGALSRFTIFALGIMPYISASIIMQLL 61

Query: 100 AATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVF 159
              +P+ E LKKEGE GR+ I QYTRY T+ L + Q+ GIAV L+   G+V    + F  
Sbjct: 62  TYVLPAFEQLKKEGEGGRRKITQYTRYGTLGLALFQSLGIAVALEASAGLVISPGFGFRM 121

Query: 160 STIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTP 219
           +TI+TL  GTMFL+WLGEQIT RG+GNG+S++IF GI AGLP+++  +LEL R GS+S  
Sbjct: 122 TTIVTLTAGTMFLMWLGEQITERGLGNGISILIFGGIAAGLPNAVGGLLELVRTGSMSII 181

Query: 220 LMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSI 279
           + LLI      V   V++ ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+P I
Sbjct: 182 VALLIVVVVALVTYFVVYVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPI 241

Query: 280 FASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFN 339
           FASS++LLPATI  +     S  W+  +  +L  G+  Y++LY+  IVFF FFYTA+VFN
Sbjct: 242 FASSIILLPATIANWFSTGDSMRWLKDIASTLSPGQPVYVMLYAAAIVFFCFFYTALVFN 301

Query: 340 PKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVP 399
            +E ADNLKK G FIPGIRPGD+TA +ID +L R+T+ GA Y+  VC+ PE LI    VP
Sbjct: 302 SRETADNLKKSGAFIPGIRPGDQTAKYIDKILVRLTLAGAIYITFVCLLPEFLILKYNVP 361

Query: 400 VSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
               GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 362 FYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 402


>gi|294341222|emb|CAZ89623.1| Preprotein translocase subunit secY [Thiomonas sp. 3As]
          Length = 439

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/408 (53%), Positives = 290/408 (71%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           AL+VYR G +IP+P ID     + FQ+ S+GI GLFNMFSGGA+ R  VF+LGIMPYISA
Sbjct: 25  ALVVYRIGAHIPVPGIDPTHLQQLFQNNSSGILGLFNMFSGGALARFTVFALGIMPYISA 84

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SII+QL+   VPSLE LKKEGE GR+   QYTRY T++L + Q++GIAV L+   G+V  
Sbjct: 85  SIIMQLLTYVVPSLEALKKEGEAGRRKTTQYTRYFTLVLALFQSFGIAVALQASTGLVIS 144

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
               F  S ++TL  GTMFL+WLGEQIT RG+GNG+S+IIFSGIVAGLPS++  ++EL  
Sbjct: 145 PGIGFQLSAVLTLTSGTMFLMWLGEQITERGLGNGISIIIFSGIVAGLPSAIAGLMELVS 204

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            G++S  + L + +  V V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN 
Sbjct: 205 TGAMSVLVALFVLAIVVLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNM 264

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           AGV+P IFASS++LLPAT + +   +    W+  +  +L  G+  Y++LY+  I+FFAFF
Sbjct: 265 AGVIPPIFASSIILLPATAVSWFGAAKGMGWLKDIAGALSPGQPLYILLYATAIIFFAFF 324

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           YTA+VFN +E AD LKK G FIPGIRPG++TA  ID VL R+T+VGA Y+  VC+ PE L
Sbjct: 325 YTALVFNSRETADQLKKGGAFIPGIRPGEQTAKFIDKVLMRLTLVGAIYITLVCLLPEFL 384

Query: 393 IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +    VP S  GTSLLIIV V +D + Q+Q Y ++ QY+ + KK+  K
Sbjct: 385 VLKYNVPFSFGGTSLLIIVVVTMDFMAQVQAYAMSHQYDALLKKANFK 432


>gi|320352933|ref|YP_004194272.1| protein translocase subunit SecY/sec61 alpha [Desulfobulbus
           propionicus DSM 2032]
 gi|320121435|gb|ADW16981.1| protein translocase subunit secY/sec61 alpha [Desulfobulbus
           propionicus DSM 2032]
          Length = 434

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/427 (49%), Positives = 290/427 (67%), Gaps = 9/427 (2%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DL+ R+VFT++ L+VYR G  IP P I+  + +  F+  ++ +FG+FNMFSGGA+E  ++
Sbjct: 12  DLRKRVVFTLLMLLVYRMGVQIPTPGINGEALTAFFEKNASTLFGMFNMFSGGALENFSI 71

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   VP LE L KEGE GR+ I QYTRY TV+L I+Q + IA 
Sbjct: 72  FALGIMPYISASIIIQLLTVVVPQLETLSKEGESGRRKITQYTRYGTVVLSIIQGFFIAT 131

Query: 142 GLK-----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGI 196
           GL+     NG  IV D    F   T++TL  GT F++WLGEQ+T RGIGNG+SLIIFSGI
Sbjct: 132 GLEGMTSPNGVPIVIDPSLHFKLMTVLTLTSGTAFIMWLGEQMTERGIGNGISLIIFSGI 191

Query: 197 VAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGN 256
           VA +PS++ + +EL + G +S   + LI +    ++A +IF E +QRR+ IQY KR VG 
Sbjct: 192 VARMPSAVANTIELIKTGELSLIFVPLILALMFLIVAFIIFVETSQRRIPIQYAKRVVGR 251

Query: 257 RMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRS 316
           R++    S+LPLK+N +GV+P IFASS+++ PATI  F+ +     W+  +  +   G  
Sbjct: 252 RVYGGQASHLPLKINVSGVIPPIFASSIMMFPATIGSFVHID----WVQRISAAFSPGTV 307

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
           +Y +LY   IVFF FFY A+ F   + A+NLKK+GGFIPGIRPG RT+  +D  L R+TV
Sbjct: 308 YYYLLYVGMIVFFCFFYAAVSFKADDVAENLKKNGGFIPGIRPGKRTSEFLDSTLIRLTV 367

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
           VGA YL  VC+ P  LIA   VP    GT+LLI+V V +DTI QI+ +LI + Y+G  K 
Sbjct: 368 VGAIYLSAVCVMPTLLIAELKVPFYFGGTALLIVVGVAIDTISQIESHLIMRNYDGFMKN 427

Query: 437 SRSKKKN 443
           +R + +N
Sbjct: 428 NRIRGRN 434


>gi|296137045|ref|YP_003644287.1| preprotein translocase, SecY subunit [Thiomonas intermedia K12]
 gi|295797167|gb|ADG31957.1| preprotein translocase, SecY subunit [Thiomonas intermedia K12]
          Length = 439

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/408 (53%), Positives = 290/408 (71%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           AL+VYR G +IP+P ID     + FQ+ S+GI GLFNMFSGGA+ R  VF+LGIMPYISA
Sbjct: 25  ALVVYRIGAHIPVPGIDPTHLQQLFQNNSSGILGLFNMFSGGALARFTVFALGIMPYISA 84

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SII+QL+   VPSLE LKKEGE GR+   QYTRY T++L + Q++GIAV L+   G+V  
Sbjct: 85  SIIMQLLTYVVPSLEALKKEGEAGRRKTTQYTRYFTLVLALFQSFGIAVALQASPGLVIS 144

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
               F  S ++TL  GTMFL+WLGEQIT RG+GNG+S+IIFSGIVAGLPS++  ++EL  
Sbjct: 145 PGIGFQLSAVLTLTSGTMFLMWLGEQITERGLGNGISIIIFSGIVAGLPSAIAGLMELVS 204

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            G++S  + L + +  V V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN 
Sbjct: 205 TGAMSVLVALFVLAIVVLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNM 264

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           AGV+P IFASS++LLPAT + +   +    W+  +  +L  G+  Y++LY+  I+FFAFF
Sbjct: 265 AGVIPPIFASSIILLPATAVSWFGAAKGMGWLKDIAGALSPGQPLYILLYATAIIFFAFF 324

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           YTA+VFN +E AD LKK G FIPGIRPG++TA  ID VL R+T+VGA Y+  VC+ PE L
Sbjct: 325 YTALVFNSRETADQLKKGGAFIPGIRPGEQTAKFIDKVLMRLTLVGAIYITLVCLLPEFL 384

Query: 393 IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           +    VP S  GTSLLIIV V +D + Q+Q Y ++ QY+ + KK+  K
Sbjct: 385 VLKYNVPFSFGGTSLLIIVVVTMDFMAQVQAYAMSHQYDALLKKANFK 432


>gi|157960034|ref|YP_001500068.1| preprotein translocase subunit SecY [Shewanella pealeana ATCC
           700345]
 gi|157845034|gb|ABV85533.1| preprotein translocase, SecY subunit [Shewanella pealeana ATCC
           700345]
          Length = 446

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/422 (49%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ER ++
Sbjct: 17  ELKTRLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFNQQKGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTRY T++LG  QA GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRYGTLVLGTFQAIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNLGFSFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLLAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYATAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|84394570|ref|ZP_00993274.1| preprotein translocase SecY [Vibrio splendidus 12B01]
 gi|86148808|ref|ZP_01067075.1| preprotein translocase SecY [Vibrio sp. MED222]
 gi|218710729|ref|YP_002418350.1| preprotein translocase subunit SecY [Vibrio splendidus LGP32]
 gi|84374790|gb|EAP91733.1| preprotein translocase SecY [Vibrio splendidus 12B01]
 gi|85833398|gb|EAQ51589.1| preprotein translocase SecY [Vibrio sp. MED222]
 gi|218323748|emb|CAV20102.1| SecY, Preprotein translocase subunit SecY [Vibrio splendidus LGP32]
          Length = 444

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 294/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F  +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFDQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+L I   + AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLFIAVLSFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|308048011|ref|YP_003911577.1| protein translocase subunit secY/sec61 alpha [Ferrimonas balearica
           DSM 9799]
 gi|307630201|gb|ADN74503.1| protein translocase subunit secY/sec61 alpha [Ferrimonas balearica
           DSM 9799]
          Length = 439

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 296/420 (70%), Gaps = 2/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R+ F + A+IV+R G+++P+P ID    ++ F+ +   I  +FNMFSGGA+ER ++
Sbjct: 17  ELKARLWFVLGAIIVFRAGSFVPIPGIDAAVLAELFKQQQGTIVSMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P++  LKKEGE GR+ INQYTR+ T++L   Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPAMAELKKEGESGRRKINQYTRWGTLVLATFQSIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IFSGIVAGL
Sbjct: 137 GLPSMLPGLVVNPGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFSGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G +   L+L +      + A V+F ER QRR+++ Y KRQ G R+F 
Sbjct: 197 PSAIGQTAEQARQGEMHLILLLGLVVIVSLITAFVVFMERGQRRIVVNYAKRQQGRRVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  + D +     +  +  +L  G+  Y++
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTLAQWFDKNQGGI-LSDISLALSPGQPLYVM 315

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V IVFF FFYTA+VFNP+E ADNLKK G FIPGIRPG++TA +ID V+TR+T+ GA 
Sbjct: 316 IYAVAIVFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTARYIDKVMTRLTLAGAA 375

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++  T VP    GTSLLI+V V++D + Q+Q +L++ QYE V KK+  K
Sbjct: 376 YITFICLVPEFMMITTNVPFYFGGTSLLIMVVVIMDFMAQVQTHLMSSQYESVLKKANLK 435


>gi|261867274|ref|YP_003255196.1| preprotein translocase subunit SecY [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412606|gb|ACX81977.1| preprotein translocase, SecY subunit [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 441

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 301/420 (71%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLIEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+A+  P+L  L+KEGE GR+ I++YTRY+TV+L  LQA GI+ 
Sbjct: 78  FALGIMPYISASIIIQLLASVHPALAELRKEGESGRRKISKYTRYSTVVLATLQAVGIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPNMLPGLVPNLGFGFYFTAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R+G +   ++LLI    +AV   V+F ER  RR+ ++Y KRQ G ++  
Sbjct: 198 PAAVGQTIEQARLGQMHFLVLLLIAVIVLAVTYFVVFVERGHRRIKVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L PAT+  ++   SS  W+  L   L  G+  Y+V
Sbjct: 258 GHSTHLPLKVNMAGVIPAIFASSIILFPATLTQWVGQGSSLEWLTDLSMLLHPGQPLYLV 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+  I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++TR+T++G  
Sbjct: 318 VYASAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQIQ +L++ +YE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTSAWNVQFYFGGTSLLIVVVVIMDFIVQIQSHLMSTRYESALKKANLK 437


>gi|52426083|ref|YP_089220.1| preprotein translocase subunit SecY [Mannheimia succiniciproducens
           MBEL55E]
 gi|52308135|gb|AAU38635.1| SecY protein [Mannheimia succiniciproducens MBEL55E]
          Length = 441

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 301/421 (71%), Gaps = 1/421 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S + +LKSR++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFSGGA+ 
Sbjct: 14  SGSSELKSRLLFVLGALIVFRVGSFIPVPGIDAAVLAQLIEQQKGTIIDMFNMFSGGALS 73

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL+A   P+L  L+KEGE GR+ I++YTRYAT+ L  LQA 
Sbjct: 74  RASIFALGIMPYISASIIIQLLATVYPALNELRKEGESGRRKISKYTRYATLGLATLQAI 133

Query: 138 GIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGI 196
           GI+ GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GI
Sbjct: 134 GISTGLPNMLPGLVPNLGFGFYFTAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGI 193

Query: 197 VAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGN 256
           VAGLPS++   +E  R G +   ++LLI     AV   V+FFER QRR+ ++Y KRQ G 
Sbjct: 194 VAGLPSAIGQTIEQARQGQMHLLVLLLIAVIVFAVTYFVVFFERGQRRIKVEYAKRQQGR 253

Query: 257 RMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRS 316
           ++     ++LPLK+N AGV+P+IFASS++L PAT+  +    SS  W+  L   L  G+ 
Sbjct: 254 QILGGHSTHLPLKVNMAGVIPAIFASSIILFPATLTQWFGEGSSLEWLTDLSMLLHPGQP 313

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y+++Y++ I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++TR+T+
Sbjct: 314 LYLIVYAIAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTL 373

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
           +G  Y+  VC+ P  +++   V     GTSLLI+V V++D IVQIQ +L++ +YE   KK
Sbjct: 374 IGGLYITFVCLVPYIMMSAWNVQFYFGGTSLLIVVVVIMDFIVQIQSHLMSTKYESALKK 433

Query: 437 S 437
           +
Sbjct: 434 A 434


>gi|293602603|ref|ZP_06685046.1| preprotein translocase subunit SecY [Achromobacter piechaudii ATCC
           43553]
 gi|292818975|gb|EFF78013.1| preprotein translocase subunit SecY [Achromobacter piechaudii ATCC
           43553]
          Length = 421

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 219/414 (52%), Positives = 302/414 (72%)

Query: 27  IVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGI 86
           +VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ R ++F+LGI
Sbjct: 1   MVFLVLALVVYRLGTHIPVPGINPDALADLFRQNQGGILGLFNMFSGGALSRFSIFALGI 60

Query: 87  MPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNG 146
           MPYISASII+QL++  VPSLE LKKEGE GR+ I QYTRY TV+L ++QA GI+V L++ 
Sbjct: 61  MPYISASIIMQLMSVVVPSLEALKKEGESGRRKITQYTRYGTVVLALVQAVGISVALESQ 120

Query: 147 QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVS 206
           QG+V D    F F+T++TL+ GTMF++WLGEQIT RG+GNG+S++IF+GIVAGLP++L +
Sbjct: 121 QGLVIDPGMLFRFTTVVTLVTGTMFVMWLGEQITERGLGNGISILIFAGIVAGLPAALAA 180

Query: 207 VLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYL 266
           +L+L R  ++S    L I +  V V A V+F ER QR++ + Y KRQVGN+++    S+L
Sbjct: 181 LLDLVRTNAMSVLSALFIVALVVLVTAFVVFVERGQRKITVNYAKRQVGNKVYGGQSSHL 240

Query: 267 PLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFI 326
           PLKLN AGV+P IFASS++L PATI  +   S +  W+  L  +L   +  Y+ LYSV I
Sbjct: 241 PLKLNMAGVIPPIFASSIILFPATITSWFSSSENMRWLSDLAAALSPRQPLYITLYSVAI 300

Query: 327 VFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVC 386
           +FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+ GA Y+  VC
Sbjct: 301 IFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLAGAIYITLVC 360

Query: 387 IFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           + PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+  K
Sbjct: 361 LLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKANFK 414


>gi|90581698|ref|ZP_01237486.1| preprotein translocase SecY [Vibrio angustum S14]
 gi|330447017|ref|ZP_08310667.1| preprotein translocase SecY [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|90437113|gb|EAS62316.1| preprotein translocase SecY [Vibrio angustum S14]
 gi|328491208|dbj|GAA05164.1| preprotein translocase SecY [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 441

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/420 (49%), Positives = 295/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A++++R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGAILIFRAGSFVPIPGIDAAVLASLFEQQKGTIIEMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASIIVQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIIVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+V +    F F  +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPSMIPGLVHNPGPSFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   +E  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G R+F 
Sbjct: 198 PPAIGQTVEQARQGELHVLLLLLIAVISFAVIYFVVFMERGQRRIVVNYAKRQQGRRVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L P T+  +   S    W+  +  +L  G+  Y++
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQSEGLGWLSDISLALSPGQPLYVM 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++TA +ID V+TR+T+ GA 
Sbjct: 318 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTAKYIDKVMTRLTLAGAL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQYE V KK+  K
Sbjct: 378 YITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKANLK 437


>gi|251793847|ref|YP_003008579.1| preprotein translocase subunit SecY [Aggregatibacter aphrophilus
           NJ8700]
 gi|247535246|gb|ACS98492.1| preprotein translocase, SecY subunit [Aggregatibacter aphrophilus
           NJ8700]
          Length = 441

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 298/417 (71%), Gaps = 1/417 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKRRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLIEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+A   P+L  L+KEGE GR+ I++YTRY+TV+L  LQA GI+ 
Sbjct: 78  FALGIMPYISASIIIQLLATVHPALAELRKEGESGRRKISKYTRYSTVVLATLQAVGIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPNMLPGLVPNLGFGFYFTAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R+G +   ++LLI  +  AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PAAIGQTIEQARLGQMHVLVLLLIAVTVFAVTYFVVFVERGQRRIKVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L PAT+  +    SS  W+  L   L  G+  Y+V
Sbjct: 258 GHSTHLPLKVNMAGVIPAIFASSIILFPATLTQWGGQGSSLEWLTDLSMLLHPGQPLYLV 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+  I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++TR+T++G  
Sbjct: 318 VYAAAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQIQ +L++ +YE   KK+
Sbjct: 378 YVTFVCLVPYVMTSAWNVQFYFGGTSLLIVVVVIMDFIVQIQSHLMSTKYESALKKA 434


>gi|209693944|ref|YP_002261872.1| preprotein translocase subunit SecY [Aliivibrio salmonicida
           LFI1238]
 gi|208007895|emb|CAQ78025.1| preprotein translocase SecY subunit [Aliivibrio salmonicida
           LFI1238]
          Length = 443

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/422 (49%), Positives = 295/422 (69%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQQGTIIEMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P L  LKKEGE GR+ INQYTRY T++L   QA GI+ 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPPLAELKKEGESGRRKINQYTRYGTLVLATFQAIGIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+VS+ D  F  +  ++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPSMIPGLVSNPDMMFYLTATVSLITGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   ++  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PPAIGETIQQARQGELHVLLLLLIAVLSFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIVGLVDSLGHGRSFY 318
              ++LPLK+N AGV+P+IFASS++L P T+  +   +   T  W+  +  +L  G+  Y
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGGNGEGTFGWLTDVSMALSPGQPLY 317

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++T  +ID V+TR+T+ G
Sbjct: 318 VMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTTKYIDKVMTRLTLAG 377

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQYE V KK+ 
Sbjct: 378 AMYITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKAN 437

Query: 439 SK 440
            K
Sbjct: 438 LK 439


>gi|88861474|ref|ZP_01136100.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Pseudoalteromonas
           tunicata D2]
 gi|88816522|gb|EAR26351.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Pseudoalteromonas
           tunicata D2]
          Length = 442

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/422 (48%), Positives = 297/422 (70%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + A+I+YR G+++P+P ID    ++ F+ +   I  +FNMFSGGA+ER +V
Sbjct: 17  ELKRRLLFVLGAIIIYRLGSFVPIPGIDAAVLAEFFEQQKGTIVEMFNMFSGGALERASV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+    P++  LKKEGEQGRK I+QYTRYAT++L  +Q+ GIA 
Sbjct: 77  LALGIMPYISASIIMQLLTHIHPAMIELKKEGEQGRKKISQYTRYATLVLATVQSIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N  QG+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF GIVA L
Sbjct: 137 GLPNMMQGLVVNPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISVLIFVGIVANL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++ S  E+ R G ++  ++L+I     AV  LV+FFER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGSTAEMARQGDLNVLMLLVIAVIVFAVTYLVVFFERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSP--TWIVGLVDSLGHGRSFY 318
              ++LPLK+N AGV+P IFASS++L P TI  +      P    +  +  +L  G+  Y
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIASWFGQGEGPIADALQTISLALSPGQPLY 316

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
            ++ +  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ G
Sbjct: 317 AMVLAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSKYIDKVMTRLTLAG 376

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE +      P    GTS+LIIV V++D + Q+Q +L++ QY+ V KK+ 
Sbjct: 377 ALYITFICLVPEFMTMAWQTPFYFGGTSILIIVVVIMDFMAQVQTHLMSHQYDSVLKKAN 436

Query: 439 SK 440
            K
Sbjct: 437 LK 438


>gi|110833278|ref|YP_692137.1| preprotein translocase subunit SecY [Alcanivorax borkumensis SK2]
 gi|110646389|emb|CAL15865.1| Preprotein translocase SecY subunit [Alcanivorax borkumensis SK2]
          Length = 460

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/434 (48%), Positives = 301/434 (69%), Gaps = 18/434 (4%)

Query: 21  KDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMA 80
           ++L  RI F + AL+V+R G +IP+P ++  +  + F +    I GLFNMFSGG++ERM+
Sbjct: 22  RELWRRIGFLLGALVVFRVGAHIPVPGMNPEALQQMFNNNRDTILGLFNMFSGGSLERMS 81

Query: 81  VFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIA 140
           +F+LGIMPYI+ASI++QL+ A VP+LE L+KEGEQGR+ I QYTRY TV+LG +Q++G+ 
Sbjct: 82  IFALGIMPYITASIVIQLMTAVVPTLEQLRKEGEQGRRKITQYTRYLTVVLGAIQSFGMV 141

Query: 141 VGLKNGQGIVS----------DSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
            GL N QGI             S YF   ST++T   GT+FL+WLGEQIT RGIGNG+S+
Sbjct: 142 AGL-NSQGITLLPETASTMQLASFYFVAVSTLVT---GTVFLMWLGEQITERGIGNGISM 197

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           +IF+ IV+GLP ++    E  R G +S  +ML +F   +AVI  V++ ER QRR+ + Y 
Sbjct: 198 LIFASIVSGLPGAVAQTFESARTGDLSLIMMLFVFLVAMAVIFGVVYVERGQRRITVNYA 257

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTW----IVG 306
           +RQ G R++    S+LPLK+N AGV+P+IFASS+LL PA++  +   S+  +W    +  
Sbjct: 258 RRQQGRRVYAAQQSHLPLKVNMAGVIPAIFASSILLFPASLTQWFSDSNPDSWWGQALRN 317

Query: 307 LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALH 366
           + ++L  G   Y++L+++ IVFF +FYTA+VFNPK+ ADNLKK G +IPGIRPG+++A +
Sbjct: 318 VSEALLPGTPLYILLFTLAIVFFCYFYTALVFNPKDVADNLKKSGAYIPGIRPGEQSARY 377

Query: 367 IDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLI 426
           ID V+ R+T++GA Y+  VC+ P  L AV  VP  L GTSLLI+V VV+D   Q+  +L 
Sbjct: 378 IDTVMGRLTLIGAVYMTLVCLLPLGLQAVANVPFYLGGTSLLIVVVVVMDFWSQVNSHLT 437

Query: 427 AQQYEGVFKKSRSK 440
           + QYE + KKS  K
Sbjct: 438 STQYEKLMKKSNLK 451


>gi|269104032|ref|ZP_06156729.1| preprotein translocase SecY subunit [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163930|gb|EEZ42426.1| preprotein translocase SecY subunit [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 441

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/420 (49%), Positives = 295/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR+ F + A++++R G+++P+P ID    +  F+ +   I  LFNMFSGGA+ R ++
Sbjct: 18  ELKSRLFFVLGAILIFRAGSFVPIPGIDAAVLADLFEQQKGTIIELFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASIIVQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIIVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+V +    F F  +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPSMIPGLVVNPGLGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   +E  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G R+F 
Sbjct: 198 PPAIGQTVEQARQGELHVLLLLLIAVISFAVIYFVVFMERGQRRIVVNYAKRQQGRRVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L P T+  +   S +  W+  +  +L  G+  Y++
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQSENLGWLSDISLALSPGQPLYVM 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ GA 
Sbjct: 318 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLAGAL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQYE V KK+  K
Sbjct: 378 YITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKANLK 437


>gi|319944775|ref|ZP_08019039.1| preprotein translocase subunit SecY [Lautropia mirabilis ATCC
           51599]
 gi|319742024|gb|EFV94447.1| preprotein translocase subunit SecY [Lautropia mirabilis ATCC
           51599]
          Length = 446

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 215/423 (50%), Positives = 300/423 (70%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R+VF ++AL+V+R GT+IP+P I+  + ++ F ++  G+ GLFN+FSGGA+ R +V
Sbjct: 17  DLKRRLVFLLLALVVFRIGTHIPVPGINPDAMAELFGNQEGGVLGLFNLFSGGALSRFSV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   VPSL+ +KKEGE GR++I +YTR+AT+ L   QA GI+V
Sbjct: 77  FALGIMPYISASIIMQLLTVVVPSLDQIKKEGEAGRRIITKYTRWATLALATFQALGISV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++   +VSD  + F    +I+L+ GTMFL+WLGEQIT RG+GNG+SLIIFSGIV+GLP
Sbjct: 137 ALESQGNLVSDPGFMFRVVAVISLVTGTMFLMWLGEQITERGLGNGISLIIFSGIVSGLP 196

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++  +  L   G+++    L+I +  + V A V+F ER QRR+ I Y KRQVGN+++Q 
Sbjct: 197 GAIGGMGSLVSNGNMNPVAALIIMALVILVTAFVVFIERGQRRITINYAKRQVGNKIYQG 256

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSLGHGRSF 317
             SYLPLKLN AGV+P IFASS++L PAT+  +     S    V     +  +L  G+  
Sbjct: 257 QTSYLPLKLNMAGVIPPIFASSIILFPATLAQWFTSGDSENVAVRTLRDVAATLSPGQPV 316

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM+LY++ I+FF FFYTA+ +N ++ A+NLKK G  +PGIRPG++TA +ID VLTR+T V
Sbjct: 317 YMLLYAIAIIFFCFFYTALQYNSRDTAENLKKSGAMLPGIRPGEQTAKYIDKVLTRLTAV 376

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE LI    VP    GTSLLIIV V +D + Q+Q +L++ QYE + KK+
Sbjct: 377 GALYITLVCLLPEFLILEWNVPFYFGGTSLLIIVVVTMDFMAQVQTHLMSNQYESLLKKA 436

Query: 438 RSK 440
             K
Sbjct: 437 NFK 439


>gi|54307561|ref|YP_128581.1| preprotein translocase subunit SecY [Photobacterium profundum SS9]
 gi|46911981|emb|CAG18779.1| putative preprotein translocase, SecY subunit [Photobacterium
           profundum SS9]
          Length = 438

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/420 (48%), Positives = 297/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F + A++++R G+++P+P ID    +  F+ +   +  LFNMFSGGA+ER ++
Sbjct: 18  ELKTRLLFVLGAILIFRAGSFVPIPGIDAAVLADLFEQQKGTVIELFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASIIVQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIIVQLLTVVHPALAELKKEGESGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+V +    F F  +++L+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIVAGL
Sbjct: 138 GLPSMIPGLVLNPGLGFYFVAVVSLITGTMFLMWLGEQITERGIGNGISVIIFTGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   +E  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G R+F 
Sbjct: 198 PPAIGQTVEQARQGELHVLLLLLIAVISFAVIYFVVFMERGQRRIVVNYAKRQQGRRVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L P T+  +   + +  W+  +  +L  G+  Y++
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNENLGWLSDISLALSPGQPLYVM 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ GA 
Sbjct: 318 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLAGAM 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++QQYE V KK+  K
Sbjct: 378 YITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHMMSQQYESVLKKANLK 437


>gi|254449308|ref|ZP_05062753.1| preprotein translocase, SecY subunit [gamma proteobacterium
           HTCC5015]
 gi|198261067|gb|EDY85367.1| preprotein translocase, SecY subunit [gamma proteobacterium
           HTCC5015]
          Length = 449

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/430 (48%), Positives = 301/430 (70%), Gaps = 4/430 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           A+  +  ++++RI+F + AL++YR GTYI +P I+    +  F+S+S GI G+ ++F+GG
Sbjct: 12  ANLGQLTEVRNRILFLLFALLIYRVGTYITVPGINPRVMADLFESQSGGILGMVDVFAGG 71

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ RM++F+LG+MPYI+ASII+Q++    P    L+KEG+QG++ + QYTRY TVLL  +
Sbjct: 72  ALGRMSLFALGVMPYITASIIIQMMGHVHPPFVELRKEGQQGQRKLTQYTRYLTVLLATV 131

Query: 135 QAYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
           Q+ GI+V L+N    G  +V++    FVF+  ITL+ GTMFL+WLGEQIT RGIGNG+S+
Sbjct: 132 QSVGISVALQNPEVAGPSLVTNPGISFVFTATITLVTGTMFLMWLGEQITERGIGNGISM 191

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           +IF+GIVAGLP+++ +V EL   G +S PL+L +      V   VI  ER QRR+ I + 
Sbjct: 192 LIFAGIVAGLPTAIANVFELTSEGQMSYPLLLGVLVVAALVTYFVIVMERGQRRITINFA 251

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS 310
           KRQ G R +    S+LPLKLN AGV+P+IFA +++L P TI  F   S   +WI      
Sbjct: 252 KRQQGRRQYAAHSSHLPLKLNAAGVIPAIFAQAIILFPGTIASFAGNSGPTSWIRDAAAF 311

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G+  +M++Y   I+FF FFYTA+VFN ++ ADNLKK G FIPGIRPG++TA +ID V
Sbjct: 312 LAPGQPAHMIIYGAAIIFFCFFYTALVFNARDTADNLKKQGAFIPGIRPGEQTARYIDGV 371

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           +TR+TVVG+ Y+  VC+ P+ LI+   VP +  GT+LLI+V VV+D + Q+Q ++++ QY
Sbjct: 372 MTRLTVVGSLYITAVCLLPQVLISEFNVPFNFGGTALLIVVVVVMDFMAQLQAHMMSHQY 431

Query: 431 EGVFKKSRSK 440
           EG+ KKS  K
Sbjct: 432 EGLMKKSNLK 441


>gi|121609264|ref|YP_997071.1| preprotein translocase subunit SecY [Verminephrobacter eiseniae
           EF01-2]
 gi|121553904|gb|ABM58053.1| protein translocase subunit secY/sec61 alpha [Verminephrobacter
           eiseniae EF01-2]
          Length = 437

 Score =  417 bits (1073), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/404 (50%), Positives = 277/404 (68%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P ID     + F  +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGIDPAQLQRLFSGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   +P  E LKKEGE GR+ I QYTRY T+ L + Q+ GIAV L++  G+V      
Sbjct: 91  QLMTYVLPQFEQLKKEGEAGRRKITQYTRYGTLGLALFQSLGIAVALESSAGLVLSPGLG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  GTMFL+WLGEQIT RG+GNG+S++IFSGI AGLP S+  +LEL R G++
Sbjct: 151 FRMTAVVSLTAGTMFLMWLGEQITERGLGNGISILIFSGIAAGLPGSIGGLLELVRTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           S    + I      V   V+F ER  R++L+ + +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 SILAAIFIVIVVALVTYFVVFVERGLRKILVNHARRQVGNKVYGAQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAI 336
           P IFASS++LLPAT++ +     S  W+  +  +L  G+  Y++ Y+  I+FF FFYTA+
Sbjct: 271 PPIFASSIILLPATVVNWFSAGESMRWLKDISGALTPGQPIYVMFYAAAIIFFCFFYTAL 330

Query: 337 VFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVT 396
           VFN +E ADNLKK G FIPGIRPG++TA +ID +L R+T+ GA Y+  VC+ PE LI   
Sbjct: 331 VFNSRETADNLKKSGAFIPGIRPGEQTARYIDKILVRLTLAGAVYITFVCLLPEFLILKY 390

Query: 397 GVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+R K
Sbjct: 391 NVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKARFK 434


>gi|89076304|ref|ZP_01162645.1| preprotein translocase SecY [Photobacterium sp. SKA34]
 gi|89048008|gb|EAR53597.1| preprotein translocase SecY [Photobacterium sp. SKA34]
          Length = 441

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/420 (49%), Positives = 295/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A++++R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGAILIFRAGSFVPIPGIDAAVLASLFEQQKGTIIEMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASIIVQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIIVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+V +    F F  +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPSMIPGLVHNPGPSFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   +E  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G R+F 
Sbjct: 198 PPAIGQTVEQARQGELHVLLLLLIVVISFAVIYFVVFMERGQRRIVVNYAKRQQGRRVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L P T+  +   S    W+  +  +L  G+  Y++
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQSEGLGWLSDISLALSPGQPLYVM 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++TA +ID V+TR+T+ GA 
Sbjct: 318 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTAKYIDKVMTRLTLAGAL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQYE V KK+  K
Sbjct: 378 YITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKANLK 437


>gi|118602233|ref|YP_903448.1| protein translocase subunit secY/sec61 alpha [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567172|gb|ABL01977.1| protein translocase subunit secY/sec61 alpha [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 432

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 215/426 (50%), Positives = 295/426 (69%), Gaps = 4/426 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S   ++DL  RI+F + ALIV+R GT+I +P I   + +   Q +   I  +FNMFSGGA
Sbjct: 4   SLGLSQDLSKRILFLLGALIVFRLGTHITIPFISSAALASLVQDQQGTILDMFNMFSGGA 63

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           +ER+++F+LGIMPYISASII+QL+ + VP LE LKKEGE G++ I QYTR  TV+L I Q
Sbjct: 64  LERLSIFTLGIMPYISASIIIQLMTSIVPKLEQLKKEGETGKRKITQYTRIGTVVLAIFQ 123

Query: 136 AYGIAVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191
           +YGI++ L++    G  +V+  D+ F   T++TL  GT+FL+WLGEQIT +GIGNG+S+I
Sbjct: 124 SYGISIALQSQSSGGIALVTQGDFTFNMVTVVTLTTGTLFLMWLGEQITEKGIGNGISMI 183

Query: 192 IFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPK 251
           IF+GIV+GLPS+L S L L   G ++  L++++   T+ V A V+F ER QRR+ + Y K
Sbjct: 184 IFAGIVSGLPSALGSTLSLVATGELTIILVVILLIMTLLVTAFVVFMERGQRRITVNYAK 243

Query: 252 RQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSL 311
           RQ G +M     SYLPLK+N AGV+P IFASS++L PAT+ G+   S    W+  L  S+
Sbjct: 244 RQQGRKMVSGQSSYLPLKINMAGVIPPIFASSIILFPATLGGWFSQSEGMDWLADLTASI 303

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++ Y + IVFF FFYTA+ F+ K+ ADNL+K GGFIPGIRPG  +A +ID V+
Sbjct: 304 SPGQPLYVLFYGLAIVFFTFFYTALTFDSKDTADNLRKSGGFIPGIRPGKHSADYIDLVM 363

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           +R+T  GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D I Q Q +L++ QYE
Sbjct: 364 SRLTASGAIYITAVCLLPEFLILYWNVPFYFGGTSLLIIVVVVMDFIAQAQSHLMSNQYE 423

Query: 432 GVFKKS 437
            + KK+
Sbjct: 424 SLMKKT 429


>gi|90414976|ref|ZP_01222938.1| preprotein translocase SecY [Photobacterium profundum 3TCK]
 gi|90323915|gb|EAS40515.1| preprotein translocase SecY [Photobacterium profundum 3TCK]
          Length = 438

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/420 (48%), Positives = 297/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F + A++++R G+++P+P ID    +  F+ +   +  LFNMFSGGA+ER ++
Sbjct: 18  ELKTRLLFVLGAILIFRAGSFVPIPGIDAAVLADLFEQQKGTVIELFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASIIVQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIIVQLLTVVHPALAELKKEGESGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL +   G+V +    F F  +++L+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIVAGL
Sbjct: 138 GLPSMIPGLVINPGLGFYFVAVVSLITGTMFLMWLGEQITERGIGNGISVIIFTGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   +E  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G R+F 
Sbjct: 198 PPAIGQTVEQARQGELHVLLLLLIAVISFAVIYFVVFMERGQRRIVVNYAKRQQGRRVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L P T+  +   + +  W+  +  +L  G+  Y++
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNENLGWLSDISLALSPGQPLYVM 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ GA 
Sbjct: 318 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLAGAM 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++QQYE V KK+  K
Sbjct: 378 YITFICLIPEFMMIAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHMMSQQYESVLKKANLK 437


>gi|322515614|ref|ZP_08068593.1| preprotein translocase subunit SecY [Actinobacillus ureae ATCC
           25976]
 gi|322118324|gb|EFX90599.1| preprotein translocase subunit SecY [Actinobacillus ureae ATCC
           25976]
          Length = 440

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/420 (49%), Positives = 296/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R + 
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELVRQQQGTIIDMFNMFSGGALSRAST 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASIIVQL+ A  P L  LKKEGE GR+ I++YTRYAT+LL  +Q+ GI++
Sbjct: 77  FALGIMPYISASIIVQLLTAIHPPLAELKKEGEAGRRKISKYTRYATLLLAFIQSIGISI 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N  QG+V +    F  +++I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMLQGLVPNPSILFYVTSVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G IS  ++LL+     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEQARQGEISPLVLLLVAVIAFAVTYFVVFVERGQRRIVVNYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P+IFASS++L PA+I  +   S    W+  L   L  G+  Y+V
Sbjct: 257 ARSSHLPLKVNMAGVIPAIFASSIILFPASISQWFGQSEGLEWLFDLSQLLQPGQPLYIV 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA 
Sbjct: 317 LFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q +L++ QY+ V KK+  K
Sbjct: 377 YITFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHLMSLQYDSVLKKANLK 436


>gi|83648832|ref|YP_437267.1| preprotein translocase subunit SecY [Hahella chejuensis KCTC 2396]
 gi|83636875|gb|ABC32842.1| Preprotein translocase subunit SecY [Hahella chejuensis KCTC 2396]
          Length = 443

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/420 (49%), Positives = 293/420 (69%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L++R+ F ++A++VYR G +IP+P I+    +  F      I  LFNMFSGGA+ERM++
Sbjct: 17  ELRARLWFVLLAILVYRVGAHIPVPGINPDRLAALFDQNQGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P LE LKKEGE GR+ I+QYTRY TVLL  +QA+GI+V
Sbjct: 77  FALGIMPYISASIIMQLLTVVSPQLEQLKKEGEAGRRKISQYTRYGTVLLATIQAFGISV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL N QG+   +   F F  ++T + G +FL+W+GEQIT RGIGNG+SL+IF+GIVAGLP
Sbjct: 137 GLAN-QGVTFTTGPSFFFVAVVTFVCGAVFLMWVGEQITERGIGNGISLLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R+G +S   ++ +    VA+IA V+F ER QRR+ I Y +RQ G +++  
Sbjct: 196 GAVGQTFEQARLGEMSVLTLIAVAVFAVAIIAFVVFMERGQRRITINYARRQQGRKVYAQ 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA++  +        W+  +  +LG  +  Y++L
Sbjct: 256 QSSHLPLKVNMAGVIPPIFASSILLFPASLGQWFGKGEGMEWLQVVSQALGPSQPLYIIL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++ +VFF FFYTA+++NPKE ADNLK+ G F+PGIRPG+ TA +ID VLTR+TV GA Y
Sbjct: 316 FAIAVVFFCFFYTALMYNPKEVADNLKRSGAFVPGIRPGENTAKYIDGVLTRLTVFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  V + P+ L+    VP    GTSLLI+V VV+D + Q+Q +L++ QY+ + KKS  K 
Sbjct: 376 IAAVALLPQFLVVSWNVPFYFGGTSLLIVVVVVMDFMAQVQSHLMSHQYDSLMKKSNLKN 435


>gi|311109582|ref|YP_003982435.1| preprotein translocase, SecY subunit [Achromobacter xylosoxidans
           A8]
 gi|310764271|gb|ADP19720.1| preprotein translocase, SecY subunit [Achromobacter xylosoxidans
           A8]
          Length = 441

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 309/423 (73%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           +R  DLK R+VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ 
Sbjct: 12  ARYGDLKRRLVFLVLALVVYRLGTHIPVPGINPDALADLFRQNQGGILGLFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL++  VPSLE+LKKEGE GR+ I QYTRY TV+L ++QA 
Sbjct: 72  RFSIFALGIMPYISASIIMQLMSVVVPSLESLKKEGEAGRRKITQYTRYGTVVLALVQAV 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI+V L++ QG+V D    F F+T++TL+ GTMF++WLGEQIT RG+GNG+S++IF+GIV
Sbjct: 132 GISVALESQQGLVIDPGMLFRFTTVVTLVTGTMFVMWLGEQITERGLGNGISILIFAGIV 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP++L ++L+L R  S+S    L I +  V V A V+F ER QR++ + Y KRQVGN+
Sbjct: 192 AGLPAALAALLDLVRTNSMSVLSALFIVALVVLVTAFVVFVERGQRKITVNYAKRQVGNK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLKLN AGV+P IFASS++L PATI  +   S +  W+  L  +L   +  
Sbjct: 252 VYGGQSSHLPLKLNMAGVIPPIFASSIILFPATITSWFSSSENMRWLSDLAAALSPRQPL 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ LYSV I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+ 
Sbjct: 312 YITLYSVAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLA 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+
Sbjct: 372 GAIYITLVCLLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKA 431

Query: 438 RSK 440
             K
Sbjct: 432 NFK 434


>gi|319639569|ref|ZP_07994316.1| preprotein translocase SECY subunit [Neisseria mucosa C102]
 gi|317399140|gb|EFV79814.1| preprotein translocase SECY subunit [Neisseria mucosa C102]
          Length = 437

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/431 (47%), Positives = 304/431 (70%), Gaps = 7/431 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           + +  S+  DLK R+VF + AL+V+R G +IP+P +D ++ +K ++  + GIFG+ NMFS
Sbjct: 6   SLSGLSKFGDLKKRLVFLLGALVVFRIGAHIPVPGVDAVALAKLYEGAANGIFGMLNMFS 65

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ER ++F++GIMPYIS+SIIVQL +  +PSL+ LKKEGE GRK+I +YTRY TVLL 
Sbjct: 66  GGSLERFSIFAIGIMPYISSSIIVQLASEIIPSLKALKKEGEAGRKIITKYTRYGTVLLA 125

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           +LQ++G+A  +   QG+V  S   F  ST++ L+ GTMFL+WLGEQIT RGIGNG+SLII
Sbjct: 126 VLQSFGVATFVYQ-QGVVVTSSLEFHISTVVCLVTGTMFLMWLGEQITERGIGNGISLII 184

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIAL---VIFFERAQRRLLIQY 249
            +GIV+G+PS +V +L L   GS+S   ML+  S  + ++ L   V++FE AQR++ + Y
Sbjct: 185 TAGIVSGIPSGIVRLLTLTEQGSMS---MLMAVSIVIGILLLVYAVVYFESAQRKVPVHY 241

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KRQ G+ M      ++P KLN AGV+P IFASS++L P+T++G+   +S+ + +  +  
Sbjct: 242 AKRQFGSGMMPGQSIHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSNSTNSILHKVAA 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
            L HG+  Y+VL++  I+FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ 
Sbjct: 302 MLQHGQPLYIVLFATTIIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEK 361

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           V+ R+T+ GA Y+  +C+ PE L     VP  L GTSLLI+V V +D   QI  Y+++ Q
Sbjct: 362 VVLRLTLFGALYITTICLIPEFLTTALNVPFYLGGTSLLILVVVTMDFRTQINSYVMSSQ 421

Query: 430 YEGVFKKSRSK 440
           YE +  +   K
Sbjct: 422 YEDLMSRPDMK 432


>gi|289209309|ref|YP_003461375.1| preprotein translocase, SecY subunit [Thioalkalivibrio sp. K90mix]
 gi|288944940|gb|ADC72639.1| preprotein translocase, SecY subunit [Thioalkalivibrio sp. K90mix]
          Length = 448

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 216/424 (50%), Positives = 302/424 (71%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+ R++F + AL+VYR GT+IP+P I+ ++ S+ F+ +S  I  +FNMFSGGA+ER+++
Sbjct: 18  ELRQRLLFVLGALVVYRIGTFIPVPGINPVAVSQFFEQQSGTILDMFNMFSGGALERLSI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LG+MPYISA+II+QL+AATVP+L+ LKKEGEQGR+ I QYTRY TV L + Q+ GI +
Sbjct: 78  FALGVMPYISAAIIMQLLAATVPALQQLKKEGEQGRRKITQYTRYGTVALALFQSIGIGI 137

Query: 142 GLKNGQGIVS-----DSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGI 196
            L NGQ I       +    F+F+ +++L+ GT+FL+WLGEQIT RGIGNG+S+IIF+GI
Sbjct: 138 AL-NGQTIQGMPMALNPGPIFIFTVVVSLVTGTLFLMWLGEQITERGIGNGISIIIFAGI 196

Query: 197 VAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGN 256
           VAGLP ++   LEL R G ++   ++++    +AV A V+F ER QRR+ I Y KRQVG 
Sbjct: 197 VAGLPGAIGGTLELARTGELAAAFVVILIVLALAVTAFVVFVERGQRRVTINYAKRQVGR 256

Query: 257 RMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRS 316
           ++     S+LPLKLN AGV+P IFASS++L P+T+  +   +    W+  L  +L  G+ 
Sbjct: 257 KVVGGQSSHLPLKLNMAGVIPPIFASSIILFPSTLGQWFGQAEGMDWLRELSTTLAPGQP 316

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y+  Y+  I+FF FFYTA+VFN ++ A+NLKK G FIPGIRPG +T   ID V+TR+T 
Sbjct: 317 LYVGFYAAAIIFFCFFYTALVFNSRDTAENLKKQGAFIPGIRPGVQTERFIDGVMTRLTA 376

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
           VGA Y+  VC+ PE LI    VP    GTSLLIIV VV+D + Q+Q +L++ QYEG+ KK
Sbjct: 377 VGAVYITAVCLLPEFLILYWNVPFYFGGTSLLIIVIVVMDFMAQLQSHLVSHQYEGLMKK 436

Query: 437 SRSK 440
           +  K
Sbjct: 437 ANLK 440


>gi|254427344|ref|ZP_05041051.1| preprotein translocase, SecY subunit [Alcanivorax sp. DG881]
 gi|196193513|gb|EDX88472.1| preprotein translocase, SecY subunit [Alcanivorax sp. DG881]
          Length = 440

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/434 (48%), Positives = 300/434 (69%), Gaps = 18/434 (4%)

Query: 21  KDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMA 80
           ++L  RI F + AL+V+R G +IP+P ++  +  + F +    I GLFNMFSGG++ERM+
Sbjct: 2   RELWRRIGFLLGALVVFRVGAHIPVPGMNPEALQQMFNNNRDTILGLFNMFSGGSLERMS 61

Query: 81  VFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIA 140
           +F+LGIMPYI+ASI++QL+ A VP+LE L+KEGEQGR+ I QYTRY TV LG +Q++G+ 
Sbjct: 62  IFALGIMPYITASIVIQLMTAVVPTLEQLRKEGEQGRRKITQYTRYLTVALGAIQSFGMV 121

Query: 141 VGLKNGQGIVS----------DSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
            GL N QGI             S YF   ST++T   GT+FL+WLGEQIT RGIGNG+S+
Sbjct: 122 AGL-NSQGITLLPETASTMQIASFYFVAVSTLVT---GTVFLMWLGEQITERGIGNGISM 177

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           +IF+ IV+GLP ++    E  R G +S  +ML +F   +AVI  V++ ER QRR+ + Y 
Sbjct: 178 LIFASIVSGLPGAVAQTFESARTGDLSLIMMLFVFLVAMAVIFGVVYVERGQRRITVNYA 237

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTW----IVG 306
           +RQ G R++    S+LPLK+N AGV+P+IFASS+LL PA++  +   S+  +W    +  
Sbjct: 238 RRQQGRRVYAAQQSHLPLKVNMAGVIPAIFASSILLFPASLTQWFSDSNPDSWWGQALRN 297

Query: 307 LVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALH 366
           + ++L  G   Y++L+++ IVFF +FYTA+VFNPK+ ADNLKK G +IPGIRPG+++A +
Sbjct: 298 VSEALLPGTPLYILLFTLAIVFFCYFYTALVFNPKDVADNLKKSGAYIPGIRPGEQSARY 357

Query: 367 IDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLI 426
           ID V+ R+T++GA Y+  VC+ P  L AV  VP  L GTSLLI+V VV+D   Q+  +L 
Sbjct: 358 IDTVMGRLTLIGAVYMTLVCLLPLGLQAVANVPFYLGGTSLLIVVVVVMDFWSQVNSHLT 417

Query: 427 AQQYEGVFKKSRSK 440
           + QYE + KKS  K
Sbjct: 418 STQYEKLMKKSNLK 431


>gi|254362777|ref|ZP_04978859.1| preprotein translocase subunit SecY [Mannheimia haemolytica PHL213]
 gi|153094406|gb|EDN75255.1| preprotein translocase subunit SecY [Mannheimia haemolytica PHL213]
          Length = 439

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 297/423 (70%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELIRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P L  LKKEGE GR+ I++YTRY T+LL  +Q+ GI++
Sbjct: 77  FALGIMPYISASIIIQLLTAIHPPLAELKKEGEAGRRKISKYTRYGTLLLAFIQSIGISL 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N   G+V +    F  +++++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMVHGLVPNPSILFYVTSVVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G +S  ++LL+     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEQARQGELSFIVLLLVAIIAFAVTYFVVFVERGQRRIVVNYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P+IFASS++L PA+I  +   S    W+  L   L  G+  Y+V
Sbjct: 257 ARTSHLPLKVNMAGVIPAIFASSIILFPASITQWFGQSEGFEWLFNLSQLLQPGQPLYVV 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA 
Sbjct: 317 LFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q +L++QQY+ V KK+  K
Sbjct: 377 YIAFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHLMSQQYDSVLKKANLK 436

Query: 441 KKN 443
             N
Sbjct: 437 GLN 439


>gi|170718269|ref|YP_001785287.1| preprotein translocase subunit SecY [Haemophilus somnus 2336]
 gi|168826398|gb|ACA31769.1| preprotein translocase, SecY subunit [Haemophilus somnus 2336]
          Length = 441

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 303/429 (70%), Gaps = 1/429 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           N ++ S   +LKSR++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFS
Sbjct: 9   NRSTQSGTSELKSRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLLEQQKGTIIDMFNMFS 68

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R ++F+LGIMPYISASII+QL+    P+L  LKKEGE GR+ I++YTRY+T++L 
Sbjct: 69  GGALSRASIFALGIMPYISASIIIQLLTTVHPALAELKKEGEAGRRKISKYTRYSTLVLA 128

Query: 133 ILQAYGIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191
            +QA GI+ GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RGIGNG+SLI
Sbjct: 129 TVQAIGISTGLPNMLPGLVPNLGFGFYFTAVISLVTGTMFLMWLGEQITERGIGNGISLI 188

Query: 192 IFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPK 251
           IF+GIVAGLPS++   +E  R G +   ++LLI     AV   V+FFER QRR+ ++Y K
Sbjct: 189 IFAGIVAGLPSAIGQTIEQARQGQMHLLVLLLIAVIVFAVTYFVVFFERGQRRIKVEYAK 248

Query: 252 RQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSL 311
           RQ G ++     ++LPLK+N AGV+P+IFASS++L PAT+  +    S+  W+  L   L
Sbjct: 249 RQQGRQIVGGHSTHLPLKVNMAGVIPAIFASSIILFPATLTSWFGQGSNLEWLTELSLLL 308

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y+++Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++
Sbjct: 309 HPGQPLYLIVYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIM 368

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T++G  Y+  VC+ P  + +   V     GTSLLI+V V++D IVQIQ +L++ +YE
Sbjct: 369 TRLTLIGGLYITFVCLVPYIMTSAWNVQFYFGGTSLLIVVVVIMDFIVQIQSHLMSTKYE 428

Query: 432 GVFKKSRSK 440
              KK+  K
Sbjct: 429 SALKKANLK 437


>gi|194291002|ref|YP_002006909.1| preprotein translocase subunit SecY [Cupriavidus taiwanensis LMG
           19424]
 gi|193224837|emb|CAQ70848.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Cupriavidus
           taiwanensis LMG 19424]
          Length = 447

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 222/422 (52%), Positives = 299/422 (70%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R++F ++ALIVYR G +IP+P ID    +K FQS+S GI G+FN+FSGGA+ R  V
Sbjct: 20  DLKRRLMFLVLALIVYRIGAHIPVPGIDPEQLAKLFQSQSGGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE+LKKEG+ G++ I QYTRY TV+L   QA  IAV
Sbjct: 80  FALGIMPYISASIIMQLLTIVLPQLESLKKEGQAGQRKITQYTRYGTVVLATFQALSIAV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G+V D    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AGLP
Sbjct: 140 ALESQPGLVLDPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  + EL R GS+S    + I +  + V   V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 200 NAIGGLFELVRTGSMSIIAAIFIVAIVIGVTFAVVFVERGQRKILVNYAKRQVGNKVYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT---WIVGLVDSLGHGRSFY 318
             S+LPLKLN AGV+P IFASS++L PATI G+    S+     +I  L  +L  G+  Y
Sbjct: 260 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTSDSTGAVGRFIKDLAATLSPGQPVY 319

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  IVFF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R+T+ G
Sbjct: 320 ILLYAAAIVFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVRLTLAG 379

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+ 
Sbjct: 380 AIYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKAN 439

Query: 439 SK 440
            K
Sbjct: 440 FK 441


>gi|261492712|ref|ZP_05989260.1| preprotein translocase subunit SecY [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261495673|ref|ZP_05992119.1| preprotein translocase subunit SecY [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261308780|gb|EEY10037.1| preprotein translocase subunit SecY [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261311565|gb|EEY12720.1| preprotein translocase subunit SecY [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 439

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 297/423 (70%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELIRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P L  LKKEGE GR+ I++YTRY T+LL  +Q+ GI++
Sbjct: 77  FALGIMPYISASIIIQLLTAIHPPLAELKKEGEAGRRKISKYTRYGTLLLAFIQSIGISL 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N   G+V +    F  +++++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMVHGLVPNPSILFYVTSVVSLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G +S  ++LL+     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEQARQGELSFIVLLLVAIIAFAVTYFVVFVERGQRRIVVNYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P+IFASS++L PA+I  +   S    W+  L   L  G+  Y+V
Sbjct: 257 ARTSHLPLKVNMAGVIPAIFASSIILFPASITQWFGQSEGFEWLFNLSQLLQPGQPLYVV 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA 
Sbjct: 317 LFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q +L++QQY+ V KK+  K
Sbjct: 377 YIAFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHLMSQQYDSVLKKANLK 436

Query: 441 KKN 443
             N
Sbjct: 437 GLN 439


>gi|24371849|ref|NP_715891.1| preprotein translocase subunit SecY [Shewanella oneidensis MR-1]
 gi|24345662|gb|AAN53336.1|AE015473_23 preprotein translocase, SecY subunit [Shewanella oneidensis MR-1]
          Length = 446

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/422 (48%), Positives = 298/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +S  I G+FNMFSGGA+ER ++
Sbjct: 17  ELKARLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQSGTILGMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTR+ T++LG  Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRWGTLVLGTFQSVGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNIGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLLAVIIFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|241759615|ref|ZP_04757716.1| preprotein translocase, SecY subunit [Neisseria flavescens SK114]
 gi|241319987|gb|EER56368.1| preprotein translocase, SecY subunit [Neisseria flavescens SK114]
          Length = 437

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 300/428 (70%), Gaps = 1/428 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           + +  S+  DLK R+ F + AL+V+R G +IP+P +D ++ +K ++  + GIFG+ NMFS
Sbjct: 6   SLSGLSKFGDLKKRLAFLLGALVVFRIGAHIPVPGVDAVALAKLYEGAANGIFGMLNMFS 65

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ER ++F++GIMPYISASIIVQL +  VPSL+ LKKEGE GRK+I +YTRY TVLL 
Sbjct: 66  GGSLERFSIFAIGIMPYISASIIVQLASEIVPSLKALKKEGEAGRKIITKYTRYGTVLLA 125

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           +LQ++G+A  +   QG+V  S   F  ST++ L+ GTMFL+WLGEQIT RGIGNG+SLII
Sbjct: 126 VLQSFGVATFVYQ-QGVVVTSSLEFHISTVVCLVTGTMFLMWLGEQITERGIGNGISLII 184

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
            +GIV+G+PS +V +L L   GS+S  + + I    + +I  V++FE AQR++ + Y KR
Sbjct: 185 TAGIVSGIPSGIVRLLTLTEQGSMSMLMAVSIVIGILLLIYAVVYFESAQRKVPVHYAKR 244

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           Q G+ M      ++P KLN AGV+P IFASS++L P+T++G+   +S+ + +  +   L 
Sbjct: 245 QFGSGMMPGQSIHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSNSTNSVLHKVAAMLQ 304

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
           HG+  Y+VL++  I+FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ 
Sbjct: 305 HGQPLYIVLFATTIIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVL 364

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+T+ GA Y+  +C+ PE L     VP  L GTSLLI+V V +D   QI  Y ++ QYE 
Sbjct: 365 RLTLFGALYITTICLIPEFLTTALKVPFYLGGTSLLILVVVTMDFRTQINSYRMSSQYED 424

Query: 433 VFKKSRSK 440
           +  +   K
Sbjct: 425 LMSRPDMK 432


>gi|113460229|ref|YP_718286.1| preprotein translocase subunit SecY [Haemophilus somnus 129PT]
 gi|112822272|gb|ABI24361.1| protein translocase subunit secY/sec61 alpha [Haemophilus somnus
           129PT]
          Length = 441

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/429 (48%), Positives = 302/429 (70%), Gaps = 1/429 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           N ++ S   +LKSR++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFS
Sbjct: 9   NRSTQSGTSELKSRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLLEQQKGTIIDMFNMFS 68

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R ++F+LGIMPYISASII+QL+    P+L  LKKEGE GR+ I++YTRY+T+ L 
Sbjct: 69  GGALSRASIFALGIMPYISASIIIQLLTTVHPALAELKKEGEAGRRKISKYTRYSTLALA 128

Query: 133 ILQAYGIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191
            +QA GI+ GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RGIGNG+SLI
Sbjct: 129 TIQAIGISTGLPNMLPGLVPNLGFSFYFTAVISLVTGTMFLMWLGEQITERGIGNGISLI 188

Query: 192 IFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPK 251
           IF+GIVAGLPS++   +E  R G +   ++LLI     AV   V+FFER QRR+ ++Y K
Sbjct: 189 IFAGIVAGLPSAIGQTIEQARQGQMHLLVLLLIAVIVFAVTYFVVFFERGQRRIKVEYAK 248

Query: 252 RQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSL 311
           RQ G ++     ++LPLK+N AGV+P+IFASS++L PAT+  +    S+  W+  L   L
Sbjct: 249 RQQGRQIVGGHSTHLPLKVNMAGVIPAIFASSIILFPATLTSWFGQGSNLEWLTELSLLL 308

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y+++Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++
Sbjct: 309 HPGQPLYLIVYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIM 368

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T++G  Y+  VC+ P  + +   V     GTSLLI+V V++D IVQIQ +L++ +YE
Sbjct: 369 TRLTLIGGLYITFVCLVPYIMTSAWNVQFYFGGTSLLIVVVVIMDFIVQIQSHLMSTKYE 428

Query: 432 GVFKKSRSK 440
              KK+  K
Sbjct: 429 SALKKANLK 437


>gi|145588262|ref|YP_001154859.1| preprotein translocase, SecY subunit [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046668|gb|ABP33295.1| protein translocase subunit secY/sec61 alpha [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 445

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 222/424 (52%), Positives = 298/424 (70%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+ R++F ++AL+V+R G +IP+P ID    ++ F  +  GI G+FN+FSGGA+ R  V
Sbjct: 20  ELRHRLIFLVLALLVFRLGAHIPVPGIDPDQLAQLFAGQKDGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   VPSLE+LKKEG+ G++ I QYTRY TV L   QA GI+V
Sbjct: 80  FALGIMPYISASIIMQLMTIVVPSLESLKKEGQAGQRKITQYTRYGTVFLATFQALGISV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V +    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF GIV+GLP
Sbjct: 140 ALQAQPGLVINPGLTFEVNTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGGIVSGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           ++L S+LEL R GS++    LLI     AV   V+F ER QRR+L+ Y KRQVGN+++  
Sbjct: 200 NALASLLELVRTGSMNIISALLIVVIVAAVTYFVVFVERGQRRILVNYAKRQVGNKVYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT-----WIVGLVDSLGHGRS 316
             SY PLKLN AGV+P IFASS++L PATI G+   S  PT      I  L  +L  G+ 
Sbjct: 260 QSSYFPLKLNMAGVIPPIFASSIILFPATIAGWFT-SGEPTNLFSRAIKDLAATLAPGQP 318

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y +LY+  I+FF FFYTA+VFN +E A+NLKK G F+PGIRPGD+TA +ID +L R+T+
Sbjct: 319 VYTILYAAAIIFFCFFYTALVFNSRETAENLKKSGAFVPGIRPGDQTARYIDKILVRLTL 378

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q +++ QQY  + KK
Sbjct: 379 AGAIYMVLVCLLPEFLVLKYNVPFYFGGTSLLIIVVVAMDFMAQVQSFVMQQQYGSLMKK 438

Query: 437 SRSK 440
           +  K
Sbjct: 439 ANFK 442


>gi|46143637|ref|ZP_00134836.2| COG0201: Preprotein translocase subunit SecY [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209243|ref|YP_001054468.1| preprotein translocase subunit SecY [Actinobacillus
           pleuropneumoniae L20]
 gi|165977216|ref|YP_001652809.1| preprotein translocase subunit SecY [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|190151134|ref|YP_001969659.1| Preprotein translocase secY subunit [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303250032|ref|ZP_07336234.1| preprotein translocase subunit SecY [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303253206|ref|ZP_07339355.1| preprotein translocase subunit SecY [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248850|ref|ZP_07530863.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307253464|ref|ZP_07535335.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307257878|ref|ZP_07539634.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307262274|ref|ZP_07543923.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307264483|ref|ZP_07546068.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126098035|gb|ABN74863.1| Preprotein translocase secY subunit [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165877317|gb|ABY70365.1| preprotein translocase SecY subunit [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|189916265|gb|ACE62517.1| Preprotein translocase secY subunit [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302647888|gb|EFL78095.1| preprotein translocase subunit SecY [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302651095|gb|EFL81249.1| preprotein translocase subunit SecY [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854777|gb|EFM86967.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306859143|gb|EFM91185.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306863608|gb|EFM95535.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306868037|gb|EFM99864.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870180|gb|EFN01939.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 440

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 296/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELVRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASIIVQL+ A  P L  LKKEGE GR+ I++YTRY T+LL  +Q+ GI++
Sbjct: 77  FALGIMPYISASIIVQLLTAIHPPLAELKKEGEAGRRKISKYTRYGTLLLAFIQSIGISI 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N  QG+V +    F  +++I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMLQGLVPNPSILFYVTSVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G IS  ++LL+     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEQARQGEISPLVLLLVAIIAFAVTYFVVFVERGQRRIVVNYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P+IFASS++L PA++  +   S    W+  L   L  G+  Y+V
Sbjct: 257 ARSSHLPLKVNMAGVIPAIFASSIILFPASVTQWFGQSEGLEWLFDLSQLLQPGQPLYLV 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA 
Sbjct: 317 LFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q +L++ QY+ V KK+  K
Sbjct: 377 YITFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHLMSLQYDSVLKKANLK 436


>gi|94312228|ref|YP_585438.1| preprotein translocase subunit SecY [Cupriavidus metallidurans
           CH34]
 gi|93356080|gb|ABF10169.1| preprotein translocase membrane subunit [Cupriavidus metallidurans
           CH34]
          Length = 447

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 298/422 (70%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R++F ++ALIVYR G +IP+P ID    +K FQS+S GI G+FN+FSGGA+ R  V
Sbjct: 20  DLKRRLMFLVLALIVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE+LKKEG+ G++ I QYTRY TV+L   QA  IAV
Sbjct: 80  FALGIMPYISASIIMQLLTIVLPQLESLKKEGQAGQRKITQYTRYGTVVLATFQALSIAV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G+V +    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AGLP
Sbjct: 140 ALESQPGLVLEPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  + EL R GS+S    + I +    V   V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 200 NAIGGLFELVRTGSMSIIAAIFIVAIIAGVTFAVVFIERGQRKILVNYAKRQVGNKVYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT---WIVGLVDSLGHGRSFY 318
             S+LPLKLN AGV+P IFASS++L PATI G+    S+     +I  L  +L  G+  Y
Sbjct: 260 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTSDSTSAVGRFIKDLAATLSPGQPVY 319

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  IVFF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R+T+ G
Sbjct: 320 ILLYATAIVFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVRLTLAG 379

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+ 
Sbjct: 380 AIYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKAN 439

Query: 439 SK 440
            K
Sbjct: 440 FK 441


>gi|224370671|ref|YP_002604835.1| preprotein translocase subunit SecY [Desulfobacterium autotrophicum
           HRM2]
 gi|223693388|gb|ACN16671.1| SecY [Desulfobacterium autotrophicum HRM2]
          Length = 437

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/430 (48%), Positives = 292/430 (67%), Gaps = 9/430 (2%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +  +LK +++ T   L VYR G ++P P ID  + +  F +    +F +FNMFSGGA++R
Sbjct: 11  KLPELKRKLLITFALLFVYRVGVHVPTPGIDGAALASFFDNARGTLFAMFNMFSGGALDR 70

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           ++VF+LGIMPYISASII+QL+   +P LE L KEGEQGRK I QYTRY TV+L ++Q +G
Sbjct: 71  LSVFALGIMPYISASIILQLMTVVIPHLEQLSKEGEQGRKKITQYTRYGTVVLSLIQGFG 130

Query: 139 IAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIF 193
           I+VGL++     G  IV    + F   T+ITL  GT F++WLGEQIT RGIGNG+SLIIF
Sbjct: 131 ISVGLESMTSPAGSPIVMYPGWEFRLMTVITLTAGTAFIMWLGEQITERGIGNGISLIIF 190

Query: 194 SGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQ 253
           +GIVA +P ++ + + L   G +    ++++    VAV+A +IFFE AQRR+ +QY KR 
Sbjct: 191 AGIVARMPIAIANTMRLVSTGEMGVFSLIILIVLMVAVVAAIIFFETAQRRIPVQYAKRV 250

Query: 254 VGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGH 313
           VG +M+    S+LPLK+NTAGV+P IFASS+++ PAT+  FID+    T    +  ++  
Sbjct: 251 VGRKMYGGQTSHLPLKINTAGVIPPIFASSIIMFPATLANFIDLPMMKT----VAAAMSP 306

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G   Y +++  FI+FF FFYTA+ FNP + A+N+KK+GG+IPGIRPG RTA +ID VLTR
Sbjct: 307 GSIVYNLIFVGFIIFFCFFYTAVTFNPDDVAENMKKNGGYIPGIRPGKRTAEYIDRVLTR 366

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV 433
           +T  GA Y+  VC+ P  L+    VP    GT+LLI+V V +DT+ QI+ +LI + YEG 
Sbjct: 367 ITTGGAVYVSLVCVLPTMLMTKFNVPFYFGGTALLIVVGVSIDTVSQIESHLITRNYEGF 426

Query: 434 FKKSRSKKKN 443
             KS S K  
Sbjct: 427 LGKSGSVKSR 436


>gi|73542843|ref|YP_297363.1| preprotein translocase subunit SecY [Ralstonia eutropha JMP134]
 gi|72120256|gb|AAZ62519.1| protein translocase subunit secY/sec61 alpha [Ralstonia eutropha
           JMP134]
          Length = 447

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 222/422 (52%), Positives = 300/422 (71%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R++F ++ALIVYR G +IP+P ID    +K FQS+S GI G+FN+FSGGA+ R  V
Sbjct: 20  DLKRRLMFLVLALIVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE+LKKEG+ G++ I QYTRY TV+L   QA  IAV
Sbjct: 80  FALGIMPYISASIIMQLLTIVLPQLESLKKEGQAGQRKITQYTRYGTVVLATFQALSIAV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G+V D    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AGLP
Sbjct: 140 ALESQPGLVIDPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  + EL R GS+S    +LI +  + V   V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 200 NAIGGLFELVRTGSMSIIAAILIVAIVIGVTFAVVFVERGQRKILVNYAKRQVGNKVYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT---WIVGLVDSLGHGRSFY 318
             S+LPLKLN AGV+P IFASS++L PATI G+    S+     ++  L  +L  G+  Y
Sbjct: 260 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTSQSTGAVGRFVKDLAATLSPGQPVY 319

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  IVFF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R+T+ G
Sbjct: 320 ILLYAAAIVFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVRLTLAG 379

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+ 
Sbjct: 380 AIYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKAN 439

Query: 439 SK 440
            K
Sbjct: 440 FK 441


>gi|307251078|ref|ZP_07533002.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306856908|gb|EFM89040.1| Preprotein translocase subunit secY [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 440

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 296/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELVRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASIIVQL+ A  P L  LKKEGE GR+ I++YTRY T+LL  +Q+ GI++
Sbjct: 77  FALGIMPYISASIIVQLLTAIHPPLAELKKEGEAGRRKISKYTRYGTLLLAFIQSIGISI 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N  QG+V +    F  +++I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMLQGLVPNPSILFYVTSVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G IS  ++LL+     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEQARQGEISPLVLLLVAIIAFAVTYFVVFVERGQRRIVVNYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P+IFASS++L PA++  +   S    W+  L   L  G+  Y+V
Sbjct: 257 ARSSHLPLKVNMAGVIPAIFASSIILFPASVTQWFGQSEGLEWLFDLSQLLRPGQPLYLV 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA 
Sbjct: 317 LFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q +L++ QY+ V KK+  K
Sbjct: 377 YITFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHLMSLQYDSVLKKANLK 436


>gi|110812356|gb|ABG91712.1| preprotein translocase, SecY subunit [Shewanella putrefaciens 200]
          Length = 446

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/422 (48%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +S  I  +FNMFSGGA+ER ++
Sbjct: 17  ELKARLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQSGTILSMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTR+ T++LG  Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRWGTLVLGTFQSVGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNIGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLLAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICVIPEFMLIXWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|113869411|ref|YP_727900.1| preprotein translocase subunit SecY [Ralstonia eutropha H16]
 gi|113528187|emb|CAJ94532.1| preprotein translocase SecY (membrane subunit) [Ralstonia eutropha
           H16]
          Length = 447

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 299/422 (70%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DLK R++F ++ALIVYR G +IP+P ID    +K FQS+S GI G+FN+FSGGA+ R  V
Sbjct: 20  DLKRRLMFLVLALIVYRIGAHIPVPGIDPEQLAKLFQSQSGGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE LKKEG+ G++ I QYTRY TV+L   QA  IAV
Sbjct: 80  FALGIMPYISASIIMQLLTIVLPQLEALKKEGQAGQRKITQYTRYGTVVLATFQALSIAV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L++  G+V D    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AGLP
Sbjct: 140 ALESQPGLVLDPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  + EL R GS+S    + I +  + V   V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 200 NAIGGLFELVRTGSMSIIAAIFIVAIVIGVTFAVVFVERGQRKILVNYAKRQVGNKVYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT---WIVGLVDSLGHGRSFY 318
             S+LPLKLN AGV+P IFASS++L PATI G+    ++ +   +I  L  +L  G+  Y
Sbjct: 260 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTSDATGSVGGFIKDLAATLSPGQPVY 319

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  IVFF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R+T+ G
Sbjct: 320 ILLYAAAIVFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVRLTLAG 379

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+ 
Sbjct: 380 AVYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKAN 439

Query: 439 SK 440
            K
Sbjct: 440 FK 441


>gi|120597009|ref|YP_961583.1| preprotein translocase subunit SecY [Shewanella sp. W3-18-1]
 gi|146294821|ref|YP_001185245.1| preprotein translocase subunit SecY [Shewanella putrefaciens CN-32]
 gi|120557102|gb|ABM23029.1| protein translocase subunit secY/sec61 alpha [Shewanella sp.
           W3-18-1]
 gi|145566511|gb|ABP77446.1| protein translocase subunit secY/sec61 alpha [Shewanella
           putrefaciens CN-32]
 gi|319424600|gb|ADV52674.1| preprotein translocase, SecY subunit [Shewanella putrefaciens 200]
          Length = 446

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/422 (48%), Positives = 297/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +S  I  +FNMFSGGA+ER ++
Sbjct: 17  ELKARLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQSGTILSMFNMFSGGALERASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTR+ T++LG  Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRWGTLVLGTFQSVGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNIGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLLAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|107024283|ref|YP_622610.1| preprotein translocase subunit SecY [Burkholderia cenocepacia AU
           1054]
 gi|116688392|ref|YP_834015.1| preprotein translocase subunit SecY [Burkholderia cenocepacia
           HI2424]
 gi|161702972|ref|YP_367713.2| preprotein translocase subunit SecY [Burkholderia sp. 383]
 gi|170731702|ref|YP_001763649.1| preprotein translocase subunit SecY [Burkholderia cenocepacia
           MC0-3]
 gi|206558661|ref|YP_002229421.1| preprotein translocase subunit SecY [Burkholderia cenocepacia
           J2315]
 gi|105894472|gb|ABF77637.1| protein translocase subunit secY/sec61 alpha [Burkholderia
           cenocepacia AU 1054]
 gi|116646481|gb|ABK07122.1| protein translocase subunit secY/sec61 alpha [Burkholderia
           cenocepacia HI2424]
 gi|169814944|gb|ACA89527.1| preprotein translocase, SecY subunit [Burkholderia cenocepacia
           MC0-3]
 gi|198034698|emb|CAR50565.1| preprotein translocase SecY subunit [Burkholderia cenocepacia
           J2315]
          Length = 449

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 229/434 (52%), Positives = 311/434 (71%), Gaps = 7/434 (1%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVTDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIV----GLVD 309
           N+++    S+LPLKLN +GV+P IFASS++L PATI+G+   +  PT  WI      + +
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILGWFS-TGQPTGSWISNTLHNVAE 311

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
           +L  G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID 
Sbjct: 312 ALKPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDR 371

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           +LTR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQ
Sbjct: 372 ILTRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQ 431

Query: 430 YEGVFKKSRSKKKN 443
           YE + KK+  K  N
Sbjct: 432 YESLLKKANFKGGN 445


>gi|237806895|ref|YP_002891335.1| preprotein translocase subunit SecY [Tolumonas auensis DSM 9187]
 gi|237499156|gb|ACQ91749.1| preprotein translocase, SecY subunit [Tolumonas auensis DSM 9187]
          Length = 443

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 295/424 (69%), Gaps = 7/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A+IV+R G Y+P+P ID     + FQ +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGAIIVFRAGAYVPIPGIDATVLGQLFQQQKGTIIEMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P    LKKEGE GR+VI+++TR+ T++L  +QA GIA 
Sbjct: 78  FALGIMPYISASIIIQLLTVISPYYAELKKEGESGRRVISKHTRWGTLVLATVQASGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPNMMHGLVLNPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++ +  E  R G +   L+LL+     AV   V+F ER QRR+++ Y KRQ GN++F 
Sbjct: 198 PQAIGATAEQARQGELHILLLLLLVVIVFAVTYFVVFVERGQRRIVVNYAKRQQGNQIFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD----SLGHGRS 316
              ++LPLKLN AGV+P+IFASS++L P TI  +     S  WI  ++     SL  G+ 
Sbjct: 258 AQSTHLPLKLNMAGVIPAIFASSIILFPGTIASWFGQGDS--WIANILQEISMSLQPGQP 315

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y +LY+V I+FF+FFYTA+VFNP+E ADNLKK G FIPGIRPG++TA  ID V+TR+T+
Sbjct: 316 LYELLYAVAIIFFSFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTARFIDKVMTRLTL 375

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ P+ L+    V     GTSLLIIV V++D + Q+Q ++++ QY  V KK
Sbjct: 376 AGALYITAICLVPQLLMTFWHVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYGDVLKK 435

Query: 437 SRSK 440
           +  K
Sbjct: 436 ANLK 439


>gi|28897051|ref|NP_796656.1| preprotein translocase subunit SecY [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260877969|ref|ZP_05890324.1| preprotein translocase, SecY subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|260897582|ref|ZP_05906078.1| preprotein translocase, SecY subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|260903547|ref|ZP_05911942.1| preprotein translocase, SecY subunit [Vibrio parahaemolyticus
           AQ4037]
 gi|28805259|dbj|BAC58540.1| preprotein translocase, SecY subunit [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308087871|gb|EFO37566.1| preprotein translocase, SecY subunit [Vibrio parahaemolyticus
           Peru-466]
 gi|308089977|gb|EFO39672.1| preprotein translocase, SecY subunit [Vibrio parahaemolyticus
           AN-5034]
 gi|308109054|gb|EFO46594.1| preprotein translocase, SecY subunit [Vibrio parahaemolyticus
           AQ4037]
          Length = 444

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+SL+IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISLLIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|149192389|ref|ZP_01870590.1| protein translocase subunit SecY [Vibrio shilonii AK1]
 gi|148833780|gb|EDL50816.1| protein translocase subunit SecY [Vibrio shilonii AK1]
          Length = 444

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/433 (49%), Positives = 299/433 (69%), Gaps = 8/433 (1%)

Query: 16  SFSRAK----DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMF 71
            FS AK    +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMF
Sbjct: 8   DFSSAKSGLNELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMF 67

Query: 72  SGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLL 131
           SGGA+ER ++ +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L
Sbjct: 68  SGGALERASILALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVL 127

Query: 132 GILQAYGIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
              QA GIA GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+S+
Sbjct: 128 ATFQAIGIATGLPNMVNNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISI 187

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           +IF+GIVAGLPS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y 
Sbjct: 188 LIFAGIVAGLPSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYA 247

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGL 307
           KRQ G ++F    ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +
Sbjct: 248 KRQQGRKVFAAQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDV 307

Query: 308 VDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHI 367
             +L  G+  Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +I
Sbjct: 308 SLALSPGQPLYVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYI 367

Query: 368 DYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIA 427
           D V+TR+T+ GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++
Sbjct: 368 DKVMTRLTLAGALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMS 427

Query: 428 QQYEGVFKKSRSK 440
           QQY+ V KK+  K
Sbjct: 428 QQYDSVLKKANLK 440


>gi|295677912|ref|YP_003606436.1| preprotein translocase, SecY subunit [Burkholderia sp. CCGE1002]
 gi|295437755|gb|ADG16925.1| preprotein translocase, SecY subunit [Burkholderia sp. CCGE1002]
          Length = 448

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 307/429 (71%), Gaps = 4/429 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R VF ++AL+VYR G +IP+P ID    +K FQS+S GI G+FNMFSGGA
Sbjct: 13  SAAKFGDLRRRAVFLLLALVVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRIFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIAV L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAVALENQPGLVIDPGMVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    +++ +   AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAIGGLFELVRTGSMSIISAIIVVALIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +    S  +W       + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILNWFSSGSRTSWFADTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYALAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSK 440
            + KK+  K
Sbjct: 433 SLLKKANFK 441


>gi|312884683|ref|ZP_07744384.1| preprotein translocase subunit SecY [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367596|gb|EFP95147.1| preprotein translocase subunit SecY [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 444

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 298/423 (70%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P +D    +  F  ++  I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGVDAAVLADLFDQQAGTIVDMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L  LQA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATLQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N  + +V      F     ++L+ GTMFL+WLGEQIT RGIGNG+SL+IF+GIVAGL
Sbjct: 138 GLPNMVENLVVIDQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISLLIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   ++  + G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIDQAKRGDLHVLLLLLIAVLSFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV---SSSPTWIVGLVDSLGHGRSF 317
              ++LPLK+N AGV+P+IFASS++L P T+  +      SS+  W+  +  +L  G+  
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQGGQSSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++A   V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMAAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|254476973|ref|ZP_05090359.1| preprotein translocase, SecY subunit [Ruegeria sp. R11]
 gi|214031216|gb|EEB72051.1| preprotein translocase, SecY subunit [Ruegeria sp. R11]
          Length = 407

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/396 (52%), Positives = 285/396 (71%), Gaps = 8/396 (2%)

Query: 1   MASAVEQFVSNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSK 60
           M SA EQ  +N ++++  +A DL++RI+FT+  LIVYR GTYIP+P ID  +  +     
Sbjct: 1   MVSAAEQMAANTSWSALGKATDLRNRILFTLGLLIVYRLGTYIPVPGIDADALRQFMAQA 60

Query: 61  SAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVI 120
             GI G+ +MF+GGA+ RM +F+LGIMPYISASIIVQL+ + VPSLE LKKEGEQGRK I
Sbjct: 61  GQGIGGMVSMFTGGALGRMGIFALGIMPYISASIIVQLLTSMVPSLEQLKKEGEQGRKKI 120

Query: 121 NQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQIT 180
           NQYTRY TVLL   Q+YG+AV L++G  + +D   +F  + +ITL+GGTMFL+WLGEQIT
Sbjct: 121 NQYTRYGTVLLATAQSYGLAVSLESGD-LATDPGLYFRLACMITLVGGTMFLMWLGEQIT 179

Query: 181 MRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFER 240
            RGIGNG+SLIIF GI+A +P+++   L  GR G+IS  +++ +    VA+I  V+F ER
Sbjct: 180 QRGIGNGISLIIFVGIIAEVPAAIAQFLASGRSGAISPAVIIAVIVMMVAIIMFVVFMER 239

Query: 241 AQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGF-IDVSS 299
           A R++ IQYP+RQVG +++    S+LP+K+N AGV+P+IFASSLLLLP TI  F  D ++
Sbjct: 240 ALRKIHIQYPRRQVGMKVYDGGSSHLPVKVNPAGVIPAIFASSLLLLPVTISTFSADATN 299

Query: 300 SP--TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPG 356
            P  +W   L+ + G G+  Y++ +   IVFFA+FYT  + F P + A+NLK   GF+PG
Sbjct: 300 GPIMSW---LLANFGPGQPLYLLFFVAMIVFFAYFYTFNVSFKPDDVANNLKNQNGFVPG 356

Query: 357 IRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           IRPG +TA +++YV+ R+ V+G+ YL  VC+ PE L
Sbjct: 357 IRPGKKTAEYLEYVVNRILVLGSAYLAAVCLLPEIL 392


>gi|209521365|ref|ZP_03270078.1| preprotein translocase, SecY subunit [Burkholderia sp. H160]
 gi|209498185|gb|EDZ98327.1| preprotein translocase, SecY subunit [Burkholderia sp. H160]
          Length = 448

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 307/429 (71%), Gaps = 4/429 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R VF ++AL+VYR G +IP+P ID    +K FQS+S GI G+FNMFSGGA
Sbjct: 13  SAAKFGDLRRRAVFLLLALVVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRVFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIAV L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAVALENQPGLVIDPGMVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    +++ +   AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAIGGLFELVRTGSMSIISAIIVVALIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +    S  +W       + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILNWFSSGSRTSWFADTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYALAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSK 440
            + KK+  K
Sbjct: 433 SLLKKANFK 441


>gi|268597765|ref|ZP_06131932.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae FA19]
 gi|268683069|ref|ZP_06149931.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID332]
 gi|268551553|gb|EEZ46572.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae FA19]
 gi|268623353|gb|EEZ55753.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID332]
          Length = 436

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 298/423 (70%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           +   + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 VGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GAFYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|27364194|ref|NP_759722.1| preprotein translocase subunit SecY [Vibrio vulnificus CMCP6]
 gi|37678579|ref|NP_933188.1| preprotein translocase subunit SecY [Vibrio vulnificus YJ016]
 gi|320157581|ref|YP_004189960.1| preprotein translocase secY subunit [Vibrio vulnificus MO6-24/O]
 gi|27360312|gb|AAO09249.1| Preprotein translocase secY subunit [Vibrio vulnificus CMCP6]
 gi|37197319|dbj|BAC93159.1| preprotein translocase subunit SecY [Vibrio vulnificus YJ016]
 gi|319932893|gb|ADV87757.1| preprotein translocase secY subunit [Vibrio vulnificus MO6-24/O]
          Length = 444

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/424 (50%), Positives = 297/424 (70%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKN--GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           GL N     +V D   F + +T+ +L+ GTMFL+WLGEQIT RGIGNG+SL+IF+GIVAG
Sbjct: 138 GLPNMVDNLVVIDQTMFTLIATV-SLVTGTMFLMWLGEQITERGIGNGISLLIFAGIVAG 196

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LPS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F
Sbjct: 197 LPSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVF 256

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRS 316
               S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+ 
Sbjct: 257 AAQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQP 316

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+
Sbjct: 317 LYVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTL 376

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK
Sbjct: 377 AGALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHMMSHQYESVLKK 436

Query: 437 SRSK 440
           +  K
Sbjct: 437 ANLK 440


>gi|307731235|ref|YP_003908459.1| preprotein translocase, SecY subunit [Burkholderia sp. CCGE1003]
 gi|323527582|ref|YP_004229735.1| preprotein translocase subunit SecY [Burkholderia sp. CCGE1001]
 gi|307585770|gb|ADN59168.1| preprotein translocase, SecY subunit [Burkholderia sp. CCGE1003]
 gi|323384584|gb|ADX56675.1| preprotein translocase, SecY subunit [Burkholderia sp. CCGE1001]
          Length = 448

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 226/429 (52%), Positives = 306/429 (71%), Gaps = 4/429 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R VF ++ALIVYR G +IP+P ID    +K FQS+S GI G+FNMFSGGA
Sbjct: 13  SAAKFGDLRRRAVFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TVLL   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRIFTVLLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIAV L+N   +V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAVALENQPALVIDPGMVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    +++ +   AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAIGGLFELVRTGSMSIISAIIVVALIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +    S  +W       + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILNWFSSGSRTSWFADTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYALAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSK 440
            + KK+  K
Sbjct: 433 SLLKKANFK 441


>gi|78484660|ref|YP_390585.1| preprotein translocase subunit SecY [Thiomicrospira crunogena
           XCL-2]
 gi|78362946|gb|ABB40911.1| protein translocase subunit secY/sec61 alpha [Thiomicrospira
           crunogena XCL-2]
          Length = 437

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/424 (48%), Positives = 286/424 (67%), Gaps = 4/424 (0%)

Query: 23  LKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVF 82
           L  +I F + ALIVYR GT+IP+P ID ++ +  F+ +   I  +FNMFSGGA++R+++ 
Sbjct: 14  LSQKIFFVLGALIVYRLGTHIPVPLIDPVALAAMFEQQKGTILDMFNMFSGGALQRLSIL 73

Query: 83  SLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVG 142
           +LGIMPYISASII+QL+    P+LE LKK+GE GR+ I QYTRY TV+L   QA G+A+ 
Sbjct: 74  ALGIMPYISASIIMQLLTVVSPTLEQLKKDGEAGRRKITQYTRYGTVVLATFQALGVAIA 133

Query: 143 LK----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           L+    NG  +V +    F    + TL+ GT+FL+WLGEQIT RGIGNG+SLIIF+GIVA
Sbjct: 134 LESQNINGMSVVVEPGLLFKVIAVATLVSGTIFLMWLGEQITERGIGNGISLIIFAGIVA 193

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
           GLPS+L    E    G++      ++ +    VIA V+F ER QRR+ I Y +R  G ++
Sbjct: 194 GLPSALGGTFEQVNTGAMHAITAFVLLALVFLVIAFVVFVERGQRRIPIHYAQRMRGRKL 253

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFY 318
           +     +LPLKLN AGV+P IFASS++L PAT+ G+   + +  W+  +  ++  G+  Y
Sbjct: 254 YGGQEGHLPLKLNMAGVIPPIFASSIILFPATLGGWFGTAENMGWLKDIATTMSPGQPLY 313

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++ Y++ I+FF FFYTAIVFNP E ADNL+K G +IPGIRPG +TA  ID +++R+T+ G
Sbjct: 314 ILFYAMAIIFFCFFYTAIVFNPNETADNLRKSGAYIPGIRPGQQTARRIDTIMSRLTLAG 373

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE LI    VP    GTSLLIIV VV+D +  IQ ++ + QYE + KK+ 
Sbjct: 374 AIYITLVCLLPEFLILYWNVPFYFGGTSLLIIVIVVMDFMTNIQAHMQSGQYESMMKKAN 433

Query: 439 SKKK 442
            K +
Sbjct: 434 LKGR 437


>gi|317401569|gb|EFV82198.1| SecY protein [Achromobacter xylosoxidans C54]
          Length = 441

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 224/423 (52%), Positives = 308/423 (72%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           +R  DLK R+VF ++AL+VYR GT+IP+P I+  + +  F+    GI GLFNMFSGGA+ 
Sbjct: 12  TRYGDLKRRLVFLVLALVVYRLGTHIPVPGINPDALADLFRQNQGGILGLFNMFSGGALS 71

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F+LGIMPYISASII+QL++  VPSLE LKKEGE GR+ I QYTRY TV+L ++QA 
Sbjct: 72  RFSIFALGIMPYISASIIMQLMSVVVPSLEALKKEGEAGRRKITQYTRYGTVVLALVQAV 131

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GI+V L++ QG+V D    F F+T++TL+ GTMF++WLGEQIT RG+GNG+S++IF+GIV
Sbjct: 132 GISVALESQQGLVIDPGMLFRFTTVVTLVTGTMFVMWLGEQITERGLGNGISILIFAGIV 191

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP++L ++L+L R  ++S    L I +  V V A V+F ER QR++ + Y KRQVGN+
Sbjct: 192 AGLPAALAALLDLVRTNAMSVLSALFIVALVVLVTAFVVFVERGQRKITVNYAKRQVGNK 251

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           ++    S+LPLKLN AGV+P IFASS++L PATI  +   S +  W+  L  +L   +  
Sbjct: 252 VYGGQSSHLPLKLNMAGVIPPIFASSIILFPATITSWFSSSENMRWLSDLAAALSPRQPL 311

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y+ LYSV I+FF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +L R+T+ 
Sbjct: 312 YITLYSVAIIFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDKILMRLTLA 371

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++ QY+ + KK+
Sbjct: 372 GAIYITLVCLLPEFLVMRWNVPFYFGGTSLLIIVVVTMDFMAQVQAYMMSHQYDSLLKKA 431

Query: 438 RSK 440
             K
Sbjct: 432 NFK 434


>gi|268683265|ref|ZP_06150127.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           SK-92-679]
 gi|268623549|gb|EEZ55949.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           SK-92-679]
          Length = 436

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 298/423 (70%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
           +   + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 VGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GALYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|158520745|ref|YP_001528615.1| preprotein translocase, SecY subunit [Desulfococcus oleovorans
           Hxd3]
 gi|158509571|gb|ABW66538.1| preprotein translocase, SecY subunit [Desulfococcus oleovorans
           Hxd3]
          Length = 429

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/424 (48%), Positives = 292/424 (68%), Gaps = 5/424 (1%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +  +LK RI+FT+  L VYR G  IP P ID  + ++ F++   G+ G+FNMFSGGA+E+
Sbjct: 11  KIPELKRRILFTLSMLAVYRIGVMIPTPGIDREALARIFEAHKGGMLGMFNMFSGGALEQ 70

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           ++VF+LGIMPYISA+II++L+   VP LE LKKEGEQGRK + QYTRY TV+L I+Q + 
Sbjct: 71  LSVFALGIMPYISAAIILELLTVAVPYLEQLKKEGEQGRKKLTQYTRYGTVVLSIIQGFL 130

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           +AVG++   G V D  + F   T+ITL  GT F++WLGEQIT +GIGNG+SLIIF+GIVA
Sbjct: 131 MAVGIEK-MGAVIDPGWSFRLMTVITLTAGTAFIMWLGEQITEKGIGNGISLIIFAGIVA 189

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
            LP+++++   +   G +    +L++    VAV+ ++IF E+ QRR+ IQY KR VG RM
Sbjct: 190 RLPAAIINTSRMISTGDMGIFGVLILLVFMVAVVGVIIFMEQGQRRIPIQYAKRVVGRRM 249

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFY 318
           +    ++LPLK+NT+GV+P IFASS+++ PAT+ GF+DV     ++  +   L  G   Y
Sbjct: 250 YGGQSTHLPLKINTSGVIPPIFASSIMMFPATMAGFVDVP----FVQDMSAVLMPGHWIY 305

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
            V +   I FF +FYTA+ F P + A+N+KK GG+IPGIRPG RTA +ID VLTR+T+ G
Sbjct: 306 NVFFVALIFFFCYFYTAVTFKPDDVAENMKKQGGYIPGIRPGKRTADYIDRVLTRITLGG 365

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ P  LI+   VP    GT+LLI+V V +DT  Q++ ++I + YEG  KK  
Sbjct: 366 ATYVAAVCVLPTILISQFNVPFYFGGTALLIVVGVAIDTTAQMESHMIQRSYEGFLKKGI 425

Query: 439 SKKK 442
             ++
Sbjct: 426 RGRR 429


>gi|83720756|ref|YP_443552.1| preprotein translocase subunit SecY [Burkholderia thailandensis
           E264]
 gi|167620717|ref|ZP_02389348.1| preprotein translocase subunit SecY [Burkholderia thailandensis
           Bt4]
 gi|257137662|ref|ZP_05585924.1| preprotein translocase subunit SecY [Burkholderia thailandensis
           E264]
 gi|83654581|gb|ABC38644.1| preprotein translocase, SecY subunit [Burkholderia thailandensis
           E264]
          Length = 448

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 307/432 (71%), Gaps = 4/432 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLMAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVTDPGAVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIFSAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +        W+      + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILSWFSSGERKGWLSDTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSKKKN 443
            + KK+  K  N
Sbjct: 433 SLLKKANFKGGN 444


>gi|254237107|ref|ZP_04930430.1| secretion protein SecY [Pseudomonas aeruginosa C3719]
 gi|126169038|gb|EAZ54549.1| secretion protein SecY [Pseudomonas aeruginosa C3719]
          Length = 442

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/423 (48%), Positives = 292/423 (69%), Gaps = 1/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR G +IP+P I+    +  F+     I  LFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFLAIIVYRIGAHIPVPGINPDRLAALFRQNEGTILSLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+Q   Y TV+L ++Q   ++V
Sbjct: 77  FALGIMPYISASIIMQLMTAISPQLEQLKKEGESGRRKISQLPHYGTVVLILVQDICMSV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QG+   +D+ F F  + T + G MF++WLGEQIT RG+GNG+S++IF+GIVAGLP
Sbjct: 137 GLGS-QGVAFSNDFGFYFVAVTTFVAGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++    E  R G I+   ++ +    VA+IA V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 RAIGQSFESARQGDINIFALIGVGLLAVAIIAFVVFIERGQRRIAVHYAKRQQGRKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P+IFASS+LL PA++  +   S    W+  +  ++  G+   ++L
Sbjct: 256 QTSHLPLKVNMAGVIPAIFASSILLFPASLGSWFGQSEGLGWLQDVAQAIAPGQPLNILL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           ++  IVFF FFYTA++FNPK+ A+NLKK G FIPGIRPG+++A +ID VLTR+T+ GA Y
Sbjct: 316 FTAGIVFFCFFYTALMFNPKDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +  VC+ P+ L+    VP  L GTSLLI+V VV+D + Q+Q +L++ QYE + KK+  K 
Sbjct: 376 MTAVCLLPQFLVVAAHVPFYLGGTSLLIVVVVVMDFMAQVQSHLVSHQYESLMKKANLKG 435

Query: 442 KNS 444
             S
Sbjct: 436 YGS 438


>gi|254494701|ref|ZP_05107872.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae 1291]
 gi|268602348|ref|ZP_06136515.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID18]
 gi|226513741|gb|EEH63086.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae 1291]
 gi|268586479|gb|EEZ51155.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID18]
          Length = 436

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 297/423 (70%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
               + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 AGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GAFYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|260772116|ref|ZP_05881033.1| preprotein translocase SecY subunit [Vibrio metschnikovii CIP
           69.14]
 gi|260612983|gb|EEX38185.1| preprotein translocase SecY subunit [Vibrio metschnikovii CIP
           69.14]
          Length = 444

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 295/424 (69%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIIEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKN--GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           GL N     +V D   F + +T+ +L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAG
Sbjct: 138 GLPNMVNNLVVIDQTMFTLIATV-SLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAG 196

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LPS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F
Sbjct: 197 LPSAIGHTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVF 256

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD---SLGHGRS 316
               ++LPLK+N AGV+P+IFASS++L P T+  +   +    W   L D   +L  G+ 
Sbjct: 257 AAQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESQWFGWLTDVSLALSPGQP 316

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+
Sbjct: 317 LYVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTARYIDKVMTRLTL 376

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++ QY+ V KK
Sbjct: 377 AGALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSNQYDSVLKK 436

Query: 437 SRSK 440
           +  K
Sbjct: 437 ANLK 440


>gi|260779483|ref|ZP_05888373.1| preprotein translocase SecY subunit [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260604292|gb|EEX30596.1| preprotein translocase SecY subunit [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 444

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+SL+IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISLLIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIVVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSTFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|328471854|gb|EGF42731.1| preprotein translocase subunit SecY [Vibrio parahaemolyticus 10329]
          Length = 444

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/423 (49%), Positives = 294/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+  TMFL+WLGEQIT RGIGNG+SL+IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTSTMFLMWLGEQITERGIGNGISLLIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQYE V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYESVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|161523449|ref|YP_001578461.1| preprotein translocase subunit SecY [Burkholderia multivorans ATCC
           17616]
 gi|189351778|ref|YP_001947406.1| preprotein translocase subunit SecY [Burkholderia multivorans ATCC
           17616]
 gi|160340878|gb|ABX13964.1| preprotein translocase, SecY subunit [Burkholderia multivorans ATCC
           17616]
 gi|189335800|dbj|BAG44870.1| preprotein translocase SecY subunit [Burkholderia multivorans ATCC
           17616]
          Length = 449

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 228/433 (52%), Positives = 309/433 (71%), Gaps = 5/433 (1%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVIDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVSGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSS-SPTWIV----GLVDS 310
           N+++    S+LPLKLN +GV+P IFASS++L PATI+G+      S +WI      + ++
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILGWFSTGQPSGSWISNTLHNVAEA 312

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +
Sbjct: 313 LKPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRI 372

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LTR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQY
Sbjct: 373 LTRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQY 432

Query: 431 EGVFKKSRSKKKN 443
           E + KK+  K  N
Sbjct: 433 ESLLKKANFKGGN 445


>gi|91228968|ref|ZP_01262863.1| preprotein translocase SecY [Vibrio alginolyticus 12G01]
 gi|262392496|ref|YP_003284350.1| preprotein translocase SecY subunit [Vibrio sp. Ex25]
 gi|269964716|ref|ZP_06178954.1| preprotein translocase subunit secY [Vibrio alginolyticus 40B]
 gi|91187488|gb|EAS73825.1| preprotein translocase SecY [Vibrio alginolyticus 12G01]
 gi|262336090|gb|ACY49885.1| preprotein translocase SecY subunit [Vibrio sp. Ex25]
 gi|269830615|gb|EEZ84836.1| preprotein translocase subunit secY [Vibrio alginolyticus 40B]
          Length = 444

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|223042023|ref|ZP_03612204.1| preprotein translocase secY subunit [Actinobacillus minor 202]
 gi|223017185|gb|EEF15616.1| preprotein translocase secY subunit [Actinobacillus minor 202]
          Length = 441

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 297/421 (70%), Gaps = 2/421 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELVRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P L  LKKEGE GR+ I++YTRYAT+LL  +Q+ GI+V
Sbjct: 77  FALGIMPYISASIIIQLLTAIHPPLAELKKEGEAGRRKISKYTRYATLLLAFIQSIGISV 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N   G+V + +  F  + +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMLSGLVPNPNMLFYITAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G IS  ++LLI     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEEARQGEISFLVLLLIAVIAFAVTYFVVFVERGQRRIVVHYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSP-TWIVGLVDSLGHGRSFYM 319
              S+LPLK+N AGV+P+IFASS++L PA+I  +   SS    W+  L   L  G+  Y+
Sbjct: 257 ARTSHLPLKVNMAGVIPAIFASSIILFPASITQWFGQSSEGFEWLFDLSQLLQPGQPLYI 316

Query: 320 VLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGA 379
           VL+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA
Sbjct: 317 VLFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGA 376

Query: 380 GYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRS 439
            Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q ++++ QY+ V KK+  
Sbjct: 377 LYITFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHMMSLQYDSVLKKANL 436

Query: 440 K 440
           K
Sbjct: 437 K 437


>gi|325205255|gb|ADZ00708.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           M04-240196]
          Length = 436

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 297/423 (70%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    L I    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALFIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
               + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 AGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++V ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAVTVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GALYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|269959709|ref|ZP_06174089.1| preprotein translocase subunit secY [Vibrio harveyi 1DA3]
 gi|269835632|gb|EEZ89711.1| preprotein translocase subunit secY [Vibrio harveyi 1DA3]
          Length = 444

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVMNQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|194099937|ref|YP_002003075.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           NCCP11945]
 gi|260439561|ref|ZP_05793377.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae DGI2]
 gi|268593796|ref|ZP_06127963.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae 35/02]
 gi|268600010|ref|ZP_06134177.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae MS11]
 gi|268604611|ref|ZP_06138778.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID1]
 gi|268687499|ref|ZP_06154361.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291042797|ref|ZP_06568538.1| preprotein translocase SECY subunit [Neisseria gonorrhoeae DGI2]
 gi|193935227|gb|ACF31051.1| preprotein translocase SECY subunit [Neisseria gonorrhoeae
           NCCP11945]
 gi|268547185|gb|EEZ42603.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae 35/02]
 gi|268584141|gb|EEZ48817.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae MS11]
 gi|268588742|gb|EEZ53418.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID1]
 gi|268627783|gb|EEZ60183.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291013231|gb|EFE05197.1| preprotein translocase SECY subunit [Neisseria gonorrhoeae DGI2]
 gi|317165389|gb|ADV08930.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 436

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 297/423 (70%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
               + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 AGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GALYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|261250397|ref|ZP_05942972.1| preprotein translocase SecY subunit [Vibrio orientalis CIP 102891]
 gi|323492139|ref|ZP_08097301.1| preprotein translocase subunit SecY [Vibrio brasiliensis LMG 20546]
 gi|260938966|gb|EEX94953.1| preprotein translocase SecY subunit [Vibrio orientalis CIP 102891]
 gi|323313700|gb|EGA66802.1| preprotein translocase subunit SecY [Vibrio brasiliensis LMG 20546]
          Length = 444

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+SL+IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISLLIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|330432104|gb|AEC17163.1| preprotein translocase subunit SecY [Gallibacterium anatis UMN179]
          Length = 441

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 297/429 (69%), Gaps = 1/429 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           N ++ S   +LK R++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFS
Sbjct: 9   NRSTQSGTSELKRRLLFVLGALIVFRIGSFIPVPGIDSAVLAQVIEQQKGTIVDMFNMFS 68

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R +VF+LGIMPYISASII+QL+ +  P+L  LKKEGE GR+ I++YTRY+T+ L 
Sbjct: 69  GGALSRASVFALGIMPYISASIIIQLLTSVYPALAELKKEGEAGRRKISKYTRYSTLALA 128

Query: 133 ILQAYGIAVGLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191
            +QA GI+ GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RG+GNG+SLI
Sbjct: 129 TIQAIGISTGLPNMLPGLVPNLGFGFYFTAVISLVTGTMFLMWLGEQITERGVGNGISLI 188

Query: 192 IFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPK 251
           IF+GIVAGLPS++   +E  R G +   ++LLI     AV   V+F ER QRRL++ Y K
Sbjct: 189 IFAGIVAGLPSAIAHTIEQARQGQMHLLVLLLIAVVVFAVTYFVVFVERGQRRLVVNYAK 248

Query: 252 RQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSL 311
           RQ G  M     S+LPLK+N AGV+P+IFASS++L PATI  +        W+  L   L
Sbjct: 249 RQQGRHMLAAQSSHLPLKVNMAGVIPAIFASSIILFPATITQWFGQGQGLDWLNDLSMLL 308

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY+V I+FF+FFY+A+ +NP++ ADNLKK G F+PGIRPG++T+ +ID ++
Sbjct: 309 HPGQPLYLILYAVAIIFFSFFYSAMQYNPRDTADNLKKSGAFLPGIRPGEQTSRYIDKIM 368

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+ ++G  Y+  VC+ P  + +   V     GTSLLI+V V++D I Q+Q +L++ QYE
Sbjct: 369 TRLALIGGLYVTFVCLVPYIMTSAWNVQFYFGGTSLLIVVVVIMDFIAQVQSHLMSSQYE 428

Query: 432 GVFKKSRSK 440
            V KK+  K
Sbjct: 429 SVLKKANLK 437


>gi|258622733|ref|ZP_05717751.1| preprotein translocase subunit secY [Vibrio mimicus VM573]
 gi|258625760|ref|ZP_05720639.1| preprotein translocase subunit secY [Vibrio mimicus VM603]
 gi|262166597|ref|ZP_06034334.1| preprotein translocase SecY subunit [Vibrio mimicus VM223]
 gi|262170487|ref|ZP_06038165.1| preprotein translocase SecY subunit [Vibrio mimicus MB-451]
 gi|258581998|gb|EEW06868.1| preprotein translocase subunit secY [Vibrio mimicus VM603]
 gi|258584921|gb|EEW09652.1| preprotein translocase subunit secY [Vibrio mimicus VM573]
 gi|261891563|gb|EEY37549.1| preprotein translocase SecY subunit [Vibrio mimicus MB-451]
 gi|262026313|gb|EEY44981.1| preprotein translocase SecY subunit [Vibrio mimicus VM223]
          Length = 444

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/424 (49%), Positives = 297/424 (70%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR+ F I AL+V+R G+++P+P ID    ++ F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLFFVIGALLVFRAGSFVPIPGIDAAVLAELFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKN--GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           GL N     +V D   F + +T+ +L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAG
Sbjct: 138 GLPNMVNNLVVIDQTMFTLIATV-SLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAG 196

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LPS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F
Sbjct: 197 LPSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVF 256

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRS 316
               ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+ 
Sbjct: 257 AAQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSTFGWLTDVSLALSPGQP 316

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+
Sbjct: 317 LYVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTL 376

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++ QYE V KK
Sbjct: 377 AGALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSHQYESVLKK 436

Query: 437 SRSK 440
           +  K
Sbjct: 437 ANLK 440


>gi|240948155|ref|ZP_04752558.1| preprotein translocase subunit SecY [Actinobacillus minor NM305]
 gi|240297508|gb|EER48015.1| preprotein translocase subunit SecY [Actinobacillus minor NM305]
          Length = 441

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/421 (49%), Positives = 297/421 (70%), Gaps = 2/421 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELVRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P L  LKKEGE GR+ I++YTRYAT+LL  +Q+ GI+V
Sbjct: 77  FALGIMPYISASIIIQLLTAIHPPLAELKKEGEAGRRKISKYTRYATLLLAFIQSIGISV 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N   G+V + +  F  + +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMLSGLVPNPNMLFYITAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G IS  ++LLI     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEEARQGEISFLVLLLIAVIAFAVTYFVVFVERGQRRIVVHYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSP-TWIVGLVDSLGHGRSFYM 319
              S+LPLK+N AGV+P+IFASS++L PA+I  +   SS    W+  L   L  G+  Y+
Sbjct: 257 ARTSHLPLKVNMAGVIPAIFASSIILFPASITQWFGQSSEGVEWLFDLSQLLQPGQPLYI 316

Query: 320 VLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGA 379
           VL+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA
Sbjct: 317 VLFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGA 376

Query: 380 GYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRS 439
            Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q ++++ QY+ V KK+  
Sbjct: 377 LYITFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHMMSLQYDSVLKKANL 436

Query: 440 K 440
           K
Sbjct: 437 K 437


>gi|126176335|ref|YP_001052484.1| preprotein translocase subunit SecY [Shewanella baltica OS155]
 gi|152998769|ref|YP_001364450.1| preprotein translocase subunit SecY [Shewanella baltica OS185]
 gi|160873346|ref|YP_001552662.1| preprotein translocase subunit SecY [Shewanella baltica OS195]
 gi|217975181|ref|YP_002359932.1| preprotein translocase subunit SecY [Shewanella baltica OS223]
 gi|304412785|ref|ZP_07394387.1| preprotein translocase, SecY subunit [Shewanella baltica OS183]
 gi|307307449|ref|ZP_07587184.1| preprotein translocase, SecY subunit [Shewanella baltica BA175]
 gi|125999540|gb|ABN63615.1| protein translocase subunit secY/sec61 alpha [Shewanella baltica
           OS155]
 gi|151363387|gb|ABS06387.1| preprotein translocase, SecY subunit [Shewanella baltica OS185]
 gi|160858868|gb|ABX47402.1| preprotein translocase, SecY subunit [Shewanella baltica OS195]
 gi|217500316|gb|ACK48509.1| preprotein translocase, SecY subunit [Shewanella baltica OS223]
 gi|304348865|gb|EFM13281.1| preprotein translocase, SecY subunit [Shewanella baltica OS183]
 gi|306910237|gb|EFN40670.1| preprotein translocase, SecY subunit [Shewanella baltica BA175]
 gi|315265573|gb|ADT92426.1| preprotein translocase, SecY subunit [Shewanella baltica OS678]
          Length = 446

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/422 (48%), Positives = 296/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ R ++
Sbjct: 17  ELKARLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQKGTILGMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTR+ T++LG  Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRWGTLVLGTFQSVGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNIGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLLAVIVFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYATAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|293390665|ref|ZP_06634999.1| preprotein translocase, SecY subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951199|gb|EFE01318.1| preprotein translocase, SecY subunit [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 441

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/420 (49%), Positives = 302/420 (71%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLIEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+A+  P+L  L+KEGE GR+ I++YTRY+TV+L  LQA GI+ 
Sbjct: 78  FALGIMPYISASIIIQLLASVHPALAELRKEGESGRRKISKYTRYSTVVLATLQAVGIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GI+AGL
Sbjct: 138 GLPNMLPGLVPNLGFGFYFTAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIIAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R+G +   ++LLI    +AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PAAIGQTIEQARLGQMHLLVLLLIAVIVLAVTYFVVFVERGQRRIKVEYAKRQQGKQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L PAT+  ++   SS  W+  L   L  G+  Y+V
Sbjct: 258 GHSTHLPLKVNMAGVIPAIFASSIILFPATLTQWVGQGSSLEWLTDLSMLLHPGQPLYLV 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+  I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++TR+T++G  
Sbjct: 318 VYASAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + A   V     GTSLLI+V V++D IVQIQ +L++ +YE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTAAWNVQFYFGGTSLLIVVVVIMDFIVQIQSHLMSTRYESALKKANLK 437


>gi|148982231|ref|ZP_01816657.1| protein translocase subunit SecY [Vibrionales bacterium SWAT-3]
 gi|145960593|gb|EDK25946.1| protein translocase subunit SecY [Vibrionales bacterium SWAT-3]
          Length = 444

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F  +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFDQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI   + AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLSFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|170695701|ref|ZP_02886843.1| preprotein translocase, SecY subunit [Burkholderia graminis C4D1M]
 gi|170139306|gb|EDT07492.1| preprotein translocase, SecY subunit [Burkholderia graminis C4D1M]
          Length = 448

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 306/429 (71%), Gaps = 4/429 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R VF ++ALIVYR G +IP+P ID    +K FQS+S GI G+FNMFSGGA
Sbjct: 13  SAAKFGDLRRRAVFLLLALIVYRVGAHIPVPGIDPDQLAKLFQSQSGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TVLL   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRIFTVLLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIAV L+N   +V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAVALENQPALVIDPGMVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    +++ +   AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAIGGLFELVRTGSMSIISAIIVVALIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +    S  +W       + +++
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILNWFSSGSRTSWFADTLHNVAEAI 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYALAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSK 440
            + KK+  K
Sbjct: 433 SLLKKANFK 441


>gi|152998251|ref|YP_001343086.1| preprotein translocase subunit SecY [Marinomonas sp. MWYL1]
 gi|150839175|gb|ABR73151.1| preprotein translocase, SecY subunit [Marinomonas sp. MWYL1]
          Length = 443

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 213/417 (51%), Positives = 289/417 (69%), Gaps = 1/417 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +RI F  +A+IVYR G +IP+P I+    S  F      I  LFN+FSGGA+ERM++
Sbjct: 17  ELWARIRFVFLAIIVYRIGAHIPVPGINPDRLSALFDQNEGTILSLFNVFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGI+PYISASII+QL+    P LE LKKEGE GR+ I QYTRY TVLL ++Q+  +AV
Sbjct: 77  FALGILPYISASIIMQLLTVVSPQLEQLKKEGEAGRRKITQYTRYGTVLLALVQSASMAV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           GL + QGI   S   F    ++TL+ GT+FL+WLGEQ+T +GIGNG+S++IF+GIVAGLP
Sbjct: 137 GLAS-QGISFSSGMEFYAVAVVTLVAGTVFLMWLGEQVTEKGIGNGISILIFAGIVAGLP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           S+L    E  R G I+   +LLI    +A IA V+F ER QRR+ + Y KRQ G ++F  
Sbjct: 196 SALGRSFESARQGDINILALLLIGILAIATIAFVVFIERGQRRITVNYAKRQQGKKVFAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFASS+LL PA+I  +        W+  +  +L  G+  Y++L
Sbjct: 256 QKSHLPLKVNMAGVIPPIFASSILLFPASIGQWFGQGEGMEWLQNISLALAPGQPLYVLL 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++ IVFF FFYTA+VFNPK+ ADNLKK G F+PGIRPGD TA +ID V+TR+T+ GA Y
Sbjct: 316 FAIAIVFFCFFYTALVFNPKDVADNLKKSGAFLPGIRPGDHTARYIDGVMTRLTLFGALY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           +  V + P+  +    VP    GTS+LI+V VV+D + Q+Q +L++QQYE + KKS 
Sbjct: 376 ITLVSLMPQFFVVAWNVPFYFGGTSMLIVVVVVMDFMSQVQSHLMSQQYESLMKKSN 432


>gi|134294463|ref|YP_001118198.1| preprotein translocase subunit SecY [Burkholderia vietnamiensis G4]
 gi|221201585|ref|ZP_03574623.1| preprotein translocase, SecY subunit [Burkholderia multivorans
           CGD2M]
 gi|221207340|ref|ZP_03580350.1| preprotein translocase, SecY subunit [Burkholderia multivorans
           CGD2]
 gi|221213478|ref|ZP_03586453.1| preprotein translocase, SecY subunit [Burkholderia multivorans
           CGD1]
 gi|134137620|gb|ABO53363.1| protein translocase subunit secY/sec61 alpha [Burkholderia
           vietnamiensis G4]
 gi|221166930|gb|EED99401.1| preprotein translocase, SecY subunit [Burkholderia multivorans
           CGD1]
 gi|221172928|gb|EEE05365.1| preprotein translocase, SecY subunit [Burkholderia multivorans
           CGD2]
 gi|221178401|gb|EEE10810.1| preprotein translocase, SecY subunit [Burkholderia multivorans
           CGD2M]
          Length = 449

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 228/433 (52%), Positives = 309/433 (71%), Gaps = 5/433 (1%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVIDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSS-SPTWIV----GLVDS 310
           N+++    S+LPLKLN +GV+P IFASS++L PATI+G+      S +WI      + ++
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILGWFSTGQPSGSWISNTLHNVAEA 312

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +
Sbjct: 313 LKPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRI 372

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LTR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQY
Sbjct: 373 LTRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQY 432

Query: 431 EGVFKKSRSKKKN 443
           E + KK+  K  N
Sbjct: 433 ESLLKKANFKGGN 445


>gi|206889576|ref|YP_002249226.1| preprotein translocase, SecY subunit [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741514|gb|ACI20571.1| preprotein translocase, SecY subunit [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 435

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/433 (47%), Positives = 296/433 (68%), Gaps = 6/433 (1%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  +  +L++R++FT+  L V+R G +IP P ID  + SK    +   + G F++F+G
Sbjct: 7   FRNILKIPELRARVLFTLAMLAVFRIGAHIPTPGIDGEALSKFLLERGGAVMGFFDIFTG 66

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+ ++ +F+LG+MPYISASII QL+   +PSL+ L KEGE+GRK I +YTRYAT+++  
Sbjct: 67  GALSKVTIFALGVMPYISASIIFQLLTVVIPSLQKLAKEGEEGRKKITRYTRYATIVIAA 126

Query: 134 LQAYGIAVGLKN--GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLI 191
           +Q +GIAVGL++  G   + +  + F   T+ITL  GT FL+WLGEQIT +GIGNG+SLI
Sbjct: 127 IQGFGIAVGLESMGGGQFIQEPGWSFRIITMITLTAGTAFLMWLGEQITEKGIGNGISLI 186

Query: 192 IFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPK 251
           IF+GIVA  P+++     L R G +S   +L++    V V+A +IF ER QRR+ IQY K
Sbjct: 187 IFAGIVARFPNAIFYTYNLVRTGELSIFFVLILIVVMVGVVAGIIFIERGQRRIPIQYAK 246

Query: 252 RQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSL 311
           R VG +M+    +YLPLK+N+AGV+P IFASS+L+ PAT+ GFI V     W+  L   +
Sbjct: 247 RVVGKKMYGGYTTYLPLKINSAGVIPPIFASSVLMFPATVAGFIAVP----WVQALAKQM 302

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G   +++LY   I+FF +FYTA+++NP E A+NL+K+GG+I GIRPG +T+ +I  VL
Sbjct: 303 SPGSFLHVILYVGLIIFFTYFYTAVIYNPVEIAENLQKNGGYITGIRPGQKTSEYIYRVL 362

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           +R+T +GA YL  VC+ PE LIA   VP    GTSLLI V V LDT+ QI+ ++I++ YE
Sbjct: 363 SRLTFIGALYLSAVCVLPEILIAKFKVPFYFGGTSLLIAVGVALDTVSQIETHMISRSYE 422

Query: 432 GVFKKSRSKKKNS 444
           G FKK R K +  
Sbjct: 423 GFFKKFRIKGRKD 435


>gi|304310036|ref|YP_003809634.1| Preprotein translocase subunit [gamma proteobacterium HdN1]
 gi|301795769|emb|CBL43968.1| Preprotein translocase subunit [gamma proteobacterium HdN1]
          Length = 446

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/425 (48%), Positives = 299/425 (70%), Gaps = 1/425 (0%)

Query: 20  AKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERM 79
           + +L +RI F ++A++VYR G +IP+P ID       FQ ++  I  LFNMFSGGA+ERM
Sbjct: 18  SSELIARIKFLLLAMVVYRIGAHIPVPGIDPEQLKHMFQQQAGTILSLFNMFSGGALERM 77

Query: 80  AVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGI 139
           +V +LGIMPYISASII+QL+ A  P LE LKKEGE GR+ I+QYTRY T+ LG+LQ++G+
Sbjct: 78  SVMALGIMPYISASIIMQLMQAVSPQLEQLKKEGEAGRRKISQYTRYGTLGLGVLQSFGM 137

Query: 140 AVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           ++ L++ QG+       ++   ++TL  GTMFL+WLGEQIT RGIGNG+S+IIF+GIVAG
Sbjct: 138 SLALQS-QGVTLAVGLAWILPAVLTLTTGTMFLMWLGEQITERGIGNGISMIIFAGIVAG 196

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LP ++   LE  R G +S  L++ +    V V+A V+F ERAQRR+ I + ++Q G  ++
Sbjct: 197 LPQAIGQSLESARQGELSEILLVALLGVAVLVVAGVVFMERAQRRITIHHARKQQGRAVY 256

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYM 319
           Q   S+LPLK+N AGV+P IFA+S+LL PA++  +   +   +W+  + ++L  G+  Y+
Sbjct: 257 QAQQSHLPLKINMAGVIPPIFATSILLFPASLGQWFGETEYASWLQDVANALNPGQPLYV 316

Query: 320 VLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGA 379
           +L++   VFF +FYTAI+FNPK+ A+NLKK G  +PGIRPG++TA +ID VL R+T +G+
Sbjct: 317 ILFAAANVFFCYFYTAIMFNPKDVAENLKKSGALVPGIRPGEQTARYIDSVLGRLTFIGS 376

Query: 380 GYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRS 439
            Y+  VC+ P  L A   VP  L GTSLLI+V VV+D + Q+Q ++++ QYE + KK+  
Sbjct: 377 IYITLVCLLPLILQAFGNVPFYLGGTSLLIVVVVVMDFMSQVQSHMLSHQYEPLMKKANL 436

Query: 440 KKKNS 444
           K   S
Sbjct: 437 KGYGS 441


>gi|167564397|ref|ZP_02357313.1| preprotein translocase subunit SecY [Burkholderia oklahomensis
           EO147]
 gi|167571543|ref|ZP_02364417.1| preprotein translocase subunit SecY [Burkholderia oklahomensis
           C6786]
 gi|167838192|ref|ZP_02465051.1| preprotein translocase subunit SecY [Burkholderia thailandensis
           MSMB43]
          Length = 448

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 307/432 (71%), Gaps = 4/432 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLMAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVTDPGAVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +        W+      + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILSWFSSGERKGWLSDTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAVYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSKKKN 443
            + KK+  K  N
Sbjct: 433 SLLKKANFKGGN 444


>gi|323495524|ref|ZP_08100598.1| preprotein translocase subunit SecY [Vibrio sinaloensis DSM 21326]
 gi|323319405|gb|EGA72342.1| preprotein translocase subunit SecY [Vibrio sinaloensis DSM 21326]
          Length = 444

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 295/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+SL+IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISLLIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHMMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|115350342|ref|YP_772181.1| preprotein translocase subunit SecY [Burkholderia ambifaria AMMD]
 gi|115280330|gb|ABI85847.1| protein translocase subunit secY/sec61 alpha [Burkholderia
           ambifaria AMMD]
          Length = 449

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 229/434 (52%), Positives = 310/434 (71%), Gaps = 7/434 (1%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVIDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIV----GLVD 309
           N+++    S+LPLKLN +GV+P IFASS++L PATI+G+   +  PT  WI      + +
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILGWFS-TGQPTGSWISNTLHNVAE 311

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
           +L  G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID 
Sbjct: 312 ALKPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDR 371

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           +LTR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQ
Sbjct: 372 ILTRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQ 431

Query: 430 YEGVFKKSRSKKKN 443
           YE + KK+  K  N
Sbjct: 432 YESLLKKANFKGGN 445


>gi|260770933|ref|ZP_05879862.1| preprotein translocase SecY subunit [Vibrio furnissii CIP 102972]
 gi|260614170|gb|EEX39360.1| preprotein translocase SecY subunit [Vibrio furnissii CIP 102972]
 gi|315178979|gb|ADT85893.1| preprotein translocase subunit SecY [Vibrio furnissii NCTC 11218]
          Length = 444

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/423 (48%), Positives = 293/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVVGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIIEMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  FALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+SL+IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISLLIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PKAIGQTIEQARQGELHVLLLLLIAVVAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSTFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHMMSNQYESVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|239818008|ref|YP_002946918.1| preprotein translocase subunit SecY [Variovorax paradoxus S110]
 gi|239804585|gb|ACS21652.1| preprotein translocase, SecY subunit [Variovorax paradoxus S110]
          Length = 437

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/405 (50%), Positives = 280/405 (69%), Gaps = 1/405 (0%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P I+    +  FQ +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGINPDQLAALFQGQQGGILSLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   +P+ E LKKEGE GR+ I QYTRY  + L + Q++ IAV L++  G+V    + 
Sbjct: 91  QLMTYVLPTFEQLKKEGEAGRRKITQYTRYGALGLALFQSFSIAVALESSAGLVISPGFG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  G+MFL+WLGEQIT RG+GNG+S++IF+GI AGLP+++  +  L   G++
Sbjct: 151 FRLTAMVSLTAGSMFLMWLGEQITERGLGNGISILIFAGIAAGLPNAIGGLASLVTTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           +  + L I +  V V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 NPIIALFIIAIVVLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSP-TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA 335
           P IFASS++LLPAT++G+         WI  +  +L  G   Y++LY+  IVFF FFYTA
Sbjct: 271 PPIFASSIILLPATVVGWFSTGEGGFGWIKDVAGALRPGEPIYVLLYAAAIVFFCFFYTA 330

Query: 336 IVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAV 395
           +VFN KE ADNLKK G FIPGIRPGD+TA +ID +L R+T+ GA Y+  VC+ PE LI  
Sbjct: 331 LVFNSKETADNLKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVYITFVCLLPEFLILK 390

Query: 396 TGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
             VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 391 YNVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 435


>gi|313667461|ref|YP_004047745.1| preprotein translocase SecY subunit [Neisseria lactamica ST-640]
 gi|313004923|emb|CBN86349.1| preprotein translocase SecY subunit [Neisseria lactamica 020-06]
          Length = 436

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/428 (47%), Positives = 301/428 (70%), Gaps = 2/428 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           + +  S+  DLK R+VF + AL+V+R G +IP+P +D ++ +K ++S   GI G+ NMFS
Sbjct: 6   SLSGLSKFGDLKKRLVFLLGALVVFRIGAHIPVPGVDAVALAKLYESAGGGILGILNMFS 65

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ER ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRK+I +YTRY TVLL 
Sbjct: 66  GGSLERFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKLITKYTRYGTVLLA 125

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           ILQ+ G+A      +GIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII
Sbjct: 126 ILQSLGVA-SFVFQRGIVVTSSFEFYVSTVVSLVTGTMFLMWLGEQITERGIGNGISLII 184

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
            +GI +G+PS +  ++     G++S  + LLI    + +I LV++FE AQR++ I Y KR
Sbjct: 185 TAGIASGIPSGITRLVAFVNQGTMSILMALLIVFGVLLLIYLVVYFESAQRKIPIHYAKR 244

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           Q  N    +  +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +V  L 
Sbjct: 245 QF-NSGLGNHNTHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSTDTNSILYKIVGLLQ 303

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
           HG+S YMVL++  ++FF +FYTA+ F+PKE A+NLKK G F+PGIRPG++T+ +++ V+ 
Sbjct: 304 HGQSLYMVLFAATVIFFCYFYTALFFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVL 363

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+T+ GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ 
Sbjct: 364 RLTLFGALYITIICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDK 423

Query: 433 VFKKSRSK 440
           +  +S  K
Sbjct: 424 LMIRSEMK 431


>gi|167582603|ref|ZP_02375477.1| preprotein translocase subunit SecY [Burkholderia thailandensis
           TXDOH]
          Length = 448

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 307/432 (71%), Gaps = 4/432 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLMAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVTDPGAVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +        W+      + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILSWFSSGERKGWLSDTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSKKKN 443
            + KK+  K  N
Sbjct: 433 SLLKKANFKGGN 444


>gi|53723834|ref|YP_104146.1| preprotein translocase subunit SecY [Burkholderia mallei ATCC
           23344]
 gi|76810582|ref|YP_335120.1| preprotein translocase subunit SecY [Burkholderia pseudomallei
           1710b]
 gi|121599319|ref|YP_994436.1| preprotein translocase subunit SecY [Burkholderia mallei SAVP1]
 gi|124384440|ref|YP_001027915.1| preprotein translocase subunit SecY [Burkholderia mallei NCTC
           10229]
 gi|126440036|ref|YP_001060730.1| preprotein translocase subunit SecY [Burkholderia pseudomallei 668]
 gi|126450304|ref|YP_001083010.1| preprotein translocase subunit SecY [Burkholderia mallei NCTC
           10247]
 gi|126451654|ref|YP_001068014.1| preprotein translocase subunit SecY [Burkholderia pseudomallei
           1106a]
 gi|134283265|ref|ZP_01769966.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           305]
 gi|161723191|ref|YP_109787.2| preprotein translocase subunit SecY [Burkholderia pseudomallei
           K96243]
 gi|167721557|ref|ZP_02404793.1| preprotein translocase subunit SecY [Burkholderia pseudomallei
           DM98]
 gi|167740531|ref|ZP_02413305.1| preprotein translocase subunit SecY [Burkholderia pseudomallei 14]
 gi|167817736|ref|ZP_02449416.1| preprotein translocase subunit SecY [Burkholderia pseudomallei 91]
 gi|167826133|ref|ZP_02457604.1| preprotein translocase subunit SecY [Burkholderia pseudomallei 9]
 gi|167847645|ref|ZP_02473153.1| preprotein translocase subunit SecY [Burkholderia pseudomallei
           B7210]
 gi|167896217|ref|ZP_02483619.1| preprotein translocase subunit SecY [Burkholderia pseudomallei
           7894]
 gi|167904599|ref|ZP_02491804.1| preprotein translocase subunit SecY [Burkholderia pseudomallei NCTC
           13177]
 gi|167912864|ref|ZP_02499955.1| preprotein translocase subunit SecY [Burkholderia pseudomallei 112]
 gi|167920823|ref|ZP_02507914.1| preprotein translocase subunit SecY [Burkholderia pseudomallei
           BCC215]
 gi|217424848|ref|ZP_03456345.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           576]
 gi|226198226|ref|ZP_03793797.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237814125|ref|YP_002898576.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238562964|ref|ZP_00439644.2| preprotein translocase, SecY subunit [Burkholderia mallei GB8 horse
           4]
 gi|242316138|ref|ZP_04815154.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           1106b]
 gi|254174760|ref|ZP_04881421.1| preprotein translocase, SecY subunit [Burkholderia mallei ATCC
           10399]
 gi|254180359|ref|ZP_04886957.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           1655]
 gi|254190322|ref|ZP_04896830.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198446|ref|ZP_04904867.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           S13]
 gi|254201219|ref|ZP_04907583.1| preprotein translocase, SecY subunit [Burkholderia mallei FMH]
 gi|254206560|ref|ZP_04912911.1| preprotein translocase, SecY subunit [Burkholderia mallei JHU]
 gi|254259846|ref|ZP_04950900.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           1710a]
 gi|254300596|ref|ZP_04968041.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           406e]
 gi|254357098|ref|ZP_04973372.1| preprotein translocase, SecY subunit [Burkholderia mallei
           2002721280]
 gi|52427257|gb|AAU47850.1| preprotein translocase, SecY subunit [Burkholderia mallei ATCC
           23344]
 gi|76580035|gb|ABA49510.1| preprotein translocase SecY subunit [Burkholderia pseudomallei
           1710b]
 gi|121228129|gb|ABM50647.1| preprotein translocase, SecY subunit [Burkholderia mallei SAVP1]
 gi|124292460|gb|ABN01729.1| preprotein translocase, SecY subunit [Burkholderia mallei NCTC
           10229]
 gi|126219529|gb|ABN83035.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           668]
 gi|126225296|gb|ABN88836.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           1106a]
 gi|126243174|gb|ABO06267.1| preprotein translocase, SecY subunit [Burkholderia mallei NCTC
           10247]
 gi|134245460|gb|EBA45553.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           305]
 gi|147747113|gb|EDK54189.1| preprotein translocase, SecY subunit [Burkholderia mallei FMH]
 gi|147752102|gb|EDK59168.1| preprotein translocase, SecY subunit [Burkholderia mallei JHU]
 gi|148026162|gb|EDK84247.1| preprotein translocase, SecY subunit [Burkholderia mallei
           2002721280]
 gi|157810514|gb|EDO87684.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           406e]
 gi|157937998|gb|EDO93668.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160695805|gb|EDP85775.1| preprotein translocase, SecY subunit [Burkholderia mallei ATCC
           10399]
 gi|169655186|gb|EDS87879.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           S13]
 gi|184210898|gb|EDU07941.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           1655]
 gi|217392304|gb|EEC32329.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           576]
 gi|225929746|gb|EEH25762.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           Pakistan 9]
 gi|237503263|gb|ACQ95581.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           MSHR346]
 gi|238521648|gb|EEP85098.1| preprotein translocase, SecY subunit [Burkholderia mallei GB8 horse
           4]
 gi|242139377|gb|EES25779.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           1106b]
 gi|254218535|gb|EET07919.1| preprotein translocase, SecY subunit [Burkholderia pseudomallei
           1710a]
          Length = 448

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 307/432 (71%), Gaps = 4/432 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLMAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVTDPGAVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +        W+      + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILSWFSSGERKGWMSDTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSKKKN 443
            + KK+  K  N
Sbjct: 433 SLLKKANFKGGN 444


>gi|15642571|ref|NP_232204.1| preprotein translocase subunit SecY [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121730154|ref|ZP_01682549.1| preprotein translocase, SecY subunit [Vibrio cholerae V52]
 gi|153831163|ref|ZP_01983830.1| preprotein translocase, SecY subunit [Vibrio cholerae 623-39]
 gi|227082693|ref|YP_002811244.1| preprotein translocase, SecY subunit [Vibrio cholerae M66-2]
 gi|229507372|ref|ZP_04396877.1| preprotein translocase SecY subunit [Vibrio cholerae BX 330286]
 gi|229509704|ref|ZP_04399185.1| preprotein translocase SecY subunit [Vibrio cholerae B33]
 gi|229513499|ref|ZP_04402963.1| preprotein translocase SecY subunit [Vibrio cholerae TMA 21]
 gi|229516829|ref|ZP_04406275.1| preprotein translocase SecY subunit [Vibrio cholerae RC9]
 gi|229524557|ref|ZP_04413962.1| preprotein translocase SecY subunit [Vibrio cholerae bv. albensis
           VL426]
 gi|229527494|ref|ZP_04416886.1| preprotein translocase SecY subunit [Vibrio cholerae 12129(1)]
 gi|229606878|ref|YP_002877526.1| preprotein translocase subunit SecY [Vibrio cholerae MJ-1236]
 gi|254851116|ref|ZP_05240466.1| preprotein translocase subunit SecY [Vibrio cholerae MO10]
 gi|255744455|ref|ZP_05418407.1| preprotein translocase SecY subunit [Vibrio cholera CIRS 101]
 gi|262401863|ref|ZP_06078428.1| preprotein translocase SecY subunit [Vibrio sp. RC586]
 gi|297581418|ref|ZP_06943341.1| preprotein translocase subunit SecY [Vibrio cholerae RC385]
 gi|298500600|ref|ZP_07010404.1| preprotein translocase, SecY subunit [Vibrio cholerae MAK 757]
 gi|12644346|sp|P78283|SECY_VIBCH RecName: Full=Preprotein translocase subunit secY
 gi|9657163|gb|AAF95717.1| preprotein translocase, SecY subunit [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121628096|gb|EAX60635.1| preprotein translocase, SecY subunit [Vibrio cholerae V52]
 gi|148873350|gb|EDL71485.1| preprotein translocase, SecY subunit [Vibrio cholerae 623-39]
 gi|227010581|gb|ACP06793.1| preprotein translocase, SecY subunit [Vibrio cholerae M66-2]
 gi|229335126|gb|EEO00611.1| preprotein translocase SecY subunit [Vibrio cholerae 12129(1)]
 gi|229338138|gb|EEO03155.1| preprotein translocase SecY subunit [Vibrio cholerae bv. albensis
           VL426]
 gi|229345892|gb|EEO10864.1| preprotein translocase SecY subunit [Vibrio cholerae RC9]
 gi|229349376|gb|EEO14332.1| preprotein translocase SecY subunit [Vibrio cholerae TMA 21]
 gi|229353178|gb|EEO18117.1| preprotein translocase SecY subunit [Vibrio cholerae B33]
 gi|229354877|gb|EEO19798.1| preprotein translocase SecY subunit [Vibrio cholerae BX 330286]
 gi|229369533|gb|ACQ59956.1| preprotein translocase SecY subunit [Vibrio cholerae MJ-1236]
 gi|254846821|gb|EET25235.1| preprotein translocase subunit SecY [Vibrio cholerae MO10]
 gi|255737980|gb|EET93373.1| preprotein translocase SecY subunit [Vibrio cholera CIRS 101]
 gi|262351835|gb|EEZ00966.1| preprotein translocase SecY subunit [Vibrio sp. RC586]
 gi|297534256|gb|EFH73094.1| preprotein translocase subunit SecY [Vibrio cholerae RC385]
 gi|297540769|gb|EFH76826.1| preprotein translocase, SecY subunit [Vibrio cholerae MAK 757]
 gi|327485058|gb|AEA79465.1| Preprotein translocase secY subunit [Vibrio cholerae LMA3894-4]
          Length = 444

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 296/424 (69%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR+ F I AL+V+R G+++P+P ID    ++ F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLFFVIGALLVFRAGSFVPIPGIDAAVLAELFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKN--GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           GL N     +V D   F + +T+ +L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAG
Sbjct: 138 GLPNMVNNLVVIDQTMFTLIATV-SLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAG 196

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LP ++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F
Sbjct: 197 LPKAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVF 256

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRS 316
               ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+ 
Sbjct: 257 AAQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSTFGWLTDVSLALSPGQP 316

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+
Sbjct: 317 LYVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTL 376

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++ QYE V KK
Sbjct: 377 AGALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSHQYESVLKK 436

Query: 437 SRSK 440
           +  K
Sbjct: 437 ANLK 440


>gi|59802140|ref|YP_208852.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae FA 1090]
 gi|293398182|ref|ZP_06642387.1| preprotein translocase, SecY subunit [Neisseria gonorrhoeae F62]
 gi|59719035|gb|AAW90440.1| putative preprotein translocase SecY subunit [Neisseria gonorrhoeae
           FA 1090]
 gi|291611445|gb|EFF40515.1| preprotein translocase, SecY subunit [Neisseria gonorrhoeae F62]
          Length = 436

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 296/423 (69%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
                 +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 A-GSQSTHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  +  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GAFYITTICLIPEFLTTILNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|15676089|ref|NP_273220.1| preprotein translocase subunit SecY [Neisseria meningitidis MC58]
 gi|121634036|ref|YP_974281.1| preprotein translocase subunit SecY [Neisseria meningitidis FAM18]
 gi|161870898|ref|YP_001600075.1| preprotein translocase subunit SecY [Neisseria meningitidis 053442]
 gi|218767148|ref|YP_002341660.1| preprotein translocase subunit SecY [Neisseria meningitidis Z2491]
 gi|304388963|ref|ZP_07371010.1| preprotein translocase subunit SecY [Neisseria meningitidis ATCC
           13091]
 gi|7225380|gb|AAF40620.1| preprotein translocase SecY subunit [Neisseria meningitidis MC58]
 gi|120865742|emb|CAM09471.1| preprotein translocase SecY subunit [Neisseria meningitidis FAM18]
 gi|121051156|emb|CAM07427.1| preprotein translocase SECY subunit [Neisseria meningitidis Z2491]
 gi|161596451|gb|ABX74111.1| preprotein translocase SECY subunit [Neisseria meningitidis 053442]
 gi|254670759|emb|CBA07026.1| preprotein translocase SecY subunit [Neisseria meningitidis
           alpha153]
 gi|254672689|emb|CBA06579.1| preprotein translocase SecY subunit [Neisseria meningitidis
           alpha275]
 gi|261391698|emb|CAX49147.1| preprotein translocase SecY subunit [Neisseria meningitidis 8013]
 gi|304337097|gb|EFM03284.1| preprotein translocase subunit SecY [Neisseria meningitidis ATCC
           13091]
 gi|316985688|gb|EFV64634.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           H44/76]
 gi|325129081|gb|EGC51930.1| preprotein translocase, SecY subunit [Neisseria meningitidis N1568]
 gi|325131052|gb|EGC53776.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           OX99.30304]
 gi|325133074|gb|EGC55746.1| preprotein translocase, SecY subunit [Neisseria meningitidis M6190]
 gi|325137220|gb|EGC59815.1| preprotein translocase, SecY subunit [Neisseria meningitidis M0579]
 gi|325139052|gb|EGC61598.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           ES14902]
 gi|325141175|gb|EGC63675.1| preprotein translocase, SecY subunit [Neisseria meningitidis CU385]
 gi|325143252|gb|EGC65591.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           961-5945]
 gi|325145359|gb|EGC67636.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           M01-240013]
 gi|325197449|gb|ADY92905.1| preprotein translocase, SecY subunit [Neisseria meningitidis G2136]
 gi|325199375|gb|ADY94830.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           H44/76]
 gi|325203003|gb|ADY98457.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           M01-240149]
 gi|325203282|gb|ADY98735.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           M01-240355]
 gi|325207199|gb|ADZ02651.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           NZ-05/33]
          Length = 436

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 296/423 (69%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    L I    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALFIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
               + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 AGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GALYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|296163301|ref|ZP_06846062.1| preprotein translocase, SecY subunit [Burkholderia sp. Ch1-1]
 gi|295886440|gb|EFG66297.1| preprotein translocase, SecY subunit [Burkholderia sp. Ch1-1]
          Length = 448

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 307/429 (71%), Gaps = 4/429 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R VF ++ALIVYR G +IP+P ID    +K FQS+S GI G+FNMFSGGA
Sbjct: 13  SAAKFGDLRRRAVFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TVLL   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRIFTVLLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIAV L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAVALENQPGLVIDPGMVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  ++ L + GS+S    +++ +   AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAIGGLVSLVQTGSMSPISAIIVVALIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +    S  +W       + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILNWFSSGSRTSWFADTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYALAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSK 440
            + KK+  K
Sbjct: 433 SLLKKANFK 441


>gi|269214265|ref|ZP_05986197.2| preprotein translocase, SecY subunit [Neisseria lactamica ATCC
           23970]
 gi|269210297|gb|EEZ76752.1| preprotein translocase, SecY subunit [Neisseria lactamica ATCC
           23970]
          Length = 427

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 299/423 (70%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R+VF + AL+V+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 2   SKFGDLKKRLVFLLGALVVFRIGAHIPVPGVDAVALAKLYESAGGGILGMLNMFSGGSLE 61

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRK+I +YTRY TVLL ILQ+ 
Sbjct: 62  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKLITKYTRYGTVLLAILQSL 121

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A      +GIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 122 GVA-SFVFQRGIVVTSSFEFYVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 180

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++     G++S  + LLI    + +I LV++FE AQR++ I Y KRQ  N 
Sbjct: 181 SGIPSGITRLVAFVNQGTMSILMALLIVFGVLLLIYLVVYFESAQRKIPIHYAKRQF-NS 239

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
              +  +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +V  L HG+S 
Sbjct: 240 GLGNHNTHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSTDTNSILYKIVGLLQHGQSL 299

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YMVL++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+  +T+ 
Sbjct: 300 YMVLFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLHLTLF 359

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 360 GALYITIICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMIRS 419

Query: 438 RSK 440
             K
Sbjct: 420 EMK 422


>gi|251767492|ref|ZP_02267471.2| preprotein translocase, SecY subunit [Burkholderia mallei PRL-20]
 gi|52211215|emb|CAH37204.1| preprotein translocase SecY subunit [Burkholderia pseudomallei
           K96243]
 gi|243062576|gb|EES44762.1| preprotein translocase, SecY subunit [Burkholderia mallei PRL-20]
          Length = 454

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 307/432 (71%), Gaps = 4/432 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 19  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 78

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 79  LSRFTIFALGIMPYISASIIMQLMAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 138

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 139 AFGIAAALENQPGLVTDPGAVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 198

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 199 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 258

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +        W+      + ++L
Sbjct: 259 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILSWFSSGERKGWMSDTLHNVAEAL 318

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 319 KPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 378

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 379 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 438

Query: 432 GVFKKSRSKKKN 443
            + KK+  K  N
Sbjct: 439 SLLKKANFKGGN 450


>gi|332175079|gb|AEE24333.1| preprotein translocase, SecY subunit [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 439

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/420 (48%), Positives = 294/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A+IV+R G+Y+P+P ID    ++ F  +   I  +FNMFSGGA+ER +V
Sbjct: 16  ELKSRLLFVLGAIIVFRLGSYVPIPGIDAAVLAELFDQQKGTIVEMFNMFSGGALERASV 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYI+ASII+QL+    P +  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 76  LALGIMPYITASIIIQLLTVMHPPMMELKKEGEAGRRKISQYTRYFTLVLATFQAIGIAT 135

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N   G+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIV+GL
Sbjct: 136 NLPNLISGLVINPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVSGL 195

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++    E  R G ++   +LLI    VA+   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 196 PTAIGQTAEQARQGDLNLLFLLLIGVIIVAITYFVVFVERGQRRIVVNYAKRQQGRKVFA 255

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P TI  +   + S +W+  +   L  G+  Y++
Sbjct: 256 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIANWFGQNESFSWLQEVALMLSPGQPLYVM 315

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
            Y+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++T+ ++D V+TR+T+ GA 
Sbjct: 316 FYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTSRYVDKVMTRLTLAGAL 375

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    VP    GTSLLI+V V++D + Q+Q +L++ QYE V KK+  K
Sbjct: 376 YITFICLVPEFMLIAWNVPFYFGGTSLLIMVVVIMDFMAQVQTHLMSHQYESVLKKANLK 435


>gi|261380579|ref|ZP_05985152.1| preprotein translocase, SecY subunit [Neisseria subflava NJ9703]
 gi|284796547|gb|EFC51894.1| preprotein translocase, SecY subunit [Neisseria subflava NJ9703]
          Length = 437

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/428 (47%), Positives = 301/428 (70%), Gaps = 1/428 (0%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           + +  S+  DLK R+VF + AL+V+R G +IP+P +D ++ +K ++  + GIFG+ NMFS
Sbjct: 6   SLSGLSKFGDLKKRLVFLLGALVVFRIGAHIPVPGVDAVALAKLYEGAANGIFGMLNMFS 65

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ER ++F++GIMPYIS+SIIVQL +  VPSL+ LKKEGE GRK+I +YTRY TVLL 
Sbjct: 66  GGSLERFSIFAIGIMPYISSSIIVQLASEIVPSLKALKKEGEAGRKIITKYTRYGTVLLA 125

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           +LQ++G+A  +   QG+V  S   F  ST++ L+ GTMFL+WLGEQIT RGIGNG+SLII
Sbjct: 126 VLQSFGVATFVYQ-QGVVVTSSLEFHISTVVCLVTGTMFLMWLGEQITERGIGNGISLII 184

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
            +GIV+G+PS +V +L L   GS+S  + + I    + +I  V++FE AQR++ + Y KR
Sbjct: 185 TAGIVSGIPSGIVRLLTLTEQGSMSMLMAVSIVIGILLLIYAVVYFESAQRKVPVHYAKR 244

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           Q G+ +      ++P KLN AGV+P IFASS++L P+T++G+   +S+ + +  +   L 
Sbjct: 245 QFGSGIMPGQSIHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSNSTNSVLHKVAAMLQ 304

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
           HG+  Y+ L++  I+FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ 
Sbjct: 305 HGQPLYIGLFATTIIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVL 364

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG 432
           R+T+ GA Y+  +C+ PE L     VP  L GTSLLI+V V +D   QI  Y+++ QYE 
Sbjct: 365 RLTLFGALYITTICLIPEFLTTALNVPFYLGGTSLLILVVVTMDFRTQINSYVMSSQYED 424

Query: 433 VFKKSRSK 440
           +  +   K
Sbjct: 425 LMSRPDMK 432


>gi|109897334|ref|YP_660589.1| preprotein translocase subunit SecY [Pseudoalteromonas atlantica
           T6c]
 gi|109699615|gb|ABG39535.1| protein translocase subunit secY/sec61 alpha [Pseudoalteromonas
           atlantica T6c]
          Length = 439

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/420 (47%), Positives = 294/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A+IV+R G+Y+P+P ID    ++ F  +   I  +FNMFSGGA+ER +V
Sbjct: 16  ELKSRLLFVLGAIIVFRLGSYVPIPGIDAAVLAELFDQQKGTIVEMFNMFSGGALERASV 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYI+ASII+QL+    P +  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 76  LALGIMPYITASIIIQLLTVMHPPMMELKKEGEAGRRKISQYTRYFTLVLATFQAIGIAT 135

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N   G+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIV+GL
Sbjct: 136 NLPNLISGLVINPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVSGL 195

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++    E  R G ++   +LLI    +A+   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 196 PTAIGQTAEQARQGDLNLLFLLLIGVIIIAITYFVVFVERGQRRIVVNYAKRQQGRKVFA 255

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P TI  +   + S +W+  +   L  G+  Y++
Sbjct: 256 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIANWFGQNESFSWLQEVALMLSPGQPLYVM 315

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
            Y+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++T+ ++D V+TR+T+ GA 
Sbjct: 316 FYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTSRYVDKVMTRLTLAGAL 375

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    VP    GTSLLI+V V++D + Q+Q +L++ QYE V KK+  K
Sbjct: 376 YITFICLVPEFMLIAWNVPFYFGGTSLLIMVVVIMDFMAQVQTHLMSHQYESVLKKANLK 435


>gi|113968564|ref|YP_732357.1| preprotein translocase subunit SecY [Shewanella sp. MR-4]
 gi|114045727|ref|YP_736277.1| preprotein translocase subunit SecY [Shewanella sp. MR-7]
 gi|117918677|ref|YP_867869.1| preprotein translocase subunit SecY [Shewanella sp. ANA-3]
 gi|113883248|gb|ABI37300.1| protein translocase subunit secY/sec61 alpha [Shewanella sp. MR-4]
 gi|113887169|gb|ABI41220.1| protein translocase subunit secY/sec61 alpha [Shewanella sp. MR-7]
 gi|117611009|gb|ABK46463.1| protein translocase subunit secY/sec61 alpha [Shewanella sp. ANA-3]
          Length = 446

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/422 (48%), Positives = 296/422 (70%), Gaps = 1/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK+R++F I A+IV+R G+++P+P ID    ++ F  +   I G+FNMFSGGA+ R ++
Sbjct: 17  ELKARLLFVIGAIIVFRAGSFVPIPGIDAAVLAELFAQQKGTILGMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GRK I+QYTR+ T++LG  Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLLTVVHPALAELKKEGESGRKKISQYTRWGTLVLGTFQSIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F  +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 137 GLPNLVPGLVVNIGFGFYFVAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  ++LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNVLVLLLLAVIIFAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P IFASS++L P T+  +   + S +W+     ++  G+  Y +
Sbjct: 257 AQSTHLPLKINMAGVIPPIFASSIILFPGTLAQWFGQNESMSWLSDFSLAVSPGQPLYSL 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ GA 
Sbjct: 317 LYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q ++++ QYE V KK+   
Sbjct: 377 YITFICLIPEFMLIAWKVQFYFGGTSLLIMVVVIMDFMAQVQTHMMSHQYESVMKKANLV 436

Query: 441 KK 442
            K
Sbjct: 437 NK 438


>gi|254805794|ref|YP_003084015.1| preprotein translocase SecY subunit [Neisseria meningitidis
           alpha14]
 gi|254669336|emb|CBA08387.1| preprotein translocase SecY subunit [Neisseria meningitidis
           alpha14]
          Length = 436

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 295/423 (69%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    L I    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALFIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
                 +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 A-GSQYTHMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GALYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|315633475|ref|ZP_07888765.1| preprotein translocase subunit SecY [Aggregatibacter segnis ATCC
           33393]
 gi|315477517|gb|EFU68259.1| preprotein translocase subunit SecY [Aggregatibacter segnis ATCC
           33393]
          Length = 441

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/420 (48%), Positives = 300/420 (71%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+SR++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELRSRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLIEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+A+  P+L  L+KEGE GR+ I++YTRY+TV+L  LQA GI+ 
Sbjct: 78  FALGIMPYISASIIIQLLASVHPALAELRKEGESGRRKISKYTRYSTVVLATLQAVGIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+ +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPNMLPGLVPNLGFGFYFTAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R+G +   +++LI      V   V+F ER QRR+ I+Y KRQ G ++  
Sbjct: 198 PAAVGQTIEQARLGQMHFLVLILIAVIVFVVTYFVVFVERGQRRIKIEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L PAT+  ++   SS  W+  L   L  G+  Y++
Sbjct: 258 GHTTHLPLKVNMAGVIPAIFASSIILFPATLTQWVGQGSSLEWLTDLSMLLHPGQPLYLI 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+  I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++TR+T++G  
Sbjct: 318 VYATAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQIQ +L++ +YE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTSAWNVQFYFGGTSLLIVVVVIMDFIVQIQSHLMSTKYESALKKANLK 437


>gi|167587752|ref|ZP_02380140.1| preprotein translocase subunit SecY [Burkholderia ubonensis Bu]
          Length = 449

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/433 (51%), Positives = 310/433 (71%), Gaps = 5/433 (1%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLMAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVTDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  +LEL + GS+     ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLLELVKTGSMGPFSAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSS-SPTW----IVGLVDS 310
           N+++    S+LPLKLN +GV+P IFASS++L PATI+G+      S +W    +  + ++
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILGWFSTGQPSGSWFSNTLHNVAEA 312

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPG++TA +ID +
Sbjct: 313 LKPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGEQTARYIDRI 372

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LTR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQY
Sbjct: 373 LTRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQY 432

Query: 431 EGVFKKSRSKKKN 443
           E + KK+  K  N
Sbjct: 433 ESLLKKANFKGGN 445


>gi|147673663|ref|YP_001218070.1| preprotein translocase subunit SecY [Vibrio cholerae O395]
 gi|146315546|gb|ABQ20085.1| preprotein translocase, SecY subunit [Vibrio cholerae O395]
 gi|227014465|gb|ACP10675.1| preprotein translocase, SecY subunit [Vibrio cholerae O395]
          Length = 444

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 295/424 (69%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
            LKSR+ F I AL+V+R G+++P+P ID    ++ F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  KLKSRLFFVIGALLVFRAGSFVPIPGIDAAVLAELFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKN--GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           GL N     +V D   F + +T+ +L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAG
Sbjct: 138 GLPNMVNNLVVIDQTMFTLIATV-SLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAG 196

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LP ++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F
Sbjct: 197 LPKAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVF 256

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRS 316
               ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+ 
Sbjct: 257 AAQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSTFGWLTDVSLALSPGQP 316

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+
Sbjct: 317 LYVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTL 376

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++ QYE V KK
Sbjct: 377 AGALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSHQYESVLKK 436

Query: 437 SRSK 440
           +  K
Sbjct: 437 ANLK 440


>gi|186477567|ref|YP_001859037.1| preprotein translocase subunit SecY [Burkholderia phymatum STM815]
 gi|184194026|gb|ACC71991.1| preprotein translocase, SecY subunit [Burkholderia phymatum STM815]
          Length = 448

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 305/429 (71%), Gaps = 4/429 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R VF ++AL+VYR G +IP+P ID    +K FQS+S GI G+FNMFSGGA
Sbjct: 13  SAAKFGDLRRRAVFLLLALVVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRVFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIAV L+N   +V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAVALENQPALVIDPGMVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    +++ +   AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAIGGLFELVRTGSMSIISAIIVVALIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +    S   W       + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILNWFSSGSRTGWFADTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYALAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSK 440
            + KK+  K
Sbjct: 433 SLLKKANFK 441


>gi|261211131|ref|ZP_05925420.1| preprotein translocase SecY subunit [Vibrio sp. RC341]
 gi|260839632|gb|EEX66243.1| preprotein translocase SecY subunit [Vibrio sp. RC341]
          Length = 444

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 295/424 (69%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR+ F I AL+V+R G+++P+P ID    +  F+ +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLFFVIGALLVFRAGSFVPIPGIDAAVLADLFEQQKGTIIEMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  FALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKN--GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           GL N     +V D   F + +T+ +L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAG
Sbjct: 138 GLPNMVNNLVVIDQTMFTLIATV-SLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAG 196

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LP ++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F
Sbjct: 197 LPKAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVF 256

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRS 316
               ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+ 
Sbjct: 257 AAQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSTFGWLTDVSLALSPGQP 316

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+
Sbjct: 317 LYVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTL 376

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++ QYE V KK
Sbjct: 377 AGALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSHQYESVLKK 436

Query: 437 SRSK 440
           +  K
Sbjct: 437 ANLK 440


>gi|148244349|ref|YP_001219043.1| preprotein translocase SecY subunit [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326176|dbj|BAF61319.1| preprotein translocase SecY subunit [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 433

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 295/422 (69%), Gaps = 4/422 (0%)

Query: 20  AKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERM 79
           ++DL  RI+F + ALI++R GT+I +P I  I+ +   Q++   I  +FNMFSGGA+ER+
Sbjct: 9   SQDLSKRILFLLGALIIFRLGTHITIPFISSIALASLVQNQQGTILDMFNMFSGGALERL 68

Query: 80  AVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGI 139
           ++F+LGIMPYIS+SII+QL+ + VP LE LKKEGE G++ I QYTR  TV+L + Q+YGI
Sbjct: 69  SIFTLGIMPYISSSIIIQLMTSVVPKLEQLKKEGETGKRRITQYTRIGTVILAVFQSYGI 128

Query: 140 AVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           ++ L++    G  +V+ S + F   T++TL  GT+FL+WLGEQIT +GIGNG+S+IIF+G
Sbjct: 129 SIALQSQSSGGVTLVTQSGFTFSMVTVVTLTTGTLFLMWLGEQITEKGIGNGISMIIFAG 188

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           IV+GLPS+  S L L   G +S  L++++   T  VIA V+F ER QRR+ + Y KRQ G
Sbjct: 189 IVSGLPSAFGSTLSLVSTGELSIILVVILLIMTSLVIAFVVFMERGQRRITVNYAKRQRG 248

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGR 315
            +M     SYLPLK+N AGV+P IFASS++L PAT+ G+   S    W+  + +S+  G+
Sbjct: 249 RKMIGAQSSYLPLKINMAGVIPPIFASSIILFPATLGGWFSRSEGMGWLADITESISPGQ 308

Query: 316 SFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVT 375
             Y++ Y + IVFF FFYTA+ F+ K+ ADNL+K GGFIPGIRPG  +A +ID V++R+T
Sbjct: 309 PLYVLFYGLAIVFFTFFYTALTFDSKDTADNLRKSGGFIPGIRPGKHSADYIDSVMSRLT 368

Query: 376 VVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFK 435
             GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D I Q Q +L++ QY  + K
Sbjct: 369 ASGAVYITAVCLLPEFLILYWNVPFYFGGTSLLIIVVVVMDFIAQAQSHLMSNQYGSLMK 428

Query: 436 KS 437
           K+
Sbjct: 429 KA 430


>gi|229521642|ref|ZP_04411060.1| preprotein translocase SecY subunit [Vibrio cholerae TM 11079-80]
 gi|229341236|gb|EEO06240.1| preprotein translocase SecY subunit [Vibrio cholerae TM 11079-80]
          Length = 444

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 293/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR+ F I AL+V+R G+++P+P ID    ++ F+ +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLFFVIGALLVFRAGSFVPIPGIDAAVLAELFEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 138 GLPNMVNNLVVINQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PKAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              ++LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSTHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSTFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++ QYE V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSHQYESVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|156973071|ref|YP_001443978.1| preprotein translocase subunit SecY [Vibrio harveyi ATCC BAA-1116]
 gi|156524665|gb|ABU69751.1| hypothetical protein VIBHAR_00750 [Vibrio harveyi ATCC BAA-1116]
          Length = 444

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 294/423 (69%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F I AL+V+R G+++P+P ID    +   + +   I  +FNMFSGGA+ER ++
Sbjct: 18  ELKSRLLFVIGALLVFRAGSFVPIPGIDAAVLADLVEQQKGTIVEMFNMFSGGALERASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI+VQL+    P+L  LKKEGE GR+ I+QYTRY T++L   QA GIA 
Sbjct: 78  LALGIMPYISASIVVQLLTVVHPALAELKKEGEAGRRKISQYTRYGTLVLATFQAIGIAT 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V  +   F     ++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVAGL
Sbjct: 138 GLPNMVDNLVVMNQTMFTLIATVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   L+LLI     AVI  V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 198 PSAIGQTIEQARQGELHVLLLLLIAVLAFAVIYFVVFMERGQRRIVVNYAKRQQGRKVFA 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATI---MGFIDVSSSPTWIVGLVDSLGHGRSF 317
              S+LPLK+N AGV+P+IFASS++L P T+    G    SS+  W+  +  +L  G+  
Sbjct: 258 AQSSHLPLKINMAGVIPAIFASSIILFPGTLAQWFGQNGESSAFGWLTDVSLALSPGQPL 317

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+ 
Sbjct: 318 YVMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLA 377

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE ++    V     GTSLLI+V V++D + Q+Q +L++QQY+ V KK+
Sbjct: 378 GALYITFICLIPEFMMVAWNVRFYFGGTSLLIVVVVIMDFMAQVQTHLMSQQYDSVLKKA 437

Query: 438 RSK 440
             K
Sbjct: 438 NLK 440


>gi|325529698|gb|EGD06561.1| preprotein translocase subunit SecY [Burkholderia sp. TJI49]
          Length = 449

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 228/433 (52%), Positives = 308/433 (71%), Gaps = 5/433 (1%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVIDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDV-SSSPTWIV----GLVDS 310
           N+++    S LPLKLN +GV+P IFASS++L PATI+G+      S +WI      + ++
Sbjct: 253 NKIYGGQSSPLPLKLNMSGVIPPIFASSIILFPATILGWFSTGQPSGSWISNTLHNVAEA 312

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +
Sbjct: 313 LKPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRI 372

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LTR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQY
Sbjct: 373 LTRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQY 432

Query: 431 EGVFKKSRSKKKN 443
           E + KK+  K  N
Sbjct: 433 ESLLKKANFKGGN 445


>gi|288575868|ref|ZP_06394024.1| preprotein translocase, SecY subunit [Neisseria mucosa ATCC 25996]
 gi|288566923|gb|EFC88483.1| preprotein translocase, SecY subunit [Neisseria mucosa ATCC 25996]
          Length = 445

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/433 (48%), Positives = 304/433 (70%), Gaps = 8/433 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           + +  S+  DLK R+ F + AL+V+R G +IP+P +D ++ +K ++S   GI G+ NMFS
Sbjct: 17  SLSGLSKFGDLKKRLTFLLGALVVFRIGAHIPVPGVDAVALAKLYESAGNGILGMLNMFS 76

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ER ++F++GIMPYISASIIVQL +  VPSL+ LKKEGE GRKVI +YTRY TVLL 
Sbjct: 77  GGSLERFSIFAIGIMPYISASIIVQLASEIVPSLKALKKEGEAGRKVITKYTRYGTVLLA 136

Query: 133 ILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLII 192
           ILQ++G+A  +   QG+V  +   F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII
Sbjct: 137 ILQSFGVATFVFQ-QGVVVTNSLEFHISTVVSLVTGTMFLMWLGEQITERGIGNGISLII 195

Query: 193 FSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKR 252
            +GI AG+PS +  +L L   G    P+ ++I    + +I +V++FE AQR++ + Y KR
Sbjct: 196 TAGIAAGIPSGISRLLALTSRG-FGLPIAIVI--GALLLIYIVVYFESAQRKVPVHYAKR 252

Query: 253 QVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLG 312
           QVG+ + Q   +++P KLN AGV+P IFASS++L P+T++ +   S + + +  +   L 
Sbjct: 253 QVGSGVMQGSNTHMPFKLNMAGVIPPIFASSIILFPSTLLSWFGPSDTGSLLHKIAGLLQ 312

Query: 313 HGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLT 372
           HG++ Y++L++V I+FF +FYTA+VF+PKE A+NLKK G F+PGIRPG +T+ +++ V+ 
Sbjct: 313 HGQALYILLFTVAIIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGKQTSQYLEQVVL 372

Query: 373 RVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE- 431
           R+T+ GA Y+  +C+ PE L     VP  L GTSLLI+V V +D   QI  Y + QQYE 
Sbjct: 373 RLTLFGALYITTICLIPEFLTTALNVPFYLGGTSLLILVVVTMDFSTQINSYRMTQQYES 432

Query: 432 ---GVFKKSRSKK 441
              G+  KS S+K
Sbjct: 433 LMSGLDMKSLSRK 445


>gi|192361952|ref|YP_001981228.1| preprotein translocase subunit SecY [Cellvibrio japonicus Ueda107]
 gi|190688117|gb|ACE85795.1| preprotein translocase, SecY subunit [Cellvibrio japonicus Ueda107]
          Length = 445

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/443 (46%), Positives = 300/443 (67%), Gaps = 14/443 (3%)

Query: 10  SNLNFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFN 69
           SNL  A+     +L +R+ F  +A+++YR GT+IP+P +D    +  F      I G+FN
Sbjct: 5   SNLPLANQRGLGELWARLRFLFLAIVIYRIGTHIPVPGLDPERIANLFNQNQGTILGMFN 64

Query: 70  MFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATV 129
           MFSGGA+ERM++ +LGIMPYISASII+QL+ A  PSLE LKKEG+ GR+ INQYTRY TV
Sbjct: 65  MFSGGALERMSILALGIMPYISASIIMQLLTAVTPSLEQLKKEGDAGRRKINQYTRYFTV 124

Query: 130 LLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           +L  +QA  +AV   +G     +  + + F  +++L+ G +F++WLGEQ+T RGIGNG+S
Sbjct: 125 VLASVQALAMAVSF-SGFAYGGEPGFAYYFIAVVSLVTGAIFMMWLGEQVTERGIGNGIS 183

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           ++IF+GIVAG+PS++    E  R G ++   +L++    + +I LV+  ER QRR+ + Y
Sbjct: 184 MLIFAGIVAGMPSAIGQAFESARQGDLNILALLIVAILALVIIWLVVRIERGQRRITVNY 243

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KRQ G + +    S+LPLK+N +GV+P+IFASS+LL PA+I  +           G+++
Sbjct: 244 AKRQQGRQAYAAQSSHLPLKINMSGVIPAIFASSILLFPASIAQWFGQGGD-----GVIN 298

Query: 310 --------SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGD 361
                   ++G G+  Y++L++  I FF FFYTA++FNP+E ADNLKK G +IPGIRPG+
Sbjct: 299 NVLQEIALAIGPGQPLYILLFAGLITFFCFFYTALMFNPREVADNLKKSGAYIPGIRPGE 358

Query: 362 RTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQI 421
            +A +ID VLTR+TVVGA Y+  VC+ PE LI VT VP  L GTSLLI+V V++D + Q+
Sbjct: 359 HSAKYIDSVLTRLTVVGAIYMSAVCLLPEFLIVVTNVPFYLGGTSLLIVVVVLMDFMSQV 418

Query: 422 QGYLIAQQYEGVFKKSRSKKKNS 444
           Q +L++ QYE + KKS  K   S
Sbjct: 419 QAHLMSHQYESLMKKSNLKGYGS 441


>gi|91785445|ref|YP_560651.1| preprotein translocase subunit SecY [Burkholderia xenovorans LB400]
 gi|187925596|ref|YP_001897238.1| preprotein translocase subunit SecY [Burkholderia phytofirmans
           PsJN]
 gi|91689399|gb|ABE32599.1| protein translocase subunit secY/sec61 alpha [Burkholderia
           xenovorans LB400]
 gi|187716790|gb|ACD18014.1| preprotein translocase, SecY subunit [Burkholderia phytofirmans
           PsJN]
          Length = 448

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 306/429 (71%), Gaps = 4/429 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R VF ++ALIVYR G +IP+P ID    +K FQS+S GI G+FNMFSGGA
Sbjct: 13  SAAKFGDLRRRAVFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQSGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TVLL   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRIFTVLLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIAV L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAVALENQPGLVIDPGMVFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  ++ L + GS+S    +++ +   AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAIGGLVSLVQTGSMSPISAIIVVALIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +    S   W       + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILNWFSSGSRTGWFADTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYALAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSK 440
            + KK+  K
Sbjct: 433 SLLKKANFK 441


>gi|189424430|ref|YP_001951607.1| preprotein translocase subunit SecY [Geobacter lovleyi SZ]
 gi|189420689|gb|ACD95087.1| preprotein translocase, SecY subunit [Geobacter lovleyi SZ]
          Length = 437

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/437 (48%), Positives = 288/437 (65%), Gaps = 11/437 (2%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  R  +LK R++FT+  L VYR G +IP P ID I+ S  F+     + GLF+MFSG
Sbjct: 5   FQNIFRIPELKKRVLFTLGMLAVYRVGCHIPTPGIDSIALSHFFKQAQGTLLGLFDMFSG 64

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+ERM+VF+LGIMPYIS+SII QL+   VP++E L KEGE GRK I QYTRY T+LL +
Sbjct: 65  GALERMSVFALGIMPYISSSIIFQLLTVVVPAIEKLSKEGEAGRKKITQYTRYGTILLSV 124

Query: 134 LQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           +Q  GIA+GL++     G+ +V    + F   TIITL  GT F++WLGEQ+T RGIGNG+
Sbjct: 125 VQGSGIAIGLESMRGPAGELVVPTPGWSFRLMTIITLTAGTAFIMWLGEQMTERGIGNGI 184

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GIV  +PS++ +  +L   G++S   ++ + +   AVIA ++F ER QRRL I 
Sbjct: 185 SLIIFAGIVVRIPSAIANTGKLINSGNLSLFALIFVLALMAAVIAAIVFVERGQRRLPIH 244

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KR  G + F    S+LPLK+N AGV+P IFASS+++ PAT+  FI+V +    +    
Sbjct: 245 YAKRVTGLKTFSPQTSHLPLKVNMAGVIPPIFASSIIMFPATVANFINVPA----VQQFA 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             L  G   Y V Y  FIVFF +FYTA+ FNP + A+N+KKHGG+IPGIRPG  T+ ++D
Sbjct: 301 KMLTPGNWLYNVFYVAFIVFFCYFYTAVTFNPADVAENIKKHGGYIPGIRPGKETSEYMD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIA--VTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLI 426
            +LTR+T  GA Y+  VC+ P  L+      +P    GTSLLI V V +DT+ QI+ +LI
Sbjct: 361 SILTRLTFAGAIYISLVCVLPSLLVGGFKLNLPFYFGGTSLLIAVGVGMDTVAQIESHLI 420

Query: 427 AQQYEGVFKKSRSKKKN 443
            + YEG  K  R + + 
Sbjct: 421 TRNYEGFLKGVRIRGRR 437


>gi|15603260|ref|NP_246334.1| preprotein translocase subunit SecY [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|12721770|gb|AAK03479.1| SecY [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 441

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/420 (48%), Positives = 297/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVFRIGSFIPVPGIDAAVLAQLVEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+    P+L  LKKEGE GR+ I++YTRY+T++L  LQA GI+ 
Sbjct: 78  FALGIMPYISASIIIQLLTTVHPALAELKKEGEAGRRKISKYTRYSTLVLATLQAVGIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F  + +I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 138 GLPNMLPGLVPNVGFSFYLAAVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++   +E  R G +   ++LLI     AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PSAIGQTIEQTRQGQMHLLVLLLIAVIVFAVTYFVVFVERGQRRIKVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N AGV+P+IFASS++L PAT+  ++   SS  W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMAGVIPAIFASSIILFPATLAQWLGEGSSLEWLTDLSMLLHPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID ++TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKIMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D I Q+Q +L++ +YE   KK+  K
Sbjct: 378 YITFVCLVPYVMTSAWNVQFYFGGTSLLIVVVVIMDFIAQVQSHLMSTKYESALKKANLK 437


>gi|330815269|ref|YP_004358974.1| Preprotein translocase SecY [Burkholderia gladioli BSR3]
 gi|327367662|gb|AEA59018.1| Preprotein translocase SecY [Burkholderia gladioli BSR3]
          Length = 448

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 223/432 (51%), Positives = 306/432 (70%), Gaps = 4/432 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++AL+VYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALVVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRVFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVIDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +       +W+      + ++L
Sbjct: 253 NKIYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILSWFSSGERKSWLSDTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSKKKN 443
            + KK+  K  N
Sbjct: 433 SLLKKANFKGSN 444


>gi|301057489|ref|ZP_07198585.1| preprotein translocase, SecY subunit [delta proteobacterium NaphS2]
 gi|300448417|gb|EFK12086.1| preprotein translocase, SecY subunit [delta proteobacterium NaphS2]
          Length = 437

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 212/429 (49%), Positives = 290/429 (67%), Gaps = 6/429 (1%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +  +LK +I+FT++ L VYR G +IP P ID  + +  F ++   +FGLF+MFSGGA+ +
Sbjct: 10  KIPELKKKILFTLMMLAVYRVGCHIPTPGIDGAALAAFFGARQGTLFGLFDMFSGGALSQ 69

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           M+V +LGIMPYISASII++L+   VP LE LKKEGEQGRK I QYTRY TV+L ++Q +G
Sbjct: 70  MSVMALGIMPYISASIILELMTVVVPYLEKLKKEGEQGRKKITQYTRYGTVILSVIQGFG 129

Query: 139 IAVGLKNGQGIVSDSD-----YFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIF 193
           IAVGL+N              + F   T+ITL  GT FL+WLGEQIT RGIGNG+SLIIF
Sbjct: 130 IAVGLENMSSPGGVMVVPVGGWGFRILTVITLTAGTSFLMWLGEQITERGIGNGISLIIF 189

Query: 194 SGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQ 253
           SGIVA  P ++++   L   G ++   M LI +  + V+ +++F ER QRR+ +QY KR 
Sbjct: 190 SGIVARFPVAVMNSFRLMGTGELTPFFMALIVALMIVVVGIIVFVERGQRRIPVQYAKRV 249

Query: 254 VGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGH 313
           VG +M+    ++LPLK+NTAGV+P IFASS+++ PATI  F+ V   P W+  +V++L  
Sbjct: 250 VGRKMYGGQTTHLPLKINTAGVIPPIFASSIIMFPATIANFLSVEEYP-WLQHIVNALAP 308

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G   Y ++Y  FI FF +FYTA+ FNP + ADN+K+ GGFIPGIRPG  TA +ID VLTR
Sbjct: 309 GHIVYTLIYVTFIFFFCYFYTAVHFNPVDVADNMKRSGGFIPGIRPGKNTAEYIDRVLTR 368

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV 433
           +T  GA Y+  +C+ P  LI    VP    GT+LLI+V V +DT  QI+ +++ + YEG 
Sbjct: 369 LTFSGAIYVSAICVLPNILIYHLNVPFYFGGTALLIVVGVAMDTTNQIESHMLTRHYEGF 428

Query: 434 FKKSRSKKK 442
            KK   K +
Sbjct: 429 MKKGFGKSR 437


>gi|167855330|ref|ZP_02478098.1| preprotein translocase subunit SecY [Haemophilus parasuis 29755]
 gi|219871576|ref|YP_002475951.1| preprotein translocase subunit SecY [Haemophilus parasuis SH0165]
 gi|167853588|gb|EDS24834.1| preprotein translocase subunit SecY [Haemophilus parasuis 29755]
 gi|219691780|gb|ACL33003.1| preprotein translocase subunit SecY [Haemophilus parasuis SH0165]
          Length = 440

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/420 (49%), Positives = 296/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIV+R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIVFRIGSFIPVPGIDASVLSELVRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P+L  LKKEGE GR+ I++YTRYAT+LL  +Q+ GI++
Sbjct: 77  FALGIMPYISASIIIQLLTAVHPALAELKKEGEAGRRKISKYTRYATLLLAFIQSIGISL 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N   G+V + +  F  +++I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMLAGLVPNPNMLFYVTSVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS +   +E  R G IS  ++LLI     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PSVIGQTIEQSRQGEISLLVLLLIAVVAFAVTYFVVFVERGQRRIVVNYASRQQGRMMAP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P+IFASS++L PATI  +   S    W+  L   L  G+  Y+V
Sbjct: 257 ARQSHLPLKVNMAGVIPAIFASSIILFPATIAQWFGTSEGFEWLFDLSQLLQPGQPLYIV 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L+++ ++FFAFFYT + +NP++ ADNLKK G F+PG RPG++T+ +ID V+TR+T++GA 
Sbjct: 317 LFTMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVPGYRPGEQTSRYIDKVMTRLTLIGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + ++  V   L GTSLLI+V V++D I Q+Q +L++ QY+ V KK+  K
Sbjct: 377 YITFVCLVPYIITSLWKVSFQLGGTSLLIVVVVIMDFIAQVQSHLMSLQYDSVLKKANLK 436


>gi|325135168|gb|EGC57794.1| preprotein translocase, SecY subunit [Neisseria meningitidis
           M13399]
          Length = 436

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/423 (48%), Positives = 295/423 (69%), Gaps = 2/423 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++E
Sbjct: 11  SKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLE 70

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ 
Sbjct: 71  RFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSL 130

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           G+A  +   QGIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI 
Sbjct: 131 GVASFVFQ-QGIVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIA 189

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           +G+PS +  ++ L   GS+S    L I    + +I LV++FE AQR++ I Y KRQ   R
Sbjct: 190 SGIPSGIAKLVTLTNQGSMSMLTALFIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGR 249

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSF 317
               + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  
Sbjct: 250 AGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLL 308

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           YM L++  ++FF +FYTA+VF+ KE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ 
Sbjct: 309 YMALFAATVIFFCYFYTALVFSSKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLF 368

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S
Sbjct: 369 GALYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRS 428

Query: 438 RSK 440
             K
Sbjct: 429 EMK 431


>gi|329122804|ref|ZP_08251376.1| preprotein translocase subunit SecY [Haemophilus aegyptius ATCC
           11116]
 gi|327472068|gb|EGF17506.1| preprotein translocase subunit SecY [Haemophilus aegyptius ATCC
           11116]
          Length = 441

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/420 (47%), Positives = 295/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIVYR G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVYRIGSFIPVPGIDAAVLAQLVEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI++QL+A   P+L  LKKEG  G++ I++YTRYATV+   +QA  I+ 
Sbjct: 78  LALGIMPYISASIVIQLLATVSPALAELKKEGAAGQRKISKYTRYATVVFATIQAVAIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+++++L+ GTMFL+WLGEQIT RGIGNG+S+++F GIVAGL
Sbjct: 138 GLPNMLSGLVPNVGFSFYFTSVVSLVTGTMFLMWLGEQITERGIGNGISILVFGGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS+++  +E  R G +   ++LLI +   AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PSAILQTIEQARQGQMHPLVLLLIAAIVFAVTYFVVFVERGQRRIRVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N A V+P+IFASS++L PAT+  +   +    W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMANVMPAIFASSIILFPATLTQWFGQNDKFEWLNNLSMLLNPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID V+TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQ+Q +LI+ QYE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTSAWDVKFYFGGTSLLIVVVVIMDFIVQVQSHLISSQYESALKKANLK 437


>gi|206580313|ref|YP_002236300.1| preprotein translocase, SecY subunit [Klebsiella pneumoniae 342]
 gi|288933286|ref|YP_003437345.1| preprotein translocase subunit Y [Klebsiella variicola At-22]
 gi|290512089|ref|ZP_06551457.1| preprotein translocase, SecY subunit [Klebsiella sp. 1_1_55]
 gi|206569371|gb|ACI11147.1| preprotein translocase, SecY subunit [Klebsiella pneumoniae 342]
 gi|288888015|gb|ADC56333.1| preprotein translocase, SecY subunit [Klebsiella variicola At-22]
 gi|289775879|gb|EFD83879.1| preprotein translocase, SecY subunit [Klebsiella sp. 1_1_55]
          Length = 443

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/422 (49%), Positives = 293/422 (69%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + ALIV+R G++IP+P ID    +K  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKRRLLFVVGALIVFRIGSFIPIPGIDAAVLAKLLEQQRGTIIEMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASIIVQL+      L  LKKEGE GR+ I+QYTRY T++L I Q+ GIA 
Sbjct: 78  FALGIMPYISASIIVQLLTVVYQPLAELKKEGESGRRKISQYTRYGTLVLAIFQSIGIAT 137

Query: 142 GLKNG---QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           GL N    QG+V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF+GIVA
Sbjct: 138 GLPNMPGMQGLVINPGFAFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISILIFAGIVA 197

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
           GLP ++   +E  R G +   L+LL+     AV   V+F ER QRR+++ Y KRQ G R+
Sbjct: 198 GLPPAIAHTIEQARQGDLHFLLLLLVAVLVFAVTFFVVFVERGQRRIVVNYAKRQQGRRV 257

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFY 318
           +    ++LPLK+N AGV+P+IFASS++L PATI  +    +   W+  +   L  G+  Y
Sbjct: 258 YAAQSTHLPLKVNMAGVIPAIFASSIILFPATITSWFGGGTGWNWLTTISLYLQPGQPLY 317

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  I+FF FFYTA+VFNP+E ADNLKK G F+PGIRPG++TA +ID V+TR+T+VG
Sbjct: 318 VLLYASAIIFFCFFYTALVFNPRETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVG 377

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE +     VP    GTSLLI+V V++D + Q+Q  +++ QYE   KK+ 
Sbjct: 378 ALYITFICLIPEFMRDAMKVPFYFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKAN 437

Query: 439 SK 440
            K
Sbjct: 438 LK 439


>gi|238025952|ref|YP_002910183.1| preprotein translocase subunit SecY [Burkholderia glumae BGR1]
 gi|237875146|gb|ACR27479.1| Preprotein translocase SecY [Burkholderia glumae BGR1]
          Length = 448

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 224/432 (51%), Positives = 306/432 (70%), Gaps = 4/432 (0%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           S ++  DL+ R +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA
Sbjct: 13  STAKFGDLRRRAMFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGA 72

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           + R  +F+LGIMPYISASII+QL+A   P LE LKKEG+ G++ I QYTR  TV+L   Q
Sbjct: 73  LSRFTIFALGIMPYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRIFTVVLATFQ 132

Query: 136 AYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           A+GIA  L+N  G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF G
Sbjct: 133 AFGIAAALENQPGLVIDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGG 192

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           I AG P+++  + EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVG
Sbjct: 193 IAAGFPNAVGGLFELVRTGSMSIISAIIIVVLIGAVTYLVVFIERGQRKILVNYAKRQVG 252

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV----GLVDSL 311
           N+++    S+LPLKLN +GV+P IFASS++L PATI+ +       +W+      + ++L
Sbjct: 253 NKVYGGQSSHLPLKLNMSGVIPPIFASSIILFPATILSWFSSGDRKSWLSDTLHNVAEAL 312

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y++LY++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +L
Sbjct: 313 KPGQPVYVLLYTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRIL 372

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           TR+T+ GA Y+V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE
Sbjct: 373 TRLTLAGAIYIVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYE 432

Query: 432 GVFKKSRSKKKN 443
            + KK+  K  N
Sbjct: 433 SLLKKANFKGSN 444


>gi|33152934|ref|NP_874287.1| preprotein translocase subunit SecY [Haemophilus ducreyi 35000HP]
 gi|33149159|gb|AAP96676.1| preprotein translocase SecY subunit [Haemophilus ducreyi 35000HP]
          Length = 439

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 296/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALI++R G++IP+P ID    S+  + +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGALIIFRIGSFIPVPGIDASVLSELIRQQQGTIIDMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+ A  P L  LKKEGE GR+ I++YTRYAT+LL  +Q+ GI++
Sbjct: 77  FALGIMPYISASIIIQLLTAIHPPLAELKKEGEAGRRKISKYTRYATLLLAFIQSIGISI 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L N  QG+V +    F  +++I+L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVA L
Sbjct: 137 ALPNMLQGLVPNPSILFYITSVISLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVADL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P+++   +E  R G IS  ++LL+     AV   V+F ER QRR+++ Y  RQ G  M  
Sbjct: 197 PATIGQTIEQARQGEISLLVLLLVALIAFAVTYFVVFIERGQRRIVVNYASRQQGRIMTP 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              S+LPLK+N AGV+P+IFASS++L PA+I  +   S    W+  L   L  G+  Y+V
Sbjct: 257 ARASHLPLKVNMAGVIPAIFASSIILFPASITQWFGQSEGLEWLFDLSQLLQPGQPLYVV 316

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           L+S+ ++FFAFFYT + +NP++ ADNLKK G F+ G RPG++T+ +ID V+TR+T++GA 
Sbjct: 317 LFSMAVIFFAFFYTGMQYNPRDTADNLKKSGAFVLGYRPGEQTSRYIDKVMTRLTLIGAL 376

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + ++  VP  L GTSLLI+V V++D I Q+Q +L++ QY+ V KK+  K
Sbjct: 377 YITFVCLVPYIITSLWKVPFQLGGTSLLIVVVVIMDFIAQVQSHLMSLQYDSVLKKANLK 436


>gi|68249394|ref|YP_248506.1| preprotein translocase subunit SecY [Haemophilus influenzae
           86-028NP]
 gi|68057593|gb|AAX87846.1| preprotein translocase SecY subunit [Haemophilus influenzae
           86-028NP]
          Length = 441

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 295/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIVYR G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVYRIGSFIPVPGIDATVLAQLVEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI++QL+A   P+L  LKKEG  G++ I++YTRYATV+   +QA  I+ 
Sbjct: 78  LALGIMPYISASIVIQLLATVSPALAELKKEGAAGQRKISKYTRYATVVFATIQAVAIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+++++L+ GTMFL+WLGEQIT RGIGNG+S+++F GIVAGL
Sbjct: 138 GLPNMLSGLVPNVGFSFYFTSVVSLVTGTMFLMWLGEQITERGIGNGISILVFGGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS+++  +E  R G +   ++LLI +   AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PSAILQTIEQARQGQMHPLVLLLIAAIVFAVTYFVVFVERGQRRIRVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N A V+P+IFASS++L PAT+  +   +    W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMANVMPAIFASSIILFPATLTQWFGQNDKFEWLNNLSMLLNPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID V+TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQ+Q +L++ QYE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTSAWDVKFYFGGTSLLIVVVVIMDFIVQVQSHLMSSQYESALKKANLK 437


>gi|51244997|ref|YP_064881.1| preprotein translocase subunit SecY [Desulfotalea psychrophila
           LSv54]
 gi|50876034|emb|CAG35874.1| probable preprotein translocase, SecY subunit [Desulfotalea
           psychrophila LSv54]
          Length = 434

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/427 (48%), Positives = 291/427 (68%), Gaps = 9/427 (2%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+ RI+FT++ L VYR G  IP P I+  + +  F   ++ +FG+FNMFSGGA+E  ++
Sbjct: 12  ELRKRIIFTLMMLAVYRMGVQIPTPGINGEALAGFFAQNASTLFGMFNMFSGGALENFSI 71

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE LKKEGE G++ I QYTRY TVLL ++Q   IA 
Sbjct: 72  FALGIMPYISASIIIQLLTVVIPKLEALKKEGEAGQRKITQYTRYGTVLLSVIQGSFIAK 131

Query: 142 GLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGI 196
           GL +     G+ IV +    F   T++TL  GT F++WLGEQ+T RGIGNG+SLIIF+GI
Sbjct: 132 GLGSMVGPGGEAIVLNPGLHFTLMTMLTLTAGTAFIMWLGEQMTERGIGNGISLIIFAGI 191

Query: 197 VAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGN 256
           VA  P+++ + ++L + G I+   + ++     A++A+++FFE +QR++ IQY KR VG 
Sbjct: 192 VARGPAAIANSIQLIQAGEIALFFVPVLLIFMFAIVAVIVFFETSQRKIPIQYAKRVVGR 251

Query: 257 RMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRS 316
           +++    S+LPLK+N AGV+P IFASS+++ PATI  FI +     W+  +  ++  G  
Sbjct: 252 KVYGGQSSHLPLKINVAGVIPPIFASSIMMFPATIGSFIQID----WVQRVSAAMSPGTV 307

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
           FY + Y   IVFF FFY A+ F P + A+NLKK+GGFIPGIRPG RTAL ID VLTR+TV
Sbjct: 308 FYYICYVAMIVFFCFFYAAVTFKPDDVAENLKKNGGFIPGIRPGKRTALFIDKVLTRLTV 367

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
           VGA YL  VC+ P  LI+   +P    GT+LLI+V V +DTI Q++ +L  + YEG  K+
Sbjct: 368 VGAVYLSVVCVLPTILISQFNIPFFFGGTALLIVVGVSIDTISQVESHLHMRNYEGFMKQ 427

Query: 437 SRSKKKN 443
            R + + 
Sbjct: 428 GRIRGRK 434


>gi|16272739|ref|NP_438957.1| preprotein translocase subunit SecY [Haemophilus influenzae Rd
           KW20]
 gi|145630544|ref|ZP_01786324.1| preprotein translocase subunit SecY [Haemophilus influenzae R3021]
 gi|145632156|ref|ZP_01787891.1| preprotein translocase subunit SecY [Haemophilus influenzae 3655]
 gi|145634791|ref|ZP_01790499.1| preprotein translocase subunit SecY [Haemophilus influenzae PittAA]
 gi|145638401|ref|ZP_01794011.1| preprotein translocase subunit SecY [Haemophilus influenzae PittII]
 gi|148826558|ref|YP_001291311.1| preprotein translocase subunit SecY [Haemophilus influenzae PittEE]
 gi|148827987|ref|YP_001292740.1| preprotein translocase subunit SecY [Haemophilus influenzae PittGG]
 gi|229845848|ref|ZP_04465960.1| preprotein translocase subunit SecY [Haemophilus influenzae 7P49H1]
 gi|260579889|ref|ZP_05847719.1| preprotein translocase, SecY subunit [Haemophilus influenzae RdAW]
 gi|260581615|ref|ZP_05849412.1| preprotein translocase, SecY subunit [Haemophilus influenzae NT127]
 gi|319775268|ref|YP_004137756.1| preprotein translocase SecY subunit [Haemophilus influenzae F3047]
 gi|319897708|ref|YP_004135905.1| preprotein translocase secy subunit [Haemophilus influenzae F3031]
 gi|1173419|sp|P43804|SECY_HAEIN RecName: Full=Preprotein translocase subunit secY
 gi|1573808|gb|AAC22456.1| preprotein translocase SecY subunit (secY) [Haemophilus influenzae
           Rd KW20]
 gi|144983934|gb|EDJ91376.1| preprotein translocase subunit SecY [Haemophilus influenzae R3021]
 gi|144987063|gb|EDJ93593.1| preprotein translocase subunit SecY [Haemophilus influenzae 3655]
 gi|145267957|gb|EDK07953.1| preprotein translocase subunit SecY [Haemophilus influenzae PittAA]
 gi|145272730|gb|EDK12637.1| preprotein translocase subunit SecY [Haemophilus influenzae PittII]
 gi|148716718|gb|ABQ98928.1| preprotein translocase subunit SecY [Haemophilus influenzae PittEE]
 gi|148719229|gb|ABR00357.1| preprotein translocase subunit SecY [Haemophilus influenzae PittGG]
 gi|229810852|gb|EEP46569.1| preprotein translocase subunit SecY [Haemophilus influenzae 7P49H1]
 gi|260093173|gb|EEW77106.1| preprotein translocase, SecY subunit [Haemophilus influenzae RdAW]
 gi|260095208|gb|EEW79099.1| preprotein translocase, SecY subunit [Haemophilus influenzae NT127]
 gi|301169516|emb|CBW29117.1| preprotein translocase membrane subunit [Haemophilus influenzae
           10810]
 gi|309751541|gb|ADO81525.1| Protein translocase subunit SecY [Haemophilus influenzae R2866]
 gi|309973711|gb|ADO96912.1| Protein translocase subunit SecY [Haemophilus influenzae R2846]
 gi|317433214|emb|CBY81589.1| preprotein translocase SecY subunit [Haemophilus influenzae F3031]
 gi|317449859|emb|CBY86070.1| preprotein translocase SecY subunit [Haemophilus influenzae F3047]
          Length = 441

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 295/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIVYR G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVYRIGSFIPVPGIDAAVLAQLVEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI++QL+A   P+L  LKKEG  G++ I++YTRYATV+   +QA  I+ 
Sbjct: 78  LALGIMPYISASIVIQLLATVSPALAELKKEGAAGQRKISKYTRYATVVFATIQAVAIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+++++L+ GTMFL+WLGEQIT RGIGNG+S+++F GIVAGL
Sbjct: 138 GLPNMLSGLVPNVGFSFYFTSVVSLVTGTMFLMWLGEQITERGIGNGISILVFGGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS+++  +E  R G +   ++LLI +   AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PSAILQTIEQARQGQMHPLVLLLIAAIVFAVTYFVVFVERGQRRIRVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N A V+P+IFASS++L PAT+  +   +    W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMANVMPAIFASSIILFPATLTQWFGQNDKFEWLNNLSMLLNPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID V+TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQ+Q +L++ QYE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTSAWDVKFYFGGTSLLIVVVVIMDFIVQVQSHLMSSQYESALKKANLK 437


>gi|145636644|ref|ZP_01792311.1| preprotein translocase subunit SecY [Haemophilus influenzae PittHH]
 gi|145270170|gb|EDK10106.1| preprotein translocase subunit SecY [Haemophilus influenzae PittHH]
          Length = 436

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/418 (47%), Positives = 295/418 (70%), Gaps = 1/418 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIVYR G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVYRIGSFIPVPGIDAAVLAQLVEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI++QL+A   P+L  LKKEG  G++ I++YTRYATV+   +QA  I+ 
Sbjct: 78  LALGIMPYISASIVIQLLATVSPALAELKKEGAAGQRKISKYTRYATVVFATIQAVAIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+++++L+ GTMFL+WLGEQIT RGIGNG+S+++F GIVAGL
Sbjct: 138 GLPNMLSGLVPNVGFSFYFTSVVSLVTGTMFLMWLGEQITERGIGNGISILVFGGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS+++  +E  R G +   ++LLI +   AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PSAILQTIEQARQGQMHPLVLLLIAAIVFAVTYFVVFVERGQRRIRVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N A V+P+IFASS++L PAT+  +   +    W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMANVMPAIFASSIILFPATLTQWFGQNDKFEWLNNLSMLLNPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID V+TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQ+Q +L++ QYE   +KS+
Sbjct: 378 YVTFVCLVPYIMTSAWDVKFYFGGTSLLIVVVVIMDFIVQVQSHLMSSQYESALEKSK 435


>gi|77361714|ref|YP_341289.1| preprotein translocase, membrane component, transport across inner
           membrane (general secretory pathway) [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76876625|emb|CAI87847.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 442

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/422 (47%), Positives = 289/422 (68%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + A+I+YR G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER +V
Sbjct: 17  ELKRRLLFVLGAIIIYRLGSFVPIPGIDAAVLADFFEQQKGTIVEMFNMFSGGALERASV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII QL+    P    LKKEGEQGRK I+QYTRY T++L  +Q+ GIA 
Sbjct: 77  LALGIMPYISASIITQLLTHMYPPFIELKKEGEQGRKKISQYTRYGTLVLATIQSIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L    +G+V +    F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF GIVA L
Sbjct: 137 SLPGMMEGLVVNPGMGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISVLIFVGIVANL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++ S  E+ R G ++  ++L++     AV  LV+FFER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGSTAEMARQGDLNVFVLLMVAVIVFAVTYLVVFFERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV--GLVDSLGHGRSFY 318
              ++LPLK+N AGV+P IFASS++L P TI  +      P   V   +  +L  G+  Y
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIASWFGQGEGPVADVLQAIATTLTPGQPLY 316

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
            ++ +  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ G
Sbjct: 317 AMVLAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSKYIDKVMTRLTLAG 376

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE +      P    GTS+LIIV V++D + Q+Q +L++ QY+ V KK+ 
Sbjct: 377 ALYITFICLVPEFMTMAWQTPFYFGGTSILIIVVVIMDFMAQVQTHLMSHQYDSVLKKAN 436

Query: 439 SK 440
            K
Sbjct: 437 LK 438


>gi|251772510|gb|EES53076.1| preprotein translocase, SecY subunit [Leptospirillum
           ferrodiazotrophum]
          Length = 437

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/433 (47%), Positives = 292/433 (67%), Gaps = 8/433 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
            F +  +  +L+ R++FT+  L VYR G YIP P ++    SK        + G F+MFS
Sbjct: 8   TFENIWKIPELRQRVIFTLAMLAVYRIGAYIPTPGVNGTELSKFLHQNGGALIGFFDMFS 67

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R  +F+LGIMPYISASII+QL+    P+L+ L KEGE+GRK+I +YTRY TVL+ 
Sbjct: 68  GGALSRFTIFALGIMPYISASIILQLLTVVHPALQALSKEGERGRKIITKYTRYLTVLIA 127

Query: 133 ILQAYGIAVGLK---NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           ++Q++GIA+GL+   NGQ  V+   + F    +ITL   T F++W+GEQIT RG+GNG+S
Sbjct: 128 MIQSFGIALGLEKMNNGQ-FVAHPGWGFRLMVVITLTAATTFVMWIGEQITERGVGNGIS 186

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIFSGIVA +PS++ S  +L +   IS  ++L +    ++VIA ++F E A+R++ ++Y
Sbjct: 187 LIIFSGIVARMPSAIFSTYKLFQEQEISGFVLLAVIVMVISVIAAIVFIETARRKIPVEY 246

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KR V NR+     +++P K+NTAGV+P IFASSL+  PATI GFI V     W+  +  
Sbjct: 247 AKRLVSNRLVAGQSTHIPFKINTAGVIPPIFASSLISFPATIAGFIAVP----WVQSIGK 302

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
           SL  G   Y VLY + I+FF+FFYTA+V NP + A+N++K+GGFIPGIRPG  TA  I  
Sbjct: 303 SLAPGSFSYTVLYVLLILFFSFFYTAVVMNPADIAENIQKYGGFIPGIRPGKNTATFIYN 362

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           V+ R+T+VGA YL  VC+ PE LI    VP    GTSLLI++ V LDT  QI+ Y++++ 
Sbjct: 363 VMNRITLVGAIYLALVCVIPEILINQLHVPFYFGGTSLLIVIGVSLDTSQQIEAYMMSRN 422

Query: 430 YEGVFKKSRSKKK 442
           Y+G  KKSR + +
Sbjct: 423 YDGFLKKSRIRGR 435


>gi|254246581|ref|ZP_04939902.1| SecY protein [Burkholderia cenocepacia PC184]
 gi|77965689|gb|ABB07069.1| protein translocase subunit secY/sec61 alpha [Burkholderia sp. 383]
 gi|124871357|gb|EAY63073.1| SecY protein [Burkholderia cenocepacia PC184]
          Length = 425

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 225/422 (53%), Positives = 304/422 (72%), Gaps = 7/422 (1%)

Query: 28  VFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIM 87
           +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA+ R  +F+LGIM
Sbjct: 1   MFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIM 60

Query: 88  PYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQ 147
           PYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   QA+GIA  L+N  
Sbjct: 61  PYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQAFGIAAALENQP 120

Query: 148 GIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSV 207
           G+V+D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AG P+++  +
Sbjct: 121 GLVTDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVGGL 180

Query: 208 LELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLP 267
            EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVGN+++    S+LP
Sbjct: 181 FELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLP 240

Query: 268 LKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIV----GLVDSLGHGRSFYMVL 321
           LKLN +GV+P IFASS++L PATI+G+   +  PT  WI      + ++L  G+  Y++L
Sbjct: 241 LKLNMSGVIPPIFASSIILFPATILGWFS-TGQPTGSWISNTLHNVAEALKPGQPVYVLL 299

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +LTR+T+ GA Y
Sbjct: 300 YTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRILTRLTLAGAIY 359

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K 
Sbjct: 360 IVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKG 419

Query: 442 KN 443
            N
Sbjct: 420 GN 421


>gi|302344336|ref|YP_003808865.1| preprotein translocase, SecY subunit [Desulfarculus baarsii DSM
           2075]
 gi|301640949|gb|ADK86271.1| preprotein translocase, SecY subunit [Desulfarculus baarsii DSM
           2075]
          Length = 435

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/433 (48%), Positives = 294/433 (67%), Gaps = 9/433 (2%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
            +  +  +L+ R++F+++ L VYR G  IP P ID  + S  FQ+    + GL NMFSGG
Sbjct: 7   GNIGKIPELRKRVLFSLMMLAVYRIGCAIPTPGIDGAALSAFFQNTDIPLLGLVNMFSGG 66

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           A+ERM++F+LGIMPYISASII+ L+   VP L  LKKEG++GRK I QY RY TVLL ++
Sbjct: 67  ALERMSIFALGIMPYISASIILDLLTVVVPRLAELKKEGQEGRKKITQYARYGTVLLSLV 126

Query: 135 QAYGIAVGLK-----NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           Q  GIA+GL+     NG  +V ++ + F   T+ITL  GT F++WLGEQIT RGIGNG+S
Sbjct: 127 QGMGIAIGLESMTAPNGALVVPEAGWGFRLMTMITLTSGTAFIMWLGEQITERGIGNGIS 186

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF+GIVA LP+++ +   + RVG +S  ++L++    VAV+A + F E+ QRR+ +QY
Sbjct: 187 LIIFAGIVASLPAAIFNTFRMVRVGEVSVFMLLVLVLVMVAVVAAICFVEQGQRRIPVQY 246

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KR VG R++    ++LPLK+NTAGV+P IFASS+++ PATI  F++V     +   +  
Sbjct: 247 AKRVVGRRVYGGQTTHLPLKINTAGVIPPIFASSIIMFPATIAQFVNVPIVQQFAAAMTP 306

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
                   Y +LY   IVFF +FYTA+ FNP + ADN+KK+GGFIPGIRPG RTA +ID 
Sbjct: 307 D----GWMYNILYVGMIVFFCYFYTAVTFNPTDVADNMKKYGGFIPGIRPGKRTADYIDR 362

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           VLTR+T+ GA Y+  VC+ P  LI    VP    GT+LLI+V V LDT+ QI+ +L+++ 
Sbjct: 363 VLTRLTLGGAAYISAVCVLPTLLITQFNVPFYFGGTALLIVVGVSLDTMSQIESHLMSRH 422

Query: 430 YEGVFKKSRSKKK 442
           YE + KK   K +
Sbjct: 423 YESLMKKGVIKGR 435


>gi|319796385|ref|YP_004158025.1| preprotein translocase, secy subunit [Variovorax paradoxus EPS]
 gi|315598848|gb|ADU39914.1| preprotein translocase, SecY subunit [Variovorax paradoxus EPS]
          Length = 437

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/405 (50%), Positives = 281/405 (69%), Gaps = 1/405 (0%)

Query: 37  YRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIV 96
           YR G +IP+P I+    +  FQ +  GI  LFNMFSGGA+ R  VF+LGIMPYISASII+
Sbjct: 31  YRIGAHIPVPGINPDQLAALFQGQQGGILSLFNMFSGGALSRFTVFALGIMPYISASIIM 90

Query: 97  QLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYF 156
           QL+   +P+ E LKKEGE GR+ I QYTRY  + L + Q++ IAV L++  G+V    + 
Sbjct: 91  QLMTYVLPTFEQLKKEGEAGRRKITQYTRYGALGLALFQSFSIAVALESSAGLVIAPGFG 150

Query: 157 FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSI 216
           F  + +++L  G+MFL+WLGEQIT RG+GNG+S++IF+GI AGLPS++  +  L   G++
Sbjct: 151 FRLTAMVSLTAGSMFLMWLGEQITERGLGNGISILIFAGIAAGLPSAVAGLGSLVTTGAM 210

Query: 217 STPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVV 276
           +  + L I +  V V   V+F ER QR++L+ Y +RQVGN+++    S+LPLKLN AGV+
Sbjct: 211 NPIVALFIIAVVVLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVI 270

Query: 277 PSIFASSLLLLPATIMGFIDVSSSP-TWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTA 335
           P IFASS++LLPAT++G+         WI  + ++L  G   Y++LY+  IVFF FFYTA
Sbjct: 271 PPIFASSIILLPATVVGWFSTGEGGFRWIKDIANALRPGEPIYVLLYAAAIVFFCFFYTA 330

Query: 336 IVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAV 395
           +VFN KE ADNLKK G FIPGIRPGD+TA +ID +L R+T+ GA Y+  VC+ PE LI  
Sbjct: 331 LVFNSKETADNLKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVYITFVCLLPEFLILK 390

Query: 396 TGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
             VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K
Sbjct: 391 YNVPFYFGGTSLLIIVVVTMDFMAQVQNYMMSQQYESLLKKANFK 435


>gi|269469222|gb|EEZ80753.1| preprotein translocase subunit SecY [uncultured SUP05 cluster
           bacterium]
          Length = 432

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/422 (49%), Positives = 291/422 (68%), Gaps = 4/422 (0%)

Query: 20  AKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERM 79
           ++DL  RI+F + ALIV+R GT+I +P I   + +   Q +   I  +FNMFSGGA+ER+
Sbjct: 8   SEDLSKRILFLLGALIVFRLGTHITIPFISSAALASLVQDQQGTILDMFNMFSGGALERL 67

Query: 80  AVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGI 139
           ++F+LGIMPYISASII+ L+ + VP LE LKKEGE G++ I QYTR  TV+L + Q+YGI
Sbjct: 68  SIFTLGIMPYISASIIITLMTSVVPKLEQLKKEGETGKRKITQYTRMGTVVLAVFQSYGI 127

Query: 140 AVGLKN----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSG 195
           ++ L++    G  +V+   + F   T++TL  GT+FL+WLGEQIT +GIGNG+S+IIF+G
Sbjct: 128 SIALQSQSAGGVALVTQGGFTFSLVTVVTLTTGTLFLMWLGEQITEKGIGNGISMIIFAG 187

Query: 196 IVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVG 255
           IV+GLPS+L S L L   G ++  L+ ++   T+ V A V+F ER QRR+ + Y KRQ G
Sbjct: 188 IVSGLPSALGSTLSLVSTGELTVILVAILLIMTLLVTAFVVFMERGQRRITVNYAKRQQG 247

Query: 256 NRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGR 315
            +M     SYLPLK+N AGV+P IFASS++L PAT+ G+   S    W+  +  S+  G+
Sbjct: 248 RKMVGGQSSYLPLKINMAGVIPPIFASSIILFPATLGGWFSQSEGMGWLADITASISPGQ 307

Query: 316 SFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVT 375
             Y++ Y + IVFF FFYTA+ F+ K+ ADNL+K GGFIPGIRPG  +A +ID V++R+T
Sbjct: 308 PLYVMFYGLAIVFFTFFYTALTFDSKDTADNLRKSGGFIPGIRPGQHSANYIDSVVSRLT 367

Query: 376 VVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFK 435
             GA Y+  VC+ PE LI    VP    GTSLLIIV VV+D I Q Q +L++ QYE + K
Sbjct: 368 ASGAVYITAVCLLPEFLILYWNVPFYFGGTSLLIIVVVVMDFIAQAQSHLMSNQYESLMK 427

Query: 436 KS 437
           K+
Sbjct: 428 KA 429


>gi|117621057|ref|YP_854863.1| preprotein translocase subunit SecY [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562464|gb|ABK39412.1| preprotein translocase, SecY subunit [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 442

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/424 (49%), Positives = 292/424 (68%), Gaps = 7/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A+IV+R G+Y+P+P ID    ++ FQ +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGAIIVFRAGSYVPIPGIDAAVLAELFQQQKGTIIEMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+    P+L  LKKEGE GR+ I+QYTR+ T++LG  QA GIA 
Sbjct: 77  LALGIMPYISASIIIQLLTVVHPALAELKKEGESGRRKISQYTRWGTLVLGTFQAIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N  QG+V+     F F+ +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 137 GLPNMMQGLVTHPGLGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++ +  E  R G +   L+LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PHAIGATAEQARQGELHILLLLLLGLIVFAVTYFVVFVERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS----LGHGRS 316
              ++LPLK+N AGV+P+IFASS++L P TI  +         I  ++      L  G+ 
Sbjct: 257 AQSTHLPLKVNMAGVIPAIFASSIILFPGTITSWFGQGEGK--IADILQQVSMVLQPGQP 314

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y +LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++TA +ID V+TR+T+
Sbjct: 315 LYEMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTARYIDKVMTRLTL 374

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ P+ L+    V     GTSLLIIV V++D + Q+Q ++++ QY  V +K
Sbjct: 375 AGALYITFICLVPQFLMTAWNVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYGDVLRK 434

Query: 437 SRSK 440
           +  K
Sbjct: 435 ANLK 438


>gi|332037273|gb|EGI73728.1| preprotein translocase SecY subunit [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 442

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/422 (47%), Positives = 290/422 (68%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + A+I+YR G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER +V
Sbjct: 17  ELKRRLLFVLGAIIIYRLGSFVPIPGIDAAVLADFFEQQKGTIVEMFNMFSGGALERASV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII QL+    P    LKKEGEQGRK I+QYTRY T++L  +Q+ GIA 
Sbjct: 77  LALGIMPYISASIITQLLTHMYPPFIELKKEGEQGRKKISQYTRYGTLVLATIQSIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L    +G+V +    F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF GIVA L
Sbjct: 137 SLPGMMEGLVVNPGMGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISVLIFVGIVANL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++ S +E+ R G ++  ++L++     AV  LV+FFER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGSTVEMARQGDLNVFVLLMVAVIVFAVTYLVVFFERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV--GLVDSLGHGRSFY 318
              ++LPLK+N AGV+P IFASS++L P TI  +      P   V   +  +L  G+  Y
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIASWFGQGEGPVADVLQAVATTLTPGQPLY 316

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
            ++ +  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ G
Sbjct: 317 SLVLAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSKYIDKVMTRLTLAG 376

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE +      P    GTS+LIIV V++D + Q+Q +L++ QY+ V KK+ 
Sbjct: 377 ALYITFICLVPEFMTMAWQTPFYFGGTSVLIIVVVIMDFMAQVQTHLMSHQYDSVLKKAN 436

Query: 439 SK 440
            K
Sbjct: 437 LK 438


>gi|323700826|ref|ZP_08112738.1| preprotein translocase, SecY subunit [Desulfovibrio sp. ND132]
 gi|323460758|gb|EGB16623.1| preprotein translocase, SecY subunit [Desulfovibrio desulfuricans
           ND132]
          Length = 436

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 296/432 (68%), Gaps = 10/432 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           + +R  +L+ ++++T   L VYR G +IP+P +D  + S+ F      +FG+F+MFSGG 
Sbjct: 6   NIARLPELRKKLLWTFALLAVYRLGIHIPIPGVDSAALSEFFAQAQNTLFGVFDMFSGGG 65

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKE-GEQGRKVINQYTRYATVLLGIL 134
           ++RM++F+LGIMPYISASII+QL+    P L+ L+KE GE GRK I QYTRY TVL+ ++
Sbjct: 66  LKRMSIFALGIMPYISASIILQLLTVVSPELKRLQKEEGEAGRKKITQYTRYGTVLITVV 125

Query: 135 QAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           Q + IA GL++     G  +V  S   F   TI+TL  GT+FL+WLGEQ+T +GIGNG+S
Sbjct: 126 QGFAIATGLESMSSPTGAPMVLYSGISFKLMTILTLTAGTVFLMWLGEQMTEKGIGNGIS 185

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LII++GI+AGLP+++++ L+L  VG IS  ++L +  + VAV+A ++F ER QRR+ I Y
Sbjct: 186 LIIYAGIIAGLPAAVINTLQLMTVGEISLFILLFLIVAMVAVLAFIVFMERGQRRIPIHY 245

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KRQ G RMF    ++LPLK+NTAGV+P IFASS+L+ PAT+  F    S+  ++     
Sbjct: 246 AKRQQGRRMFGGQTTHLPLKINTAGVIPPIFASSILMFPATLAQF----SNNKYLQDFSS 301

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
                   Y +LY   I+FF +FYTAI+F+PK  A+N++K GGFIPGIRPG+RT  +ID 
Sbjct: 302 YFRPDSILYNILYIGIIIFFCYFYTAIMFDPKGIAENIQKQGGFIPGIRPGNRTREYIDK 361

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           VL R+T+ GA Y+  VC+ P  LI+  GVP    GTSLLI+V V +D + QI+ Y+I++Q
Sbjct: 362 VLARITLWGAFYVSAVCVLPMVLISKFGVPFYFGGTSLLIVVGVAMDFMGQIESYMISRQ 421

Query: 430 YEGVFKKSRSKK 441
           YEG+  K    K
Sbjct: 422 YEGLMGKGNKIK 433


>gi|315127936|ref|YP_004069939.1| preprotein translocase, membrane component, transport across inner
           membrane (general secretory pathway) [Pseudoalteromonas
           sp. SM9913]
 gi|315016450|gb|ADT69788.1| preprotein translocase, membrane component, transport across inner
           membrane (general secretory pathway) [Pseudoalteromonas
           sp. SM9913]
          Length = 442

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/422 (47%), Positives = 288/422 (68%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + A+I+YR G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER +V
Sbjct: 17  ELKRRLLFVLGAIIIYRLGSFVPIPGIDAAVLADFFEQQKGTIVEMFNMFSGGALERASV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII QL+    P    LKKEGEQGRK I+QYTRY T++L  +Q+ GIA 
Sbjct: 77  LALGIMPYISASIITQLLTHMYPPFIELKKEGEQGRKKISQYTRYGTLVLATIQSIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L     G+V +    F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF GIVA L
Sbjct: 137 SLPGMMNGLVVNPGMGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISVLIFVGIVANL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++ S  E+ R G ++  ++L++     AV  LV+FFER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGSTAEMARQGDLNVFVLLMVAVIVFAVTYLVVFFERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV--GLVDSLGHGRSFY 318
              ++LPLK+N AGV+P IFASS++L P TI  +      P   V   +  +L  G+  Y
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIASWFGQGEGPVADVLQAIATTLTPGQPLY 316

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
            ++ +  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ G
Sbjct: 317 AMVLAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSKYIDKVMTRLTLAG 376

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE +      P    GTS+LIIV V++D + Q+Q +L++ QY+ V KK+ 
Sbjct: 377 ALYITFICLVPEFMTMAWQTPFYFGGTSILIIVVVIMDFMAQVQTHLMSHQYDSVLKKAN 436

Query: 439 SK 440
            K
Sbjct: 437 LK 438


>gi|261378061|ref|ZP_05982634.1| preprotein translocase, SecY subunit [Neisseria cinerea ATCC 14685]
 gi|269145511|gb|EEZ71929.1| preprotein translocase, SecY subunit [Neisseria cinerea ATCC 14685]
          Length = 436

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/426 (47%), Positives = 296/426 (69%), Gaps = 2/426 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           ++ S   DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG
Sbjct: 8   SALSNFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGMLNMFSGG 67

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           ++ER ++F++GIMPYISASIIVQL +  +PSL+ LKKEGE GRK+I +YTRY TVLL IL
Sbjct: 68  SLERFSIFAIGIMPYISASIIVQLASEILPSLKALKKEGEAGRKLITKYTRYGTVLLAIL 127

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q+ G+A      QG+V  S + F  STI++L+ GTMFL+WLGEQIT RGIGNG+SLII +
Sbjct: 128 QSLGVA-SFVFQQGVVVTSSFEFHVSTIVSLVTGTMFLMWLGEQITERGIGNGISLIITA 186

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GI +G+PS +  ++ L   G++S  + L I    + +I LV++FE AQR++ I Y KRQ 
Sbjct: 187 GIASGIPSGITRIITLTNQGAMSMLMALFIAFGALLLIYLVVYFESAQRKIPIHYAKRQF 246

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
            N       +++P KLN AGV+P IFASS++L P+T++G++  + S   +  +   L HG
Sbjct: 247 -NSGLGGQNTHMPFKLNMAGVIPPIFASSIILFPSTLLGWLGSADSNNILHTIAGLLQHG 305

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y+VL++V ++FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+  +
Sbjct: 306 QILYIVLFAVTVIFFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLHL 365

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T+ GA Y+  +C+ PE L     VP  L GTSLLI+V V +D   QI  Y + QQY+ + 
Sbjct: 366 TLFGALYITIICLIPELLTTFLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLM 425

Query: 435 KKSRSK 440
            +S  K
Sbjct: 426 SRSDVK 431


>gi|145300915|ref|YP_001143756.1| preprotein translocase subunit SecY [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853687|gb|ABO92008.1| preprotein translocase subunit SecY [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 442

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/424 (48%), Positives = 292/424 (68%), Gaps = 7/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A+IV+R G+Y+P+P ID    ++ FQ +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGAIIVFRAGSYVPIPGIDAAVLAELFQQQKGTIIEMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+    P+L  LKKEGE GR+ I+QYTR+ T++LG  QA GIA 
Sbjct: 77  LALGIMPYISASIIIQLLTVVHPALAELKKEGESGRRKISQYTRWGTLVLGTFQAIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N  QG+V+     F F+ +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 137 GLPNMMQGLVTHPGLGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++ +  E  R G +   L+LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PHAIGATAEQARQGELHILLLLLLGLIVFAVTYFVVFVERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS----LGHGRS 316
              ++LPLK+N AGV+P+IFASS++L P TI  +         +  ++      L  G+ 
Sbjct: 257 AQSTHLPLKVNMAGVIPAIFASSIILFPGTITSWFGQGEGK--VADILQQVSMVLQPGQP 314

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y +LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++TA +ID V+TR+T+
Sbjct: 315 LYEMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTARYIDKVMTRLTL 374

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ P+ L+    V     GTSLLIIV V++D + Q+Q ++++ QY  V +K
Sbjct: 375 AGALYITFICLVPQFLMTAWNVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYGDVLRK 434

Query: 437 SRSK 440
           +  K
Sbjct: 435 ANLK 438


>gi|323144984|ref|ZP_08079544.1| preprotein translocase, SecY subunit [Succinatimonas hippei YIT
           12066]
 gi|322415263|gb|EFY06037.1| preprotein translocase, SecY subunit [Succinatimonas hippei YIT
           12066]
          Length = 448

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 296/423 (69%), Gaps = 3/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+SR++F +I L+++R G+Y+P+P ++    ++ F+ +S  I G+FNMFSGGA+ER +V
Sbjct: 23  ELRSRLLFVLIGLVMFRIGSYVPVPGVNAEVLARLFEEQSGTIIGMFNMFSGGALERASV 82

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+A   P+L  L+KEGE GR+ I QYTR +T+ L  LQA GIA 
Sbjct: 83  LALGIMPYISASIIIQLLAVINPTLAELRKEGESGRRKITQYTRVSTLFLAALQAVGIAT 142

Query: 142 GLKNGQ-GIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           G+ N   G+V +  + F F T ++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 143 GIPNMMPGLVDNPGFGFYFVTTVSLVTGTMFLMWLGEQITERGIGNGISLIIFAGIVAGL 202

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P +L +  E  R G +ST  +LLI    V V   V+F ER QRR++I Y KRQ+GNR++ 
Sbjct: 203 PRALAATFEQARQGDLSTIALLLIGVVVVVVTFFVVFIERGQRRIVIDYAKRQMGNRIYS 262

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS--LGHGRSFY 318
              S LPLK+N +GV+P+IFASS++L P T++ +     +    V    S  L  G+  Y
Sbjct: 263 QPRSTLPLKINMSGVIPAIFASSIILFPGTVVSWFGQGDNAVANVLQEVSLFLQPGQPLY 322

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
            +LY+  IVFF FFYTA+VF+P+E A+NLKK G FIPGIRPG++TA  ID V+TR+T+ G
Sbjct: 323 ELLYAAAIVFFTFFYTALVFSPREVAENLKKSGAFIPGIRPGEQTARFIDKVMTRLTLSG 382

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           + Y+V VC+ P+ L+    V     GTSLLIIV V++D + Q+Q +++ QQY  + +K+ 
Sbjct: 383 SIYMVLVCLVPQLLMNWFNVQFYFGGTSLLIIVVVIMDFVSQLQSHMMNQQYGDLMRKAN 442

Query: 439 SKK 441
            + 
Sbjct: 443 LRN 445


>gi|296313385|ref|ZP_06863326.1| preprotein translocase, SecY subunit [Neisseria polysaccharea ATCC
           43768]
 gi|296840095|gb|EFH24033.1| preprotein translocase, SecY subunit [Neisseria polysaccharea ATCC
           43768]
          Length = 436

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/426 (47%), Positives = 296/426 (69%), Gaps = 2/426 (0%)

Query: 15  ASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGG 74
           +  S+  DLK R++F   ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG
Sbjct: 8   SGLSKFGDLKKRLLFLFGALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGMLNMFSGG 67

Query: 75  AVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGIL 134
           ++ER ++F++GIMPYISASIIVQ  +  +PSL+ LKKEGE GRKVI +YTRY TVLL IL
Sbjct: 68  SLERFSIFAIGIMPYISASIIVQFASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAIL 127

Query: 135 QAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFS 194
           Q+ G+A  +   QG+V  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +
Sbjct: 128 QSLGVASFVFQ-QGVVVTSSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITA 186

Query: 195 GIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQV 254
           GI +G+PS +  ++ L   GS+S    LL+    + +I LV++FE AQR++ I Y KRQ 
Sbjct: 187 GIASGIPSGIAKLVTLTNQGSMSILTALLVVFGALLLIYLVVYFESAQRKIPIHYAKRQF 246

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHG 314
              +   + +++P KLN AGV+P IFASS++L P+T++G+   + + + +  +   L HG
Sbjct: 247 NGGVGSQN-THMPFKLNMAGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHG 305

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  YM L++  ++FF +FYTA+ F+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+
Sbjct: 306 QLLYMALFAATVIFFCYFYTALFFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRL 365

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T+ GA Y+  +C+ PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ + 
Sbjct: 366 TLFGALYITTICLIPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLM 425

Query: 435 KKSRSK 440
            +S  K
Sbjct: 426 TRSEMK 431


>gi|229844665|ref|ZP_04464804.1| preprotein translocase subunit SecY [Haemophilus influenzae 6P18H1]
 gi|229812379|gb|EEP48069.1| preprotein translocase subunit SecY [Haemophilus influenzae 6P18H1]
          Length = 441

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/420 (46%), Positives = 294/420 (70%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIVYR G++IP+P ID    ++  + +   I  +FNMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVYRIGSFIPVPGIDAAVLAQLVEQQKGTIIDMFNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI++QL+A   P+L  LKKEG  G++ I++YTRYATV+   +QA  I+ 
Sbjct: 78  LALGIMPYISASIVIQLLATVSPALAELKKEGAAGQRKISKYTRYATVVFATIQAVAIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V +  + F F+++++L+ GTMFL+WLGEQI  RGIGNG+S+++F GIVAGL
Sbjct: 138 GLPNMLSGLVPNVGFSFYFTSVVSLVTGTMFLMWLGEQIAERGIGNGISILVFGGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS+++  +E  R G +   ++LLI +   AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PSAILQTIEQARQGQMHPLVLLLIAAIVFAVTYFVVFVERGQRRIRVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N A V+P+IFASS++L PAT+  +   +    W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMANVMPAIFASSIILFPATLTQWFGQNDKFEWLNNLSMLLNPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID V+TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQ+Q +L++ QYE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTSAWDVKFYFGGTSLLIVVVVIMDFIVQVQSHLMSSQYESALKKANLK 437


>gi|119472059|ref|ZP_01614317.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Alteromonadales
           bacterium TW-7]
 gi|119445194|gb|EAW26486.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Alteromonadales
           bacterium TW-7]
          Length = 442

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/422 (47%), Positives = 289/422 (68%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + A+I+YR G+++P+P ID    +  F+ +   I  +FNMFSGGA+ER +V
Sbjct: 17  ELKRRLLFVLGAIIIYRLGSFVPIPGIDAAVLADFFEQQKGTIVEMFNMFSGGALERASV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII QL+    P    LKKEGEQGRK I+QYTRY T++L  +Q+ GIA 
Sbjct: 77  LALGIMPYISASIITQLLTHMYPPFIELKKEGEQGRKKISQYTRYGTLVLATIQSIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
            L     G+V +    F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF GIVA L
Sbjct: 137 SLPGMMNGLVVNPGMGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISVLIFVGIVANL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++ S +E+ R G ++  ++L++     AV  LV+FFER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGSTVEMARQGDLNVFVLLMVAVIVFAVTYLVVFFERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIVGLVDSLGHGRSFY 318
              ++LPLK+N AGV+P IFASS++L P TI  +      P    +  +  +L  G+  Y
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIASWFGQGEGPVADALQAVATTLTPGQPLY 316

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
            ++ +  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ G
Sbjct: 317 SLVLAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSKYIDKVMTRLTLAG 376

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  +C+ PE +      P    GTS+LIIV V++D + Q+Q +L++ QY+ V KK+ 
Sbjct: 377 ALYITFICLVPEFMTMAWQTPFYFGGTSILIIVVVIMDFMAQVQTHLMSHQYDSVLKKAN 436

Query: 439 SK 440
            K
Sbjct: 437 LK 438


>gi|170700714|ref|ZP_02891709.1| preprotein translocase, SecY subunit [Burkholderia ambifaria
           IOP40-10]
 gi|172059361|ref|YP_001807013.1| preprotein translocase subunit SecY [Burkholderia ambifaria MC40-6]
 gi|170134384|gb|EDT02717.1| preprotein translocase, SecY subunit [Burkholderia ambifaria
           IOP40-10]
 gi|171991878|gb|ACB62797.1| preprotein translocase, SecY subunit [Burkholderia ambifaria
           MC40-6]
          Length = 425

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 225/422 (53%), Positives = 303/422 (71%), Gaps = 7/422 (1%)

Query: 28  VFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIM 87
           +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA+ R  +F+LGIM
Sbjct: 1   MFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIM 60

Query: 88  PYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQ 147
           PYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   QA+GIA  L+N  
Sbjct: 61  PYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQAFGIAAALENQP 120

Query: 148 GIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSV 207
           G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AG P+++  +
Sbjct: 121 GLVIDPGMLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVGGL 180

Query: 208 LELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLP 267
            EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVGN+++    S+LP
Sbjct: 181 FELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLP 240

Query: 268 LKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIV----GLVDSLGHGRSFYMVL 321
           LKLN +GV+P IFASS++L PATI+G+   +  PT  WI      + ++L  G+  Y++L
Sbjct: 241 LKLNMSGVIPPIFASSIILFPATILGWFS-TGQPTGSWISNTLHNVAEALKPGQPVYVLL 299

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +LTR+T+ GA Y
Sbjct: 300 YTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRILTRLTLAGAIY 359

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K 
Sbjct: 360 IVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKG 419

Query: 442 KN 443
            N
Sbjct: 420 GN 421


>gi|171318368|ref|ZP_02907526.1| preprotein translocase, SecY subunit [Burkholderia ambifaria MEX-5]
 gi|171096446|gb|EDT41345.1| preprotein translocase, SecY subunit [Burkholderia ambifaria MEX-5]
          Length = 425

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 225/422 (53%), Positives = 303/422 (71%), Gaps = 7/422 (1%)

Query: 28  VFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIM 87
           +F ++ALIVYR G +IP+P ID    +K FQS++ GI G+FNMFSGGA+ R  +F+LGIM
Sbjct: 1   MFLLLALIVYRIGAHIPVPGIDPDQLAKLFQSQAGGILGMFNMFSGGALSRFTIFALGIM 60

Query: 88  PYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQ 147
           PYISASII+QL+A   P LE LKKEG+ G++ I QYTRY TV+L   QA+GIA  L+N  
Sbjct: 61  PYISASIIMQLLAIVSPQLEALKKEGQAGQRKITQYTRYFTVVLATFQAFGIAAALENQP 120

Query: 148 GIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSV 207
           G+V D    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AG P+++  +
Sbjct: 121 GLVIDPGTLFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAVGGL 180

Query: 208 LELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLP 267
            EL R GS+S    ++I     AV  LV+F ER QR++L+ Y KRQVGN+++    S+LP
Sbjct: 181 FELVRTGSMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLP 240

Query: 268 LKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT--WIV----GLVDSLGHGRSFYMVL 321
           LKLN +GV+P IFASS++L PATI+G+   +  PT  WI      + ++L  G+  Y++L
Sbjct: 241 LKLNMSGVIPPIFASSIILFPATILGWFS-TGQPTGSWISNTLHNVAEALKPGQPVYVLL 299

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           Y++ IVFF FFYTA+VFN +E ADNLKK G F+PGIRPGD+TA +ID +LTR+T+ GA Y
Sbjct: 300 YTLAIVFFCFFYTALVFNSRETADNLKKSGAFVPGIRPGDQTARYIDRILTRLTLAGAIY 359

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKK 441
           +V VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K 
Sbjct: 360 IVFVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKG 419

Query: 442 KN 443
            N
Sbjct: 420 GN 421


>gi|330827903|ref|YP_004390855.1| Preprotein translocase subunit secY [Aeromonas veronii B565]
 gi|328803039|gb|AEB48238.1| Preprotein translocase subunit secY [Aeromonas veronii B565]
          Length = 442

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/424 (48%), Positives = 292/424 (68%), Gaps = 7/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + A+IV+R G+Y+P+P ID    ++ FQ +   I  +FNMFSGGA+ R ++
Sbjct: 17  ELKSRLLFVLGAIIVFRAGSYVPIPGIDAAVLAELFQQQKGTIIEMFNMFSGGALSRASI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+    P+L  LKKEGE GR+ I+QYTR+ T++LG  QA GIA 
Sbjct: 77  LALGIMPYISASIIIQLLTVVHPALAELKKEGESGRRKISQYTRWGTLVLGTFQAIGIAT 136

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V++    F F+ +++L+ GTMFL+WLGEQIT RGIGNG+SLIIF+GIVAGL
Sbjct: 137 GLPNMMHGLVTNPGLGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISLIIFTGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P ++ +  E  R G +   L+LL+     AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PHAIGATAEQARQGELHILLLLLLGLIVFAVTYFVVFVERGQRRIVVNYAKRQQGRQVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS----LGHGRS 316
              ++LPLK+N AGV+P+IFASS++L P TI  +         +  ++      L  G+ 
Sbjct: 257 AQSTHLPLKVNMAGVIPAIFASSIILFPGTITSWFGQGEGK--VADILQQVSMVLQPGQP 314

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y +LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++TA +ID V+TR+T+
Sbjct: 315 LYEMLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTARYIDKVMTRLTL 374

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            GA Y+  +C+ P+ L+    V     GTSLLIIV V++D + Q+Q ++++ QY  V +K
Sbjct: 375 AGALYITFICLVPQFLMTAWNVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYGDVLRK 434

Query: 437 SRSK 440
           +  K
Sbjct: 435 ANLK 438


>gi|121997629|ref|YP_001002416.1| preprotein translocase subunit SecY [Halorhodospira halophila SL1]
 gi|121589034|gb|ABM61614.1| protein translocase subunit secY/sec61 alpha [Halorhodospira
           halophila SL1]
          Length = 434

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/422 (50%), Positives = 293/422 (69%), Gaps = 1/422 (0%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           R  +++ R++F ++ALI+YR GT+I +P ID  +  +    +   I  +FNMF+GGA+ER
Sbjct: 3   RLTEVRQRLLFVLLALIIYRIGTHITIPGIDPAALEQMVDQQRGTILEMFNMFAGGALER 62

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           +++F+LG+MPYISA+II+QL+ A VPSLE LKKEGE GR+ I QYTRY T+ L   Q  G
Sbjct: 63  LSIFALGVMPYISAAIIMQLLTAVVPSLERLKKEGEAGRRKITQYTRYGTLGLATFQGIG 122

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           I++ L+ GQG+ +     FVF + +TL  G +FL+WLGEQIT RGIGNG+S+IIF+GIVA
Sbjct: 123 ISIALQ-GQGVAAMPGPAFVFISTVTLATGVIFLMWLGEQITERGIGNGISIIIFAGIVA 181

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
           GLP +L   LEL R G + T  +LL+     AV A ++F ER QRR+ +QY KRQ G +M
Sbjct: 182 GLPGALGGTLELQRTGELGTATILLLLMMAAAVTAFIVFVERGQRRITVQYAKRQQGRKM 241

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFY 318
           +    S+LPLKLN AGV+P IFASS++L PAT+  +   +    +I  +  +L  G+  Y
Sbjct: 242 YAAQQSHLPLKLNMAGVIPPIFASSIILFPATVGQWFGDAEGLGFIGDIAATLSPGQPVY 301

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           + LY+  I+FF FFYTA+VFN ++ ADNLKK G FIPGIRPG++T+ +ID V +R+T VG
Sbjct: 302 VALYAAAIIFFCFFYTALVFNSRDTADNLKKSGAFIPGIRPGEQTSRYIDQVQSRLTFVG 361

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE LI    VP    GTSLLI V VV+D + Q+Q +L++ QYE + KK+ 
Sbjct: 362 ALYITAVCLMPEFLILYWNVPFYFGGTSLLISVIVVMDFMAQLQSHLVSHQYEPLMKKAN 421

Query: 439 SK 440
            K
Sbjct: 422 LK 423


>gi|239905878|ref|YP_002952617.1| preprotein translocase secY subunit [Desulfovibrio magneticus RS-1]
 gi|239795742|dbj|BAH74731.1| preprotein translocase secY subunit [Desulfovibrio magneticus RS-1]
          Length = 437

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/434 (46%), Positives = 295/434 (67%), Gaps = 10/434 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           + +R  +LK ++++T + + VYR G ++P+P +D  + +  F+S    +FGLF+MFSGG 
Sbjct: 8   NLARLPELKKKLLWTFLLVAVYRIGVHVPVPGVDSAALADFFESAKNTLFGLFDMFSGGG 67

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKE-GEQGRKVINQYTRYATVLLGIL 134
           +  +++F+LGIMPYISASII+QL+    P L  ++KE G  G+K I QYTRY TVL+  +
Sbjct: 68  LRNLSIFALGIMPYISASIIIQLLTVVSPELAKMQKEEGAAGKKKITQYTRYGTVLITCI 127

Query: 135 QAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           Q +GIAVGL++     G  +V    + F   TIITL  GT+FL+WLGEQ+T +GIGNG+S
Sbjct: 128 QGFGIAVGLESMASPTGAPVVLMPGWGFRLMTIITLCAGTVFLMWLGEQLTEKGIGNGIS 187

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LII+SGIVAGLP +++S  +L + G +S  +++LI +  +AV+  ++F ER QRR+ IQY
Sbjct: 188 LIIYSGIVAGLPRAVLSTFDLLKAGELSPLMLILIVALMLAVLVAIVFMERGQRRIPIQY 247

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KR VG +M+    ++LPL++NTAGV+P IFASS+LL PAT+  F    SS  W+  +  
Sbjct: 248 AKRMVGRKMYGGQTTHLPLRVNTAGVIPPIFASSILLFPATLGEF----SSVPWLKTVAS 303

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
                   Y V++   IVFF +FYTAI+F+P + A+N++K GGFIPGIRPG +T  +ID 
Sbjct: 304 LFSPQTMTYNVIFIALIVFFCYFYTAIIFDPNDIAENIRKQGGFIPGIRPGAKTKEYIDK 363

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           VL R+T+ G+ Y+  VC+ P  LI    VP    GTSLLI+V V +D + QI+ YLI++Q
Sbjct: 364 VLVRITLWGSMYISAVCVLPMMLIQQFNVPFYFGGTSLLIVVGVAMDFMSQIESYLISRQ 423

Query: 430 YEGVFKKSRSKKKN 443
           YEG+ +K R K + 
Sbjct: 424 YEGLMQKGRIKGRQ 437


>gi|331004903|ref|ZP_08328319.1| Preprotein translocase secY subunit [gamma proteobacterium
           IMCC1989]
 gi|330421290|gb|EGG95540.1| Preprotein translocase secY subunit [gamma proteobacterium
           IMCC1989]
          Length = 442

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 296/423 (69%), Gaps = 5/423 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F  +A+IVYR GT+IP+P ID    +  F+     I GLFNMFSGGA+ERM++
Sbjct: 16  ELWARLRFLFLAIIVYRIGTHIPVPGIDPDRIASLFEQNEGTIIGLFNMFSGGALERMSI 75

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASII+QL+ A  PSLE LKKEG+ GR+ I+QYTRY T+LL ++Q   ++V
Sbjct: 76  LALGIMPYISASIIMQLMTAVTPSLEQLKKEGDAGRRKISQYTRYLTILLALVQGTAMSV 135

Query: 142 GLKNGQGIVSDSD--YFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAG 199
           GL + QG+V +     FF   +I +L+ G +F++WLGEQ+T +GIGNG+S++IF+GIVAG
Sbjct: 136 GLAS-QGLVYEGGNLMFFYIISITSLVTGAVFMMWLGEQVTEKGIGNGISMLIFAGIVAG 194

Query: 200 LPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMF 259
           LPS++    E  + G ++  L+L I    +AV+  V+  ER QRR+ + Y KRQ G +++
Sbjct: 195 LPSAVGQAFESSQQGDLNILLLLGILFILLAVVWFVVRVERGQRRITVNYAKRQQGKKVY 254

Query: 260 QDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS--PTWIVGLVDSLGHGRSF 317
               S+LPLK+N AGV+P+IFASSLLL P +I  ++         ++     +LG G+  
Sbjct: 255 AAQSSHLPLKVNMAGVIPAIFASSLLLFPQSIASWLGNGEGGGSEFLQEFALALGPGQPL 314

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
             +L++  I+FF FFYTA+++NP E ADNLKK G +IPGIRPG+++A +ID VLTR+TVV
Sbjct: 315 NFILFAALIIFFCFFYTALMYNPAEVADNLKKSGAYIPGIRPGEQSAKYIDSVLTRLTVV 374

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           G+ Y+  VC+ P+ LI  T +P  L GTSLLI+V V++D + Q+Q +L++ QYE + KKS
Sbjct: 375 GSLYMAAVCLMPQFLIVATNIPFYLGGTSLLIVVVVLMDFMSQVQSHLMSSQYESLMKKS 434

Query: 438 RSK 440
             K
Sbjct: 435 NLK 437


>gi|78221866|ref|YP_383613.1| preprotein translocase subunit SecY [Geobacter metallireducens
           GS-15]
 gi|78193121|gb|ABB30888.1| protein translocase subunit secY/sec61 alpha [Geobacter
           metallireducens GS-15]
          Length = 435

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 207/435 (47%), Positives = 287/435 (65%), Gaps = 9/435 (2%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  R  +LK R++F++  L VYR G +IP P ID  + +  F      + GLF+MFSG
Sbjct: 5   FQNIFRIPELKKRVLFSLGMLAVYRVGCHIPTPGIDSTALAHFFAQARGTLLGLFDMFSG 64

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+E++ VF+LGIMPYIS+SII QL+   VP++E L KEGE GRK I QYTRY T++L +
Sbjct: 65  GALEKLTVFALGIMPYISSSIIFQLLTVVVPAIEKLSKEGESGRKKIIQYTRYGTIVLSV 124

Query: 134 LQAYGIAVGLKNGQG-----IVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           +QA GI++GL++ +G     +V    + F F T+ITL  GT F++WLGEQ++ +GIGNG+
Sbjct: 125 VQALGISIGLESMRGPAGELVVPSPGWGFRFMTVITLTAGTAFIMWLGEQMSEKGIGNGI 184

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GIVA +P +L + + L + G IS  ++L I      VIA ++F ER QRRL I 
Sbjct: 185 SLIIFAGIVARIPVALGNSVRLLKTGQISLFVILFILVLMFLVIAAIVFVERGQRRLPIH 244

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KR VG + +    S+LPLK+N AGV+P IFASS+++ PAT+  FI++     W+    
Sbjct: 245 YAKRVVGLKTYGGQTSHLPLKVNMAGVIPPIFASSIIMFPATVANFINIP----WVQSAA 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
            SL  G   Y + Y  FIVFF +FYTA+ FNP + ADN+KKHGG+IPGIRPG  T+ ++D
Sbjct: 301 KSLTPGNWVYDIFYVAFIVFFCYFYTAVSFNPVDVADNVKKHGGYIPGIRPGKETSEYLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            VLT++T  GA Y+  VC+ P  LI    +P    GT+LLI V V +DT  QI+ +LI +
Sbjct: 361 RVLTKLTFAGAIYISAVCVLPSILIGKFNLPFYFGGTALLIAVGVGMDTAAQIESHLITR 420

Query: 429 QYEGVFKKSRSKKKN 443
            YEG  K  R + + 
Sbjct: 421 SYEGFMKGVRVRGRK 435


>gi|33519678|ref|NP_878510.1| preprotein translocase subunit SecY [Candidatus Blochmannia
           floridanus]
 gi|33517341|emb|CAD83726.1| preprotein translocase subunit secY [Candidatus Blochmannia
           floridanus]
          Length = 451

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/427 (46%), Positives = 295/427 (69%), Gaps = 6/427 (1%)

Query: 21  KDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMA 80
           +DLK RI+F + ALI++R G++IP+P +D    SK  Q +   I  + N+FSGG++ R +
Sbjct: 22  RDLKQRIIFIVGALIIFRIGSFIPIPGVDLTVLSKILQEQQGTIIDMLNIFSGGSLSRAS 81

Query: 81  VFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIA 140
           +FSLGIMPYISASIIVQL+    P+L  +KKEGE GR+ IN+Y RY T++LG LQ+ GI 
Sbjct: 82  IFSLGIMPYISASIIVQLLTTVHPTLIEIKKEGESGRRAINRYIRYGTLILGTLQSLGIV 141

Query: 141 VGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           +GL N   +V +  + F F  +I+L+ GT+FL+WLG+QIT  GIGNG+S+IIFSGIVAGL
Sbjct: 142 IGLPNIPNLVINPGFNFYFVAVISLVSGTIFLMWLGDQITNHGIGNGISVIIFSGIVAGL 201

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY--PKRQVGNRM 258
           P+++   +E  R   +   +++LI    +++   V+F ER QRR+L+ Y  PKRQ G RM
Sbjct: 202 PAAIGHTIEQVRQNELHFFVLVLIVCLVISITFFVVFMERGQRRILVHYANPKRQQGRRM 261

Query: 259 F---QDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVS-SSPTWIVGLVDSLGHG 314
           +   Q + ++LPLK+N AGV+P+IFASS++L P+TI+ +     S   W+  +   L  G
Sbjct: 262 YSTQQGNSTHLPLKVNMAGVIPAIFASSIILFPSTIISWFSRGVSHHRWLHIVSTYLQPG 321

Query: 315 RSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRV 374
           +  Y+++YS  I+FF FFYT++VFNP++ ADNLKK G F+PGIRPG++TA +I+ ++ R+
Sbjct: 322 QLLYILIYSSAIIFFCFFYTSLVFNPRDTADNLKKSGAFVPGIRPGEQTAKYINKIILRL 381

Query: 375 TVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
           T  G+ Y+  +C+ PE +     VP    GTSLLI+V V+++ + QIQ  L+++QYE V 
Sbjct: 382 TFAGSMYVTFICLVPEFMRISMKVPFYFGGTSLLIVVVVIMEFMTQIQTLLMSRQYESVL 441

Query: 435 KKSRSKK 441
           KK+  K 
Sbjct: 442 KKANFKN 448


>gi|240124691|ref|ZP_04737577.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           SK-92-679]
          Length = 416

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 288/408 (70%), Gaps = 2/408 (0%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++ER ++F++GIMPYISA
Sbjct: 6   ALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLERFSIFAIGIMPYISA 65

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ G+A      QGIV  
Sbjct: 66  SIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSLGVA-SFVFQQGIVVT 124

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
           S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI +G+PS +  ++ L  
Sbjct: 125 SSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIASGIPSGIAKLVTLTN 184

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R+   + +++P KLN 
Sbjct: 185 QGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGRVGSQN-THMPFKLNM 243

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  YM L++  ++FF +F
Sbjct: 244 AGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLLYMALFAATVIFFCYF 303

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           YTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ GA Y+  +C+ PE L
Sbjct: 304 YTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLFGALYITTICLIPEFL 363

Query: 393 IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
             V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S  K
Sbjct: 364 TTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRSEMK 411


>gi|240081668|ref|ZP_04726211.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae FA19]
 gi|240124440|ref|ZP_04737396.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID332]
          Length = 416

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 288/408 (70%), Gaps = 2/408 (0%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++ER ++F++GIMPYISA
Sbjct: 6   ALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLERFSIFAIGIMPYISA 65

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ G+A      QGIV  
Sbjct: 66  SIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSLGVA-SFVFQQGIVVT 124

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
           S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI +G+PS +  ++ L  
Sbjct: 125 SSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIASGIPSGIAKLVTLTN 184

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R+   + +++P KLN 
Sbjct: 185 QGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGRVGSQN-THMPFKLNM 243

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  YM L++  ++FF +F
Sbjct: 244 AGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLLYMALFAATVIFFCYF 303

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           YTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ GA Y+  +C+ PE L
Sbjct: 304 YTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLFGAFYITTICLIPEFL 363

Query: 393 IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
             V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S  K
Sbjct: 364 TTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRSEMK 411


>gi|124514423|gb|EAY55936.1| Preprotein translocase subunit (SecY) [Leptospirillum rubarum]
          Length = 437

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 204/435 (46%), Positives = 292/435 (67%), Gaps = 8/435 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
            F +  +  +L+ RI+FTI  L VYR G YIP P ++  + S+        + G F+MFS
Sbjct: 8   TFENIGKIPELRQRILFTIGMLAVYRIGAYIPTPGVNGNALSQFLHQNGGALIGFFDMFS 67

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R+ +F+LGIMPYISASII+QL+    P+L+ + KEGE+GRK+I +YTRY TVL+ 
Sbjct: 68  GGALSRLTIFALGIMPYISASIILQLLTVVHPTLQAMAKEGERGRKIITRYTRYLTVLIA 127

Query: 133 ILQAYGIAVGLK---NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           ++Q++GIA+GL+   NGQ  V    + F F  +ITL   T F++W+GEQIT RG+GNG+S
Sbjct: 128 LVQSFGIALGLEGMNNGQ-FVPHPGWSFRFIVVITLTAATTFVMWIGEQITERGVGNGIS 186

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIFSGI+A LP+++++  +L   G IS  L+L +      +++ ++F E A+R++ IQY
Sbjct: 187 LIIFSGIIARLPAAIINTYKLYNQGEISGFLILALVVMVFLIVSSIVFIETARRKIPIQY 246

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KR VGN+M     +++P K+NTAGV+P IFASSL+  PA I GF+ V     WI     
Sbjct: 247 AKRLVGNKMMGGQSTHIPFKINTAGVIPPIFASSLISFPAIIAGFVSVP----WIQSFGK 302

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
           SL  G   Y  LY + IVFF FFYTA+V NP + A+N++K+GG+IPG+RPG +T  ++  
Sbjct: 303 SLSPGSFSYTGLYVLLIVFFCFFYTAVVLNPTDIAENMQKYGGYIPGVRPGQKTVEYLYR 362

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           V+ R+T VGA YL  VC+ PE LI    VP    GTSLLI++ V LDT  QI+ Y++++ 
Sbjct: 363 VMNRITFVGALYLSIVCVIPELLIYQLHVPFYFGGTSLLIVIGVSLDTAQQIESYMMSRN 422

Query: 430 YEGVFKKSRSKKKNS 444
           YEG+ KK+R K + +
Sbjct: 423 YEGILKKTRIKGRTA 437


>gi|283853173|ref|ZP_06370426.1| preprotein translocase, SecY subunit [Desulfovibrio sp. FW1012B]
 gi|283571431|gb|EFC19438.1| preprotein translocase, SecY subunit [Desulfovibrio sp. FW1012B]
          Length = 437

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/434 (46%), Positives = 296/434 (68%), Gaps = 10/434 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           + +R  +LK ++++T + + VYR G ++P+P +D  + +  F+S    +FGLF+MFSGG 
Sbjct: 8   NLARLPELKRKLLWTFLLVAVYRIGVHVPVPGVDSAALADFFESAKNTLFGLFDMFSGGG 67

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKE-GEQGRKVINQYTRYATVLLGIL 134
           +  +++F+LGIMPYISASII+QL+    P L  ++KE G  GRK I QYTRY TVL+ ++
Sbjct: 68  LRNLSIFALGIMPYISASIIIQLLTVVSPELAKMQKEEGAAGRKKITQYTRYGTVLIAVI 127

Query: 135 QAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           Q +GIAVGL++     G  +V  S + F   TIITL  GT+FL+WLGEQ+T +GIGNG+S
Sbjct: 128 QGFGIAVGLESMASPTGAPVVLMSGWAFRLMTIITLAAGTVFLMWLGEQMTEKGIGNGIS 187

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           +II++GIVAGLP +++S ++L + G +S  ++LLI +  + V+  ++F ER QRR+ IQY
Sbjct: 188 MIIYAGIVAGLPRAVLSTIDLVKAGELSLFVLLLIGALMIGVLYAIVFMERGQRRIPIQY 247

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KR VG +M+    ++LPL++NTAGV+P IFASS+LL PAT+  F  V     W+  +  
Sbjct: 248 AKRMVGRKMYGGQTTHLPLRVNTAGVIPPIFASSILLFPATLGEFSHVP----WLKSVAS 303

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
                   Y V++   IVFF +FYTAI+F+P + A+N++K GGFIPGIRPG +T  +ID 
Sbjct: 304 FFSPQTMTYNVVFVALIVFFCYFYTAIIFDPADIAENIRKQGGFIPGIRPGAKTKEYIDK 363

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           VL R+T+ G+ Y+  VC+ P  LI    VP    GTSLLI+V V +D + QI+ YLI++Q
Sbjct: 364 VLARITLWGSLYISVVCVLPMVLIQQFNVPFYFGGTSLLIVVGVAMDFMSQIESYLISRQ 423

Query: 430 YEGVFKKSRSKKKN 443
           YEG+ +K R K + 
Sbjct: 424 YEGLMQKGRIKGRQ 437


>gi|218885207|ref|YP_002434528.1| preprotein translocase subunit SecY [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756161|gb|ACL07060.1| preprotein translocase, SecY subunit [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 437

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/434 (47%), Positives = 292/434 (67%), Gaps = 10/434 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           + +R  +L+ ++ +T + L  YR G ++P+P +D  + +  F S    +FGLF+MFSGG 
Sbjct: 8   NLARLPELRKKLFWTFLLLAAYRIGVHVPVPGVDSGALADFFASVQNTLFGLFDMFSGGG 67

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENL-KKEGEQGRKVINQYTRYATVLLGIL 134
           +  ++VF+LGIMPYISASII+QL+    P L+ + K+EG  GR+ I QYTRYATVL+ ++
Sbjct: 68  LRNLSVFALGIMPYISASIIIQLLQVVSPELKRMAKEEGAAGRRKITQYTRYATVLITVI 127

Query: 135 QAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           Q +GIAVGL+N     G  +V D+ + F   TI TL  GT+ ++WLGEQIT +GIGNG+S
Sbjct: 128 QGFGIAVGLENMHSPAGAPVVLDAGWGFRMITIATLTAGTVLIMWLGEQITEKGIGNGIS 187

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIFSGIVAG+P  +V   +L + G +S    +L+ +    V+  ++F ER QRR+ I Y
Sbjct: 188 LIIFSGIVAGIPGGIVKSGQLIKAGDMSVFTAILVLALMAVVLGCIVFMERGQRRIPIHY 247

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KRQVG +MF    ++LPL++NTAGV+P IFASSLLL PATI  F    S+   +  +  
Sbjct: 248 AKRQVGRKMFGGQSTHLPLRINTAGVIPPIFASSLLLFPATIASF----SANETLQRVAA 303

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
                   Y +L+   IVFF FFYTAI+F+PK+ A+NLKK GGFIPGIRPGD+T  +ID 
Sbjct: 304 WFAPHTVMYNILFISLIVFFCFFYTAIIFDPKDIAENLKKGGGFIPGIRPGDKTRQYIDR 363

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           VLTR+T+ GA Y+  +C+ P  LIA   VP    GTS+LI+V V +D + Q++ +LI++Q
Sbjct: 364 VLTRMTIWGAIYISAICVLPMILIAQFNVPFYFGGTSVLILVGVAMDFMSQVESHLISRQ 423

Query: 430 YEGVFKKSRSKKKN 443
           YEG+  K+R K + 
Sbjct: 424 YEGLMNKTRIKGRQ 437


>gi|255319795|ref|ZP_05361000.1| preprotein translocase, SecY subunit [Acinetobacter radioresistens
           SK82]
 gi|262380328|ref|ZP_06073482.1| preprotein translocase, SecY subunit [Acinetobacter radioresistens
           SH164]
 gi|255303114|gb|EET82326.1| preprotein translocase, SecY subunit [Acinetobacter radioresistens
           SK82]
 gi|262297774|gb|EEY85689.1| preprotein translocase, SecY subunit [Acinetobacter radioresistens
           SH164]
          Length = 452

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/433 (47%), Positives = 303/433 (69%), Gaps = 12/433 (2%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           + +++  R++F I AL+V+R G +IP+P I+  +    F +    I GLFNMFSGGA+ER
Sbjct: 22  KYREIIRRMMFLIGALLVFRLGAHIPVPGINNAALENLFNANQGTILGLFNMFSGGALER 81

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           M++ +LGIMPYISASIIVQL++  +PSLE LKKEGEQG++ INQYTR  T+LL ++QA G
Sbjct: 82  MSILALGIMPYISASIIVQLMSTVIPSLEALKKEGEQGKRKINQYTRQGTLLLALVQATG 141

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           +  GL  GQGI   S   F    + +L+ GTMFL+WLGEQIT RG+GNG+S+IIF+GIVA
Sbjct: 142 MCAGLI-GQGITLTSGLAFYVPAVTSLVAGTMFLMWLGEQITERGVGNGISMIIFAGIVA 200

Query: 199 GLPSSLVSVLELGRVGSISTPLM-LLIFS-STVAVIALVIFFERAQRRLLIQYPKRQVGN 256
           GLP+ ++    L  V S  T L+ L+IF   ++ V+A ++F E+AQRR+ + Y ++Q G 
Sbjct: 201 GLPNLIMQ--SLSSVDSGQTSLIGLVIFGLLSLGVLAAIVFIEKAQRRISVNYAQKQQGR 258

Query: 257 RMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV--GLVD---SL 311
           R+F    ++LPLK+N AGV+P+IFASSLLL PA++  ++  +     ++  GL D    L
Sbjct: 259 RVFTAQQTHLPLKINMAGVIPAIFASSLLLFPASLGQWVGSADPNAGMIKRGLQDLALVL 318

Query: 312 GHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVL 371
             G+  Y+VL+   I+FF +FYTA+VF+PKE ++NLK+ G ++PGIRPG++TA ++D++L
Sbjct: 319 SPGQPLYLVLFGALIIFFCYFYTALVFSPKEVSENLKRSGAYVPGIRPGEQTARYLDHIL 378

Query: 372 TRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
            R+T +GA Y+  +C+ P  L +  G+P  L GTSLLI+V VV+D + Q+Q +L + QY+
Sbjct: 379 NRLTFIGAMYITVICLMPMVLQSSFGIPFYLGGTSLLIVVVVVMDFMAQLQAHLTSHQYD 438

Query: 432 G--VFKKSRSKKK 442
              + +K+ +  K
Sbjct: 439 NQSLMRKTTAHPK 451


>gi|239997946|ref|ZP_04717870.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae 35/02]
 gi|240015076|ref|ZP_04721989.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae DGI18]
 gi|240113946|ref|ZP_04728436.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae MS11]
 gi|240118902|ref|ZP_04732964.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID1]
 gi|240122148|ref|ZP_04735110.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID24-1]
 gi|240129116|ref|ZP_04741777.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae
           SK-93-1035]
          Length = 416

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 287/408 (70%), Gaps = 2/408 (0%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++ER ++F++GIMPYISA
Sbjct: 6   ALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLERFSIFAIGIMPYISA 65

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ G+A      QGIV  
Sbjct: 66  SIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSLGVA-SFVFQQGIVVT 124

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
           S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI +G+PS +  ++ L  
Sbjct: 125 SSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIASGIPSGIAKLVTLTN 184

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R    + +++P KLN 
Sbjct: 185 QGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGRAGSQN-THMPFKLNM 243

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  YM L++  ++FF +F
Sbjct: 244 AGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLLYMALFAATVIFFCYF 303

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           YTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ GA Y+  +C+ PE L
Sbjct: 304 YTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLFGALYITTICLIPEFL 363

Query: 393 IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
             V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S  K
Sbjct: 364 TTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRSEMK 411


>gi|240116680|ref|ZP_04730742.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae PID18]
          Length = 416

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 287/408 (70%), Gaps = 2/408 (0%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++ER ++F++GIMPYISA
Sbjct: 6   ALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLERFSIFAIGIMPYISA 65

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ G+A      QGIV  
Sbjct: 66  SIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSLGVA-SFVFQQGIVVT 124

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
           S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI +G+PS +  ++ L  
Sbjct: 125 SSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIASGIPSGIAKLVTLTN 184

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R    + +++P KLN 
Sbjct: 185 QGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGRAGSQN-THMPFKLNM 243

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  YM L++  ++FF +F
Sbjct: 244 AGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLLYMALFAATVIFFCYF 303

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           YTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ GA Y+  +C+ PE L
Sbjct: 304 YTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLFGAFYITTICLIPEFL 363

Query: 393 IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
             V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S  K
Sbjct: 364 TTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRSEMK 411


>gi|220935472|ref|YP_002514371.1| preprotein translocase subunit SecY [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996782|gb|ACL73384.1| preprotein translocase subunit SecY [Thioalkalivibrio sp. HL-EbGR7]
          Length = 451

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 308/427 (72%), Gaps = 6/427 (1%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           +  +L+ R+VF ++AL+VYR GT+IP+P I+ ++ ++ F   S  I  +FNMFSGGA+ER
Sbjct: 17  KLTELRQRLVFVLLALVVYRIGTFIPVPGINPVAMAQFFDQHSGTILDMFNMFSGGALER 76

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           +++F+LG+MPYISA+II+QL++ATVPSL+ LKKEGE GR+ I QYTRY TV L + Q+ G
Sbjct: 77  LSIFALGVMPYISAAIIMQLLSATVPSLQQLKKEGEAGRRKITQYTRYGTVALALFQSIG 136

Query: 139 IAVGLKNGQGIVSDSDYF-----FVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIF 193
           IA+ L NGQ I   S        F+F+T++TL+ GTMFL+WLGEQIT RGIGNG+S+IIF
Sbjct: 137 IAIAL-NGQQIGGMSMAIAPGPGFIFTTVVTLVTGTMFLMWLGEQITERGIGNGISIIIF 195

Query: 194 SGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQ 253
           +GIVAGLP+++   LEL R G +S   ++L+    +AV A V+F ER QRR+ + Y KRQ
Sbjct: 196 AGIVAGLPAAIGGTLELARTGELSPAFVMLLIIMALAVTAFVVFVERGQRRITVNYAKRQ 255

Query: 254 VGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGH 313
           VG +++    S+LPLKLN AGV+P IFASS++L PAT+  +   +   TW+  +  +L  
Sbjct: 256 VGRKVYGGQSSHLPLKLNMAGVIPPIFASSIILFPATLGTWFGQAEGMTWLRDISTTLAP 315

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G+  Y++ Y+  I+FF FFYTA+VFN +E ADNLKK G FIPGIRPG +T  +ID V+TR
Sbjct: 316 GQPLYVMFYAAAIIFFCFFYTALVFNSRETADNLKKSGAFIPGIRPGMQTERYIDGVMTR 375

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV 433
           +T VGA Y+  VC+ PE +I    VP    GTSLLIIV VV+D + Q+Q +L++ QYEG+
Sbjct: 376 LTAVGAIYITAVCLLPEFMILYWNVPFYFGGTSLLIIVIVVMDFMAQLQAHLMSHQYEGL 435

Query: 434 FKKSRSK 440
            KK+  K
Sbjct: 436 MKKANLK 442


>gi|17547718|ref|NP_521120.1| preprotein translocase subunit SecY [Ralstonia solanacearum
           GMI1000]
 gi|17430023|emb|CAD16708.1| probable preprotein translocase secy (membrane subunit)
           transmembrane [Ralstonia solanacearum GMI1000]
          Length = 448

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 219/423 (51%), Positives = 299/423 (70%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DL+ R+VF ++AL+VYR G +IP+P ID    ++ FQ +S GI G+FN+FSGGA+ R  V
Sbjct: 20  DLRRRLVFLVLALLVYRIGAHIPVPGIDPDQLAQLFQRQSGGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE+LKKEG+ G++ I QYTRY TV+L   QA GIAV
Sbjct: 80  FALGIMPYISASIIMQLLTIVLPQLESLKKEGQAGQRKITQYTRYGTVVLATFQALGIAV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V D    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AGLP
Sbjct: 140 ALEAQPGLVLDPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  + EL R GS+     +L+ +   AV  LV+F ER QR++L+ Y KRQVGN+++  
Sbjct: 200 NAIGGLFELVRTGSMGIFSAILVVAIIGAVTFLVVFIERGQRKILVNYAKRQVGNKIYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT----WIVGLVDSLGHGRSF 317
             S+LPLKLN AGV+P IFASS++L PATI G+    +S      ++  L  +L  G+  
Sbjct: 260 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTAGNSTNPVARFVKDLASTLSPGQPV 319

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R+T+ 
Sbjct: 320 YILLYAAAIIFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVRLTLA 379

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+
Sbjct: 380 GAIYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLMKKA 439

Query: 438 RSK 440
             K
Sbjct: 440 NFK 442


>gi|299065435|emb|CBJ36604.1| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Ralstonia
           solanacearum CMR15]
          Length = 448

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 219/423 (51%), Positives = 299/423 (70%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DL+ R+VF ++AL+VYR G +IP+P ID    ++ FQ +S GI G+FN+FSGGA+ R  V
Sbjct: 20  DLRRRLVFLVLALLVYRIGAHIPVPGIDPDQLAQLFQRQSGGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE+LKKEG+ G++ I QYTRY TV+L   QA GIAV
Sbjct: 80  FALGIMPYISASIIMQLLTIVLPQLESLKKEGQAGQRKITQYTRYGTVVLATFQALGIAV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V D    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AGLP
Sbjct: 140 ALEAQPGLVLDPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  + EL R GS+     +L+ +   AV  LV+F ER QR++L+ Y KRQVGN+++  
Sbjct: 200 NAIGGLFELVRTGSMGIFSSILVVAIIGAVTFLVVFIERGQRKILVNYAKRQVGNKIYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT----WIVGLVDSLGHGRSF 317
             S+LPLKLN AGV+P IFASS++L PATI G+    +S      ++  L  +L  G+  
Sbjct: 260 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTAGNSANPVARFVKDLASTLSPGQPV 319

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R+T+ 
Sbjct: 320 YILLYATAIIFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVRLTLA 379

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+
Sbjct: 380 GAIYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLMKKA 439

Query: 438 RSK 440
             K
Sbjct: 440 NFK 442


>gi|253701902|ref|YP_003023091.1| preprotein translocase subunit SecY [Geobacter sp. M21]
 gi|251776752|gb|ACT19333.1| preprotein translocase, SecY subunit [Geobacter sp. M21]
          Length = 435

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/435 (46%), Positives = 292/435 (67%), Gaps = 9/435 (2%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  +  +LK +++F++  L VYR G +IP P ID ++ S  F++    + G+F+MFSG
Sbjct: 5   FQNIFKIPELKKKVLFSLAMLAVYRVGCFIPTPGIDAVALSSFFKAAQGTLLGMFDMFSG 64

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+E++ VF+LGIMPYIS+SII QL+   +P++E L KEG+ GRK I QYTRY T++L +
Sbjct: 65  GALEKLTVFALGIMPYISSSIIFQLLTVVLPAVEKLSKEGDAGRKKIIQYTRYGTIVLAV 124

Query: 134 LQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           +QA+GI++GL+      G+ +V +  + F   T+ITL  GT F++WLGEQ++ +GIGNG+
Sbjct: 125 VQAFGISIGLEAMRGPAGELVVPNPGWGFRLMTVITLTAGTAFIMWLGEQMSEKGIGNGI 184

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GIVA +P+++ +   L + G +S  ++LLI +   AVIA V+F ER QRR+ I 
Sbjct: 185 SLIIFAGIVARIPTAIGNSFRLMKTGELSLFVLLLIAAVMFAVIAAVVFMERGQRRIPIH 244

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KR VG +      S+LPLK+N AGV+P IFASS+++ PAT+  FIDV     W+    
Sbjct: 245 YAKRVVGLKTVGAQSSHLPLKVNMAGVIPPIFASSIIMFPATVGNFIDVP----WVQAAS 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             L  G+  Y +L+  FIVFF +FYTA+ FNP + A+N+KK GG++PGIRPG  T+  +D
Sbjct: 301 KQLAPGKMLYEILFVAFIVFFCYFYTAVTFNPVDVAENVKKQGGYVPGIRPGKETSDFLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            VLT++T  GA Y+  VC+ P  LI    +P    GTSLLI V V +DT+ QI+ +LI +
Sbjct: 361 AVLTKLTFAGAIYISAVCVLPSILIGKFNLPFYFGGTSLLIAVGVGMDTLAQIEAHLITR 420

Query: 429 QYEGVFKKSRSKKKN 443
            YEG  K  R + + 
Sbjct: 421 SYEGFMKGVRIQGRR 435


>gi|90417589|ref|ZP_01225507.1| preprotein translocase, SecY subunit [marine gamma proteobacterium
           HTCC2207]
 gi|90330610|gb|EAS45906.1| preprotein translocase, SecY subunit [marine gamma proteobacterium
           HTCC2207]
          Length = 439

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/421 (47%), Positives = 294/421 (69%), Gaps = 3/421 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L +R+ F   A+I+YR GT+IP+P  D    ++ F        GLFNMFSGGA+ERM++
Sbjct: 17  ELWARLRFLFAAIIIYRIGTHIPVPGFDPDRLAELFTQNQGTYLGLFNMFSGGALERMSI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LG+MPYISASII+QL++ATVP+LE LKKEG+ GR+ INQYTRY TV L ++Q   +AV
Sbjct: 77  LALGVMPYISASIIMQLLSATVPALEQLKKEGDSGRRKINQYTRYGTVFLALIQGTAMAV 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
           G  + QG+  + +  F    I +L+ G +FL+WLGEQIT RGIGNG+S++IF+GIVAG+P
Sbjct: 137 GFAS-QGLAYEVNTMFYMVAISSLVAGAVFLMWLGEQITERGIGNGISMLIFAGIVAGIP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
            ++   LE  + G + + +++ +    VAV+  V+F ER QRRL + Y +RQ G + +  
Sbjct: 196 GAIGQALESAKQGELDSLILVFVLLIAVAVVYFVVFIERGQRRLTVNYAQRQ-GRQAYNA 254

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATI-MGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
             S+LPLK+N AGV+P+IFASSLLL PA+I   F   S++P W+  +   +G G+  Y++
Sbjct: 255 QSSHLPLKVNMAGVIPAIFASSLLLFPASISQWFGSASNAPDWLQDISLLIGPGQPLYVL 314

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           ++S  I+FF+FFYTA+++NP+E ADNLKK G ++PGIRPG+ TA +ID V TR+T++G  
Sbjct: 315 MFSSLIIFFSFFYTALMYNPREVADNLKKGGAYLPGIRPGEHTAKYIDSVTTRLTLIGGI 374

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  +C+ P+ L     VP  L GTSLLI V V +D + Q+Q +L++QQY+ + KK+  K
Sbjct: 375 YITLICLMPQFLNVYFNVPFYLGGTSLLIAVVVSMDFMAQVQSHLMSQQYDSLMKKANLK 434

Query: 441 K 441
            
Sbjct: 435 N 435


>gi|206602695|gb|EDZ39176.1| Preprotein translocase subunit (SecY) [Leptospirillum sp. Group II
           '5-way CG']
          Length = 437

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/435 (46%), Positives = 292/435 (67%), Gaps = 8/435 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
            F +  +  +L+ RI+FTI  L VYR G YIP P ++  + S+        + G F+MFS
Sbjct: 8   TFENIGKISELRQRILFTIGMLAVYRIGAYIPTPGVNGNALSQFLHQNGGALIGFFDMFS 67

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GGA+ R+ +F+LGIMPYISASII+QL+    P+L+ + KEGE+GRK+I +YTRY TV++ 
Sbjct: 68  GGALSRLTIFALGIMPYISASIILQLLTVVHPTLQAMAKEGERGRKIITRYTRYLTVVIA 127

Query: 133 ILQAYGIAVGLK---NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
           ++Q++GIA+GL+   NGQ  V    + F F  +ITL   T F++W+GEQIT RG+GNG+S
Sbjct: 128 LVQSFGIALGLEGMNNGQ-FVPHPGWSFRFIVVITLTAATTFVMWIGEQITERGVGNGIS 186

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIFSGI+A LP+++++  +L   G IS  L+L +      +++ ++F E A+R++ IQY
Sbjct: 187 LIIFSGIIARLPAAIINTYKLYNQGEISGFLILALIVMVFLIVSSIVFIETARRKIPIQY 246

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            KR VGN+M     +++P K+NTAGV+P IFASSL+  PA I GF+ V     WI     
Sbjct: 247 AKRLVGNKMMGGQSTHIPFKINTAGVIPPIFASSLISFPAIIAGFVSVP----WIQSFGK 302

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
           SL  G   Y  LY + IVFF FFYTA+V NP + A+N++K+GG+IPG+RPG +T  ++  
Sbjct: 303 SLSPGSFSYTGLYVLLIVFFCFFYTAVVLNPTDIAENMQKYGGYIPGVRPGQKTVEYLYR 362

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           V+ R+T VGA YL  VC+ PE LI    VP    GTSLLI++ V LDT  QI+ Y++++ 
Sbjct: 363 VMNRITFVGALYLSIVCVIPELLIYQLHVPFYFGGTSLLIVIGVSLDTAQQIESYMMSRN 422

Query: 430 YEGVFKKSRSKKKNS 444
           YEG+ KK+R K + +
Sbjct: 423 YEGILKKTRIKGRTA 437


>gi|309379139|emb|CBX22270.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 416

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/413 (48%), Positives = 294/413 (71%), Gaps = 2/413 (0%)

Query: 28  VFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIM 87
           +F + AL+V+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++ER ++F++GIM
Sbjct: 1   MFLLGALVVFRIGAHIPVPGVDAVALAKLYESAGGGILGMLNMFSGGSLERFSIFAIGIM 60

Query: 88  PYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQ 147
           PYISASIIVQL +  +PSL+ LKKEGE GRK+I +YTRY TVLL ILQ+ G+A      +
Sbjct: 61  PYISASIIVQLASEILPSLKALKKEGEAGRKLITKYTRYGTVLLAILQSLGVA-SFVFQR 119

Query: 148 GIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSV 207
           GIV  S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI +G+PS +  +
Sbjct: 120 GIVVTSSFEFYVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIASGIPSGITRL 179

Query: 208 LELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLP 267
           +     G++S  + LLI    + +I LV++FE AQR++ I Y KRQ  N    +  +++P
Sbjct: 180 VAFVNQGTMSILMALLIVFGVLLLIYLVVYFESAQRKVPIHYAKRQF-NSGLGNHNTHMP 238

Query: 268 LKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIV 327
            KLN AGV+P IFASS++L P+T++G+  ++ + + +  +V  L HG+S YMVL++  ++
Sbjct: 239 FKLNMAGVIPPIFASSIILFPSTLLGWFGLTDTNSILYKIVGLLQHGQSLYMVLFAATVI 298

Query: 328 FFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCI 387
           FF +FYTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ GA Y+  +C+
Sbjct: 299 FFCYFYTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLFGALYITIICL 358

Query: 388 FPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
            PE L  V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S  K
Sbjct: 359 IPEFLTTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMIRSEMK 411


>gi|29653610|ref|NP_819302.1| preprotein translocase subunit SecY [Coxiella burnetii RSA 493]
 gi|154707133|ref|YP_001425162.1| preprotein translocase subunit SecY [Coxiella burnetii Dugway
           5J108-111]
 gi|161829790|ref|YP_001596205.1| preprotein translocase subunit SecY [Coxiella burnetii RSA 331]
 gi|29540872|gb|AAO89816.1| protein translocase subunit [Coxiella burnetii RSA 493]
 gi|154356419|gb|ABS77881.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111]
 gi|161761657|gb|ABX77299.1| preprotein translocase, SecY subunit [Coxiella burnetii RSA 331]
          Length = 442

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/416 (48%), Positives = 290/416 (69%), Gaps = 1/416 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F +I +IVYR G YIP+P +D    +  F     G  G+FNMFSGGA+ RM +
Sbjct: 17  ELKRRLLFVLIGIIVYRLGAYIPVPGLDPSRLAALFHQHETGFLGMFNMFSGGALSRMTI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LG+MPYIS+SIIVQ+ +   P ++ L+KEGE GR+ INQYTRY TV+L +LQ+  +  
Sbjct: 77  FALGVMPYISSSIIVQMYSQISPKMQALRKEGEAGRRKINQYTRYGTVILSLLQSAFMTK 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L +  G V + +  F F+ I+TL+ GTMFL+WLGEQ+T RG+GNG+SLIIF+ I +  P
Sbjct: 137 WLVS-SGTVINPNLGFYFTAIVTLVTGTMFLMWLGEQMTERGVGNGISLIIFASIASRFP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  V    R G +S  ++LL+ +  V V  +V+FFERAQRR+ I Y KRQ G +++  
Sbjct: 196 AAIGQVFTQVRQGQMSVLILLLLIAVIVLVTLVVVFFERAQRRITINYAKRQQGRKLYAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFA S++L P  +  F+       W+  +  +L +G+  Y+V+
Sbjct: 256 QSSHLPLKINMAGVIPVIFAQSIILFPGAVAKFMSSVKGLGWLNDVSLALSYGQPAYIVV 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++ ++FF+FFYTA+VFNPKE ADNLKK G FIPGIRPG++TA +ID V+TR+T+VG+ Y
Sbjct: 316 FAIAVIFFSFFYTALVFNPKETADNLKKSGAFIPGIRPGEQTANYIDKVMTRLTLVGSVY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           L  V + P+ LI    VP    GTSLLI+V V++D + Q+Q +L++ QYE + KKS
Sbjct: 376 LALVALLPQFLILAWNVPFYFGGTSLLIVVVVIMDFMAQVQAHLMSHQYESLMKKS 431


>gi|300690180|ref|YP_003751175.1| preprotein translocase, membrane component, transport across inner
           membrane (general Secretory Pathway) [Ralstonia
           solanacearum PSI07]
 gi|299077240|emb|CBJ49866.2| preprotein translocase, membrane component, transport across inner
           membrane (General Secretory Pathway) [Ralstonia
           solanacearum PSI07]
          Length = 440

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 220/427 (51%), Positives = 301/427 (70%), Gaps = 4/427 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           ++  DL+ R+VF ++AL+VYR G +IP+P ID    ++ FQ +S GI G+FN+FSGGA+ 
Sbjct: 8   AKYGDLRRRLVFLVLALLVYRIGAHIPVPGIDPDQLAQLFQRQSGGILGMFNLFSGGALS 67

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAY 137
           R  VF+LGIMPYISASII+QL+   +P LE+LKKEG+ G++ I QYTRY TV+L   QA 
Sbjct: 68  RFTVFALGIMPYISASIIMQLLTIVLPQLESLKKEGQAGQRRITQYTRYGTVVLATFQAL 127

Query: 138 GIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIV 197
           GIAV L+   G+V D    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI 
Sbjct: 128 GIAVALEAQPGLVLDPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIA 187

Query: 198 AGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
           AGLP+++  + EL R GS+     +L+ +   AV  LV+F ER QR++L+ Y KRQVGN+
Sbjct: 188 AGLPNAIGGLFELVRTGSMGIFSSILVVAIIGAVTFLVVFIERGQRKILVNYAKRQVGNK 247

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT----WIVGLVDSLGH 313
           ++    S+LPLKLN AGV+P IFASS++L PATI G+    SS      ++  L  +L  
Sbjct: 248 IYGGQSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTAGSSTNPVARFVKDLASTLSP 307

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G+  Y++LY+  I+FF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R
Sbjct: 308 GQPVYILLYAAAIIFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVR 367

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV 433
           +T+ GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE +
Sbjct: 368 LTLAGAVYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESL 427

Query: 434 FKKSRSK 440
            KK+  K
Sbjct: 428 MKKANFK 434


>gi|258591336|emb|CBE67635.1| Preprotein translocase secY subunit [NC10 bacterium 'Dutch
           sediment']
          Length = 436

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 211/429 (49%), Positives = 291/429 (67%), Gaps = 9/429 (2%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           R  +LK RI+FT++ALI YR G++IP P ID  + S  FQ     + G F++FSGGA+ R
Sbjct: 10  RVPELKKRIIFTVLALIAYRLGSHIPTPGIDAHALSAFFQQAGGTLLGFFDLFSGGALRR 69

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           +++F+LGIMPYISASII+QL+A   P LE L KEGE GRK I+QYTRY TVLL  +QA G
Sbjct: 70  LSIFALGIMPYISASIILQLLAVVFPPLEKLSKEGEAGRKKISQYTRYGTVLLAAIQAMG 129

Query: 139 IAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIF 193
           IA+GL++      + IV +    F   T ITL  G +FL+WLGEQIT RGIGNG+SL+IF
Sbjct: 130 IAIGLESMRSPLDEQIVINPGIGFRVMTTITLTTGAIFLMWLGEQITERGIGNGISLLIF 189

Query: 194 SGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQ 253
           +GI+  +P ++V+   L   G ++   +L++    V V+A VI     QR +++QY KR 
Sbjct: 190 AGIIVRMPEAIVNTWRLLTTGELNALSLLIVLILMVLVVAGVIIMTLGQRPIVVQYAKRV 249

Query: 254 VGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGH 313
           VG R++    +++PL++NTAGV+P IFA+S+++ PATI  F +    P W+  L  +L  
Sbjct: 250 VGRRIYGGQSTHIPLRINTAGVIPVIFAASIIVFPATIAQFFN---HP-WMQALARALSP 305

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
               Y VLY++ I+FF +FYTAIVFNP + ADN++K+GGFIPGIRPG +TA  I+ VL R
Sbjct: 306 ATVTYTVLYAIAIIFFTYFYTAIVFNPIDVADNMRKYGGFIPGIRPGAKTAEFIEKVLDR 365

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGV 433
           +T+VGA YL  + I PE LI    VP    GTSLLI+V V LDT+ Q++ +L+ + YEG 
Sbjct: 366 ITLVGAIYLTLISILPELLITTMNVPFFFGGTSLLIVVGVALDTVQQVESHLVMRHYEGF 425

Query: 434 FKKSRSKKK 442
            KK+R K +
Sbjct: 426 LKKTRIKGR 434


>gi|298506868|gb|ADI85591.1| preprotein translocase, SecY subunit [Geobacter sulfurreducens
           KN400]
          Length = 435

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/435 (46%), Positives = 291/435 (66%), Gaps = 9/435 (2%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  R  +LK R++F++  L VYR G +IP P ID  + +  F      + GLF+MFSG
Sbjct: 5   FQNIFRIPELKKRVLFSLGMLAVYRVGCHIPTPGIDSNALAHFFAQARGTLLGLFDMFSG 64

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+E++ VF+LGIMPYIS+SII QL+   VPS+E L KEGE GRK I QYTRY T++L +
Sbjct: 65  GALEKLTVFALGIMPYISSSIIFQLLTVVVPSIEKLSKEGESGRKKIIQYTRYGTIVLSV 124

Query: 134 LQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           +QA GI++GL++     G+ +V +  + F   T+ITL  GT F++WLGEQ++ +GIGNG+
Sbjct: 125 VQALGISIGLESMRGPAGELVVPNPGWGFRLMTVITLTAGTAFIMWLGEQMSEKGIGNGI 184

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GIVA +P++L++   L + G +S  ++LL+ +    VIA +++ ER QRRL I 
Sbjct: 185 SLIIFAGIVARIPTALLNTGRLIKTGQLSLFVILLVVALMFLVIAAIVYVERGQRRLPIH 244

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KR VG + +    S+LPLK+N AGV+P IFASS+++ PAT+  FI+V     W+  + 
Sbjct: 245 YAKRVVGLKTYGGQTSHLPLKVNMAGVIPPIFASSIIMFPATVANFINVP----WVQTVA 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
            SL  G   Y + Y  FI+FF +FYTA+ FNP + A+N+KKHGG+IPGIRPG  T+ ++D
Sbjct: 301 KSLTPGNLAYEIFYVAFIIFFCYFYTAVSFNPVDVAENVKKHGGYIPGIRPGKETSDYLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            VLT++T  GA Y+  VC+ P  L+    +P    GT+LLI V V +DT  QI+ +LI +
Sbjct: 361 RVLTKLTFAGALYISAVCVLPSVLVGKFNLPFYFGGTALLIAVGVGMDTAAQIESHLITR 420

Query: 429 QYEGVFKKSRSKKKN 443
            YEG  K  R + + 
Sbjct: 421 SYEGFMKGVRVRGRR 435


>gi|312795796|ref|YP_004028718.1| protein translocase subunit secY [Burkholderia rhizoxinica HKI 454]
 gi|312167571|emb|CBW74574.1| Protein translocase subunit secY [Burkholderia rhizoxinica HKI 454]
          Length = 450

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 220/409 (53%), Positives = 292/409 (71%)

Query: 35  IVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASI 94
           IVYR G +IP+P ID    +K FQS+S GI  +FNMFSGGA+ R  VF+LGIMPYISASI
Sbjct: 38  IVYRIGAHIPVPGIDPDQLAKLFQSQSGGILAMFNMFSGGALSRFTVFALGIMPYISASI 97

Query: 95  IVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSD 154
           I+QL+A   P LE LKKEG+ G++ I QYTRY TV L   QA+ IAV L+N   +V D  
Sbjct: 98  IMQLLAIVSPQLEALKKEGQAGQRRITQYTRYFTVALATFQAFSIAVALENQPNLVIDPG 157

Query: 155 YFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVG 214
             F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AG P+++  + EL R G
Sbjct: 158 MMFRLTTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGFPNAIGGLFELVRTG 217

Query: 215 SISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAG 274
           S+S    ++I     AV  LV+F ER QR++L+ Y KRQVGN+++    S+LPLKLN +G
Sbjct: 218 SMSIISAIIIVVLIAAVTYLVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLPLKLNMSG 277

Query: 275 VVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYT 334
           V+P IFASS++LLPATI  ++   ++  W+  L  +L  G+  Y++LY++ IVFF FFYT
Sbjct: 278 VIPPIFASSIILLPATIANWVSSGANMRWLHDLASTLAPGQPVYVMLYALAIVFFCFFYT 337

Query: 335 AIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIA 394
           A+VFN KE ADNLKK G F+PGIRPG++TA +ID +LTR+T+ GA Y+V VC+ PE L+ 
Sbjct: 338 ALVFNSKETADNLKKSGAFVPGIRPGEQTARYIDKILTRLTLAGAVYIVFVCLLPEFLVL 397

Query: 395 VTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSKKKN 443
              VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+  K  N
Sbjct: 398 RWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLLKKANFKGGN 446


>gi|56460996|ref|YP_156277.1| preprotein translocase subunit SecY [Idiomarina loihiensis L2TR]
 gi|56180006|gb|AAV82728.1| Preprotein translocase subunit SecY [Idiomarina loihiensis L2TR]
          Length = 442

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/422 (49%), Positives = 293/422 (69%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + A+IV+R G+++P+P ID    ++ F+ +   I  +FNMFSGGA+ER +V
Sbjct: 17  ELKRRLLFVLGAIIVFRAGSFVPIPGIDAAVLAQLFEQQKDTIVAMFNMFSGGALERASV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL +   P L  LKKEGE GR+ INQYTR+ T++L   Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLASVVHPRLAELKKEGESGRRKINQYTRWGTLILATFQSIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V D  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF GIVAGL
Sbjct: 137 GLPNLMPGLVIDPGFGFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISILIFVGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G +   L+LLI    +AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLHLLLLLLIGVVVLAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSS--PTWIVGLVDSLGHGRSFY 318
              ++LPLK+N AGV+P IFASS++L P TI  +          ++  +  +L  G+  Y
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIATWFGSGEGMVADFLQQVSMTLSPGQPLY 316

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ G
Sbjct: 317 VLLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAG 376

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE ++    V     GTSLLIIV V++D + Q+Q ++++ QY+ V KK+ 
Sbjct: 377 ALYITFVCLVPEFMMIAWNVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYDSVLKKAN 436

Query: 439 SK 440
            K
Sbjct: 437 LK 438


>gi|153209778|ref|ZP_01947506.1| preprotein translocase, SecY subunit [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212218094|ref|YP_002304881.1| preprotein translocase subunit SecY [Coxiella burnetii CbuK_Q154]
 gi|120575255|gb|EAX31879.1| preprotein translocase, SecY subunit [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212012356|gb|ACJ19736.1| protein translocase subunit [Coxiella burnetii CbuK_Q154]
          Length = 442

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/416 (48%), Positives = 290/416 (69%), Gaps = 1/416 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F +I +IVYR G YIP+P +D    +  F     G  G+FNMFSGGA+ RM +
Sbjct: 17  ELKRRLLFVLIGIIVYRVGAYIPVPGLDPSRLAALFHQHETGFLGMFNMFSGGALSRMTI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LG+MPYIS+SIIVQ+ +   P ++ L+KEGE GR+ INQYTRY TV+L +LQ+  +  
Sbjct: 77  FALGVMPYISSSIIVQMYSQISPKMQALRKEGEAGRRKINQYTRYGTVILSLLQSAFMTK 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L +  G V + +  F F+ I+TL+ GTMFL+WLGEQ+T RG+GNG+SLIIF+ I +  P
Sbjct: 137 WLVS-SGTVINPNLGFYFTAIVTLVTGTMFLMWLGEQMTERGVGNGISLIIFASIASRFP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  V    R G +S  ++LL+ +  V V  +V+FFERAQRR+ I Y KRQ G +++  
Sbjct: 196 AAIGQVFTQVRQGQMSVLILLLLIAVIVLVTLVVVFFERAQRRITINYAKRQQGRKLYAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFA S++L P  +  F+       W+  +  +L +G+  Y+V+
Sbjct: 256 QSSHLPLKINMAGVIPVIFAQSIILFPGAVAKFMSSVKGLGWLNDVSLALSYGQPAYIVV 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++ ++FF+FFYTA+VFNPKE ADNLKK G FIPGIRPG++TA +ID V+TR+T+VG+ Y
Sbjct: 316 FAIAVIFFSFFYTALVFNPKETADNLKKSGAFIPGIRPGEQTANYIDKVMTRLTLVGSVY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           L  V + P+ LI    VP    GTSLLI+V V++D + Q+Q +L++ QYE + KKS
Sbjct: 376 LALVALLPQFLILAWNVPFYFGGTSLLIVVVVIMDFMAQVQAHLMSHQYESLMKKS 431


>gi|240017525|ref|ZP_04724065.1| preprotein translocase subunit SecY [Neisseria gonorrhoeae FA6140]
          Length = 416

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 286/408 (70%), Gaps = 2/408 (0%)

Query: 33  ALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISA 92
           ALIV+R G +IP+P +D ++ +K ++S   GI G+ NMFSGG++ER ++F++GIMPYISA
Sbjct: 6   ALIVFRIGAHIPVPGVDAVALAKLYESAGNGILGILNMFSGGSLERFSIFAIGIMPYISA 65

Query: 93  SIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSD 152
           SIIVQL +  +PSL+ LKKEGE GRKVI +YTRY TVLL ILQ+ G+A      QGIV  
Sbjct: 66  SIIVQLASEILPSLKALKKEGEAGRKVITKYTRYGTVLLAILQSLGVA-SFVFQQGIVVT 124

Query: 153 SDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGR 212
           S + F  ST+++L+ GTMFL+WLGEQIT RGIGNG+SLII +GI +G+PS +  ++ L  
Sbjct: 125 SSFEFHVSTVVSLVTGTMFLMWLGEQITERGIGNGISLIITAGIASGIPSGIAKLVTLTN 184

Query: 213 VGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNT 272
            GS+S    LLI    + +I LV++FE AQR++ I Y KRQ   R      +++P KLN 
Sbjct: 185 QGSMSMLTALLIVFGALLLIYLVVYFESAQRKIPIHYAKRQFNGRAGSQS-THMPFKLNM 243

Query: 273 AGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFF 332
           AGV+P IFASS++L P+T++G+   + + + +  +   L HG+  YM L++  ++FF +F
Sbjct: 244 AGVIPPIFASSIILFPSTLLGWFGSADTNSVLHKIAGLLQHGQLLYMALFAATVIFFCYF 303

Query: 333 YTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEAL 392
           YTA+VF+PKE A+NLKK G F+PGIRPG++T+ +++ V+ R+T+ GA Y+  +C+ PE L
Sbjct: 304 YTALVFSPKEMAENLKKSGAFVPGIRPGEQTSRYLEKVVLRLTLFGALYITTICLIPEFL 363

Query: 393 IAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
             V  VP  L GTSLLI+V V +D   QI  Y + QQY+ +  +S  K
Sbjct: 364 TTVLNVPFYLGGTSLLILVVVTMDFSTQINSYRLTQQYDKLMTRSEMK 411


>gi|39997929|ref|NP_953880.1| preprotein translocase subunit SecY [Geobacter sulfurreducens PCA]
 gi|39984874|gb|AAR36230.1| preprotein translocase, SecY subunit [Geobacter sulfurreducens PCA]
          Length = 435

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/432 (46%), Positives = 290/432 (67%), Gaps = 9/432 (2%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  R  +LK R++F++  L VYR G +IP P ID  + +  F      + GLF+MFSG
Sbjct: 5   FQNIFRIPELKKRVLFSLGMLAVYRVGCHIPTPGIDSNALAHFFAQARGTLLGLFDMFSG 64

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+E++ VF+LGIMPYIS+SII QL+   VPS+E L KEGE GRK I QYTRY T++L +
Sbjct: 65  GALEKLTVFALGIMPYISSSIIFQLLTVVVPSIEKLSKEGESGRKKIIQYTRYGTIVLSV 124

Query: 134 LQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           +QA GI++GL++     G+ +V +  + F   T+ITL  GT F++WLGEQ++ +GIGNG+
Sbjct: 125 VQALGISIGLESMRGPAGELVVPNPGWGFRLMTVITLTAGTAFIMWLGEQMSEKGIGNGI 184

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GIVA +P++L++   L + G +S  ++LL+ +    VIA +++ ER QRRL I 
Sbjct: 185 SLIIFAGIVARIPTALLNTGRLIKTGQLSLFVILLVVALMFLVIAAIVYVERGQRRLPIH 244

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KR VG + +    S+LPLK+N AGV+P IFASS+++ PAT+  FI+V     W+  + 
Sbjct: 245 YAKRVVGLKTYGGQTSHLPLKVNMAGVIPPIFASSIIMFPATVANFINVP----WVQTVA 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
            SL  G   Y + Y  FI+FF +FYTA+ FNP + A+N+KKHGG+IPGIRPG  T+ ++D
Sbjct: 301 KSLTPGNLAYEIFYVAFIIFFCYFYTAVSFNPVDVAENVKKHGGYIPGIRPGKETSDYLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            VLT++T  GA Y+  VC+ P  L+    +P    GT+LLI V V +DT  QI+ +LI +
Sbjct: 361 RVLTKLTFAGALYISAVCVLPSVLVGKFNLPFYFGGTALLIAVGVGMDTAAQIESHLITR 420

Query: 429 QYEGVFKKSRSK 440
            YEG  K  R +
Sbjct: 421 SYEGFMKGVRVR 432


>gi|212213230|ref|YP_002304166.1| preprotein translocase subunit SecY [Coxiella burnetii CbuG_Q212]
 gi|212011640|gb|ACJ19021.1| protein translocase subunit [Coxiella burnetii CbuG_Q212]
          Length = 442

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 290/416 (69%), Gaps = 1/416 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+ R++F +I +IVYR G YIP+P +D    +  F     G  G+FNMFSGGA+ RM +
Sbjct: 17  ELRRRLLFVLIGIIVYRLGAYIPVPGLDPSRLAALFHQHETGFLGMFNMFSGGALSRMTI 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LG+MPYIS+SIIVQ+ +   P ++ L+KEGE GR+ INQYTRY TV+L +LQ+  +  
Sbjct: 77  FALGVMPYISSSIIVQMYSQISPKMQALRKEGEAGRRKINQYTRYGTVILSLLQSAFMTK 136

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L +  G V + +  F F+ I+TL+ GTMFL+WLGEQ+T RG+GNG+SLIIF+ I +  P
Sbjct: 137 WLVS-SGTVINPNLGFYFTAIVTLVTGTMFLMWLGEQMTERGVGNGISLIIFASIASRFP 195

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  V    R G +S  ++LL+ +  V V  +V+FFERAQRR+ I Y KRQ G +++  
Sbjct: 196 AAIGQVFTQVRQGQMSVLILLLLIAVIVLVTLVVVFFERAQRRITINYAKRQQGRKLYAA 255

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMVL 321
             S+LPLK+N AGV+P IFA S++L P  +  F+       W+  +  +L +G+  Y+V+
Sbjct: 256 QSSHLPLKINMAGVIPVIFAQSIILFPGAVAKFMSSVKGLGWLNDVSLALSYGQPAYIVV 315

Query: 322 YSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGY 381
           +++ ++FF+FFYTA+VFNPKE ADNLKK G FIPGIRPG++TA +ID V+TR+T+VG+ Y
Sbjct: 316 FAIAVIFFSFFYTALVFNPKETADNLKKSGAFIPGIRPGEQTANYIDKVMTRLTLVGSVY 375

Query: 382 LVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           L  V + P+ LI    VP    GTSLLI+V V++D + Q+Q +L++ QYE + KKS
Sbjct: 376 LALVALLPQFLILAWNVPFYFGGTSLLIVVVVIMDFMAQVQAHLMSHQYESLMKKS 431


>gi|85858167|ref|YP_460369.1| preprotein translocase subunit SecY [Syntrophus aciditrophicus SB]
 gi|85721258|gb|ABC76201.1| protein translocase subunit [Syntrophus aciditrophicus SB]
          Length = 435

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/433 (46%), Positives = 293/433 (67%), Gaps = 9/433 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           + ++  +L+ RI+++++ L VYR G +IP P ID  +    F+     + GLF+MF+GGA
Sbjct: 7   NINKIPELQKRILYSLLMLGVYRVGAHIPTPGIDTAALMAYFEQAKGSLLGLFDMFAGGA 66

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           +  ++VF+LGIMPYISASII+QL+   VP LE L KEGE GR+ I QYTRY T++L I+Q
Sbjct: 67  LSNLSVFALGIMPYISASIILQLLTVAVPHLERLSKEGEAGRRKITQYTRYGTIVLSIIQ 126

Query: 136 AYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
            +GI+VGL+N     G  IV    + F   T++TL  GT FL+WLGEQIT +GIGNG+SL
Sbjct: 127 GFGISVGLENMAGPTGVSIVMQPGWGFRLMTVLTLTAGTAFLMWLGEQITEKGIGNGISL 186

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           IIF+GIV   P ++++   L   G +   L++++ +  + VI +++F E  QRR+ +QY 
Sbjct: 187 IIFAGIVCRGPEAIINTFRLLSTGEMGFFLIIILIAMMITVIGVIVFVESGQRRIPVQYA 246

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS 310
           KR VG +++    ++LPLK+NTAGV+P IFASS+++ PATI  F+       W+  + D+
Sbjct: 247 KRVVGRKVYGGQSTHLPLKVNTAGVIPPIFASSIIMFPATIANFVP----HPWMKVVADA 302

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  GR  Y VLY  FIVFF +FYTA+ FNP + A+N++K+GG++PGIRPG +TA +ID V
Sbjct: 303 LVPGRIGYEVLYVGFIVFFCYFYTAVTFNPNDVAENMRKYGGYVPGIRPGKKTAEYIDDV 362

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LTR+T  GA Y+  VC+ P  LIA   VP    GT+LLI+V V LDT  Q++ +L+ +QY
Sbjct: 363 LTRLTFSGAIYVSAVCVLPSILIAYFNVPFYFGGTALLIVVGVALDTAGQLETHLLTRQY 422

Query: 431 EGVFKKSRSKKKN 443
           EG  KK +  ++ 
Sbjct: 423 EGFLKKGKIARRR 435


>gi|197117343|ref|YP_002137770.1| preprotein translocase subunit SecY [Geobacter bemidjiensis Bem]
 gi|197086703|gb|ACH37974.1| preprotein translocase, SecY subunit [Geobacter bemidjiensis Bem]
          Length = 435

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 202/435 (46%), Positives = 292/435 (67%), Gaps = 9/435 (2%)

Query: 14  FASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSG 73
           F +  +  +LK +++F++  L VYR G +IP P ID  + ++ F++    + G+F+MFSG
Sbjct: 5   FQNIFKIPELKKKVLFSLAMLAVYRIGCHIPTPGIDAQALAQFFKAAQGTLLGMFDMFSG 64

Query: 74  GAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGI 133
           GA+E++ VF+LGIMPYIS+SII QL+   +P++E L KEG+ GRK I QYTRY T++L +
Sbjct: 65  GALEKLTVFALGIMPYISSSIIFQLLTVVLPAVEKLSKEGDAGRKKIIQYTRYGTIVLAV 124

Query: 134 LQAYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGV 188
           +QA+GI++GL+      G+ +V +  + F   T+ITL  GT F++WLGEQ++ +GIGNG+
Sbjct: 125 VQAFGISIGLEAMRGPAGELVVPNPGWGFRLMTVITLTAGTAFIMWLGEQMSEKGIGNGI 184

Query: 189 SLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQ 248
           SLIIF+GIVA +P+++ +   L + G +S  ++LLI +   AVIA V+F ER QRR+ I 
Sbjct: 185 SLIIFAGIVARIPTAIGNSFRLIKTGELSLFVLLLIAAVMFAVIAAVVFMERGQRRIPIH 244

Query: 249 YPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLV 308
           Y KR VG +      S+LPLK+N AGV+P IFASS+++ PAT+  FIDV     W+    
Sbjct: 245 YAKRVVGLKTVGAQSSHLPLKVNMAGVIPPIFASSIIMFPATVGNFIDVP----WVQAAS 300

Query: 309 DSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHID 368
             L  G+  Y VL+  FIVFF +FYTA+ FNP + ADN+KK GG++PGIRPG  T+  +D
Sbjct: 301 KQLAPGKLLYEVLFVAFIVFFCYFYTAVTFNPVDVADNVKKQGGYVPGIRPGKETSDFLD 360

Query: 369 YVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQ 428
            VLT++T  GA Y+  VC+ P  LI    +P    GTSLLI V V +DT+ QI+ +LI +
Sbjct: 361 AVLTKLTFAGAIYISAVCVLPSILIGKFNLPFYFGGTSLLIAVGVGMDTLSQIEAHLITR 420

Query: 429 QYEGVFKKSRSKKKN 443
            YEG  K  R + + 
Sbjct: 421 SYEGFMKGVRIQGRR 435


>gi|302036685|ref|YP_003797007.1| preprotein translocase, membrane subunit SecY [Candidatus
           Nitrospira defluvii]
 gi|300604749|emb|CBK41081.1| Preprotein translocase, membrane subunit SecY [Candidatus
           Nitrospira defluvii]
          Length = 437

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/434 (46%), Positives = 292/434 (67%), Gaps = 6/434 (1%)

Query: 13  NFASFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFS 72
           +F +  +  +L++R++FT+  LIVYR G +IP P I+  + S   Q +   + G  ++FS
Sbjct: 8   SFQNIFKIPELRTRVLFTLGMLIVYRVGAHIPTPGINGEALSDFLQKQGGALLGFLDIFS 67

Query: 73  GGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLG 132
           GG++ R+ +F+LGIMPYISASII+QL+   +P L  L KEGE+GRK I QYTR+ T+++ 
Sbjct: 68  GGSLSRLTIFALGIMPYISASIILQLLTVVIPHLSKLAKEGERGRKKIIQYTRFGTIVIA 127

Query: 133 ILQAYGIAVGLK--NGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
           ++Q +GIAVGL+  N    V    + F F T+ITL  GT FL+WLGEQIT RGIGNG+SL
Sbjct: 128 LIQGFGIAVGLEQMNQGAFVLSPGWGFRFMTVITLCAGTGFLMWLGEQITERGIGNGISL 187

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           IIF+GIVA LP+++    +L +VG +S PL++++      V+A ++F E  +R++ +QY 
Sbjct: 188 IIFAGIVARLPAAVAQTFDLYKVGQLSFPLLVVLTLIMFGVVAAIVFLESGRRKVPVQYA 247

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS 310
           KR +G R++    +++PLK+NTAGV+P IFASS++  PATI GF +      WI  +   
Sbjct: 248 KRVIGRRVYGGQSTHIPLKINTAGVIPPIFASSIIAFPATIAGFFETP----WIKAVGSQ 303

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
           L  G   Y ++Y   IVFF FFYTA+V NP + ADNLKK+GGF+PGIRPG RT+ +I  V
Sbjct: 304 LAPGSLLYTLMYVGLIVFFCFFYTAVVMNPVDMADNLKKYGGFVPGIRPGQRTSDYIYSV 363

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LT++T  GA YL  VC+ PE LI    +P    GTSLLI++ V LDT  QI+ +L+ + Y
Sbjct: 364 LTKITFAGAIYLAIVCVIPEFLIYKLNMPFYFGGTSLLIVIGVGLDTAQQIESHLLNRNY 423

Query: 431 EGVFKKSRSKKKNS 444
           +G  +K + + + +
Sbjct: 424 DGFLQKGKLRGRTT 437


>gi|226942798|ref|YP_002797871.1| Sec-dependent preprotein translocase, SecY subunit [Azotobacter
           vinelandii DJ]
 gi|226717725|gb|ACO76896.1| Sec-dependent preprotein translocase, SecY subunit [Azotobacter
           vinelandii DJ]
          Length = 395

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/387 (50%), Positives = 276/387 (71%), Gaps = 1/387 (0%)

Query: 54  SKAFQSKSAGIFGLFNMFSGGAVERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEG 113
           ++ FQ     I  LFNMFSGGA+ERM++F+LGIMPYISASII+QL+    P LE LKKEG
Sbjct: 2   AELFQQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTVVSPQLEQLKKEG 61

Query: 114 EQGRKVINQYTRYATVLLGILQAYGIAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLV 173
           E GR+ I+QYTRY T++L I+QA+G++VGL + QG+   +D+ F F  + T + G MF++
Sbjct: 62  EAGRRKISQYTRYGTLVLAIVQAFGMSVGLAS-QGVAFAADFGFYFVAVSTFVAGAMFMM 120

Query: 174 WLGEQITMRGIGNGVSLIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIA 233
           WLGEQIT RG+GNG+S++IF+GIVAGLP+++    E  R G I+   +L +    VA+I 
Sbjct: 121 WLGEQITERGVGNGISMLIFAGIVAGLPAAIGQSFESARQGDINIIALLAVALLAVAIIG 180

Query: 234 LVIFFERAQRRLLIQYPKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMG 293
            V+F ER QRR+ + Y KRQ G ++F    S+LPLK+N AGV+P+IFASS+LL PA++  
Sbjct: 181 FVVFVERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLFPASLGS 240

Query: 294 FIDVSSSPTWIVGLVDSLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGF 353
           +   S    W+  +  ++  G+   ++L+S  I+FF FFYTA++FNPK+ A+NLKK G F
Sbjct: 241 WFGQSEGMGWLQDIAQAIAPGQPLNIILFSAGIIFFCFFYTALMFNPKDVAENLKKSGAF 300

Query: 354 IPGIRPGDRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSV 413
           IPGIRPG+++A +ID VLTR+T+ GA Y+  VC+ P+ L+    VP  L GTSLLI+V V
Sbjct: 301 IPGIRPGEQSARYIDGVLTRLTIFGALYMTAVCLLPQFLVVAANVPFYLGGTSLLIVVVV 360

Query: 414 VLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           V+D + Q+Q +L++ QYE + KKS  K
Sbjct: 361 VMDFMSQVQSHLVSHQYESLMKKSNLK 387


>gi|325577147|ref|ZP_08147631.1| preprotein translocase subunit SecY [Haemophilus parainfluenzae
           ATCC 33392]
 gi|301155350|emb|CBW14816.1| preprotein translocase membrane subunit [Haemophilus parainfluenzae
           T3T1]
 gi|325160729|gb|EGC72850.1| preprotein translocase subunit SecY [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 441

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/420 (46%), Positives = 290/420 (69%), Gaps = 1/420 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LKSR++F + ALIVYR G++IPLP ID    ++  + +   I  + NMFSGGA+ R ++
Sbjct: 18  ELKSRLLFVLGALIVYRIGSFIPLPGIDAAVLAQLVEQQKGTIIDMLNMFSGGALSRASI 77

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
            +LGIMPYISASI++QL+A   P+L  LKKEG  G++ I +YTRYATV+   +QA  I+ 
Sbjct: 78  LALGIMPYISASIVMQLLATVSPALAELKKEGAAGQRKITKYTRYATVVFATIQAIAIST 137

Query: 142 GLKNG-QGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N    +V +  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S+++F GIVAGL
Sbjct: 138 GLPNMLPQLVPNIGFTFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISILVFGGIVAGL 197

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           P +++  +E  R G +   ++LLI +   AV   V+F ER QRR+ ++Y KRQ G ++  
Sbjct: 198 PHAIIETVEQARQGQMHPLVLLLIAAIVFAVTYFVVFVERGQRRIRVEYAKRQQGRQILG 257

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDSLGHGRSFYMV 320
              ++LPLK+N A V+P+IFASS++L PAT+  +   +    W+  L   L  G+  Y++
Sbjct: 258 GHSTHLPLKVNMANVMPAIFASSIILFPATLTQWFGQNDKFEWLNDLSMLLNPGQPLYLL 317

Query: 321 LYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAG 380
           +Y+V I+FF+FFYTA+ +NP++ ADNLKK G FIPGIRPG++T+ +ID V+TR+T++G  
Sbjct: 318 VYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLIGGL 377

Query: 381 YLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSRSK 440
           Y+  VC+ P  + +   V     GTSLLI+V V++D IVQ+Q +L++ QYE   KK+  K
Sbjct: 378 YVTFVCLVPYIMTSAWDVKFYFGGTSLLIVVVVIMDFIVQVQSHLMSSQYESALKKANLK 437


>gi|242278678|ref|YP_002990807.1| preprotein translocase, SecY subunit [Desulfovibrio salexigens DSM
           2638]
 gi|242121572|gb|ACS79268.1| preprotein translocase, SecY subunit [Desulfovibrio salexigens DSM
           2638]
          Length = 436

 Score =  401 bits (1031), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/431 (46%), Positives = 296/431 (68%), Gaps = 9/431 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           + SR  +LK ++ +T + L VYR G +IP+P +D  + +  F+S S  +FGLF+MFSGG 
Sbjct: 8   NLSRLPELKKKLFWTFLLLAVYRIGIHIPVPGVDSSALADFFESVSNTLFGLFDMFSGGG 67

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           +  +++F+LGIMPYISASIIVQL+    P+++ L++EG QGRK I QYTRY TVL+ ++Q
Sbjct: 68  LRNLSIFALGIMPYISASIIVQLLGVVSPTIKRLQEEGAQGRKKITQYTRYGTVLITLVQ 127

Query: 136 AYGIAVGLKN-----GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSL 190
            +GIAVGL++     G  +V  + + F   TI+TL  GT+FL+WLGEQ+T +GIGNG+S+
Sbjct: 128 GFGIAVGLESMTSPTGAPVVLHAGWAFRGITILTLTAGTVFLMWLGEQMTEKGIGNGISM 187

Query: 191 IIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYP 250
           IIF+GIVAGLPS++ + + L + G I+  L+L + +  VA++A +++ ER QRR+ I Y 
Sbjct: 188 IIFAGIVAGLPSAIFNTVRLMQAGEITLFLLLFVMAFMVAILAFIVYMERGQRRIPIHYA 247

Query: 251 KRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVDS 310
           KR +G +M     ++LPL++NTAGV+P IFASS+L+ PAT+  F    S+   +      
Sbjct: 248 KRMMGRKMMGGQTTHLPLRINTAGVIPPIFASSILMFPATLASF----SNNEILSKFSAY 303

Query: 311 LGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYV 370
                  Y V+Y   I+FF +FYTAI+F+PK  A+N++K GGFIPGIRPG+RT  +ID V
Sbjct: 304 FAPSSIVYNVVYIALIIFFCYFYTAIMFDPKGIAENIQKQGGFIPGIRPGNRTREYIDRV 363

Query: 371 LTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQY 430
           LTR+T+ G+ Y+  +C+ P  LIA   VP    GT+LLI+V V +D + +I+ Y+I++QY
Sbjct: 364 LTRITLWGSLYVAAICVLPMILIAQFNVPFYFGGTALLIVVGVAMDFMGKIESYMISRQY 423

Query: 431 EGVFKKSRSKK 441
           EG+  K    K
Sbjct: 424 EGLMGKGSKVK 434


>gi|262373501|ref|ZP_06066779.1| preprotein translocase, SecY subunit [Acinetobacter junii SH205]
 gi|262311254|gb|EEY92340.1| preprotein translocase, SecY subunit [Acinetobacter junii SH205]
          Length = 452

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/418 (46%), Positives = 293/418 (70%), Gaps = 6/418 (1%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           + +++  R++F I AL+V+R G +IPLP ID ++ ++ F++      GLFNMFSGGA+ER
Sbjct: 22  KYREIIRRLMFLIGALLVFRLGAHIPLPGIDNVALARFFKANEGTFLGLFNMFSGGALER 81

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           M++ +LGIMPYISASIIVQL++  +PSLE LKKEGEQG++ INQYTRY T+ L ++Q  G
Sbjct: 82  MSILALGIMPYISASIIVQLMSTVIPSLEALKKEGEQGKRKINQYTRYGTLFLALVQGVG 141

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           +  GL + QGI   S   F    + +L+ GTMFL+WLGEQIT RG+GNG+S+IIF+GIVA
Sbjct: 142 MCAGLIS-QGITLTSGLAFYVPAVTSLVAGTMFLMWLGEQITERGVGNGISMIIFAGIVA 200

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
           GLP+ ++      + G  S   + +    ++AV+A ++F E+AQRR+ + Y ++Q G R+
Sbjct: 201 GLPNLVIQSFTTVQNGQGSLIGLAVFGLLSLAVLAAIVFIEKAQRRIPVNYAQKQQGRRV 260

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV-----GLVDSLGH 313
           F    ++LPLK+N AGV+P+IFASSLLL PA++  ++  +     I+      L   L  
Sbjct: 261 FTAQQTHLPLKINMAGVIPAIFASSLLLFPASLGQWLGSADPNAGIIKRSLQDLALVLSP 320

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G+  Y++L+   I+FF +FYTA+VF+PKE ++NLK+ G ++PGIRPG++TA ++D++L R
Sbjct: 321 GQPLYLMLFGALIIFFCYFYTALVFSPKEVSENLKRSGAYVPGIRPGEQTARYLDHILNR 380

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYE 431
           +T +GA Y+  VC+ P  L +  G+P  L GTSLLI+V VV+D + Q+Q +L + QY+
Sbjct: 381 LTFIGAIYITVVCLMPMVLQSSFGIPFHLGGTSLLIVVVVVMDFMAQLQAHLTSHQYD 438


>gi|328953138|ref|YP_004370472.1| preprotein translocase, SecY subunit [Desulfobacca acetoxidans DSM
           11109]
 gi|328453462|gb|AEB09291.1| preprotein translocase, SecY subunit [Desulfobacca acetoxidans DSM
           11109]
          Length = 437

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/427 (46%), Positives = 293/427 (68%), Gaps = 10/427 (2%)

Query: 16  SFSRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGA 75
           + ++  +LK RI+ T++ L VYR G +IP P ID  +    F      IFGLF+MFSGGA
Sbjct: 7   NIAKIPELKRRIIVTLLLLAVYRIGCHIPTPGIDADALMSFFARHRGTIFGLFDMFSGGA 66

Query: 76  VERMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQ 135
           +ER++VF+LGIMPYISASII++L+   +P+L+ L KEGE G+K I QYTRY TV+L  +Q
Sbjct: 67  LERLSVFALGIMPYISASIIMELMKVVIPALDKLYKEGEAGQKKIKQYTRYGTVILSAIQ 126

Query: 136 AYGIAVGLKN------GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVS 189
             GI++GL+       G  +V    + F   T++TL  GT F++WLGEQIT RGIGNG+S
Sbjct: 127 GLGISMGLEGMGMESGGVPVVLHPGWAFRLMTVLTLTSGTAFIMWLGEQITERGIGNGIS 186

Query: 190 LIIFSGIVAGLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQY 249
           LIIF+GIVA +PS++++ ++L + G I   L+ LI    +AV+  ++F ER QRR+ +QY
Sbjct: 187 LIIFAGIVARMPSAIINTMQLVKTGEIGIILIFLIMILMIAVVGFIVFMERGQRRIPVQY 246

Query: 250 PKRQVGNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIVGLVD 309
            +R VG RM+    ++LPLK+N+AGV+P IFASS+L+ PATI  FI+V     W+    +
Sbjct: 247 ARRVVGRRMYGGQTTHLPLKVNSAGVIPPIFASSILMFPATIATFINVD----WVRRATE 302

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
            +  G   + +LY +FI+FF +FYTA+ FNP + A+N+KK+GG+IPG+RPG  T+ +I+ 
Sbjct: 303 LISPGALIHEILYVIFIIFFCYFYTAVTFNPVDVAENMKKYGGYIPGLRPGKPTSDYIER 362

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           +L+R+T+ GA Y+  VC+ P  L+    VP    GT+LLI+V V +DT+ QI+ +++ + 
Sbjct: 363 ILSRITLGGALYVSFVCVMPTVLVQRFNVPFYFGGTALLIVVGVAMDTVGQIESHMLTRH 422

Query: 430 YEGVFKK 436
           YEG  KK
Sbjct: 423 YEGFMKK 429


>gi|171462899|ref|YP_001797012.1| preprotein translocase, SecY subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171192437|gb|ACB43398.1| preprotein translocase, SecY subunit [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 445

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 221/424 (52%), Positives = 300/424 (70%), Gaps = 6/424 (1%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +L+ R+VF ++AL+V+R G +IP+  ID    ++ F  +  GI G+FN+FSGGA+ R  V
Sbjct: 20  ELRQRLVFLVLALLVFRLGAHIPVSGIDPDQLAQLFSGQKDGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +PSLE+LKKEG+ G++ I QYTRY T++L   QA GI+V
Sbjct: 80  FALGIMPYISASIIIQLMTIVIPSLESLKKEGQAGQRKIAQYTRYGTMVLATFQALGISV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V +    F  +T++TL+ GTMFL+WLGEQIT RG+GNG+S+IIF GIV+GLP
Sbjct: 140 ALQAQPGLVVNPGLMFELNTVVTLVTGTMFLMWLGEQITERGLGNGISIIIFGGIVSGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           ++L S+LEL R GS++    LLI    VAV   V+F ER QRR+L+ Y KRQVGN+++  
Sbjct: 200 NALASLLELVRTGSMNIVSALLIVVICVAVTYFVVFVERGQRRILVNYAKRQVGNKIYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT-----WIVGLVDSLGHGRS 316
             SY PLKLN AGV+P IFASS++L PATI G+   S  PT      I  L  +L  G+ 
Sbjct: 260 QSSYFPLKLNMAGVIPPIFASSIILFPATIAGWF-TSGEPTNMFSRIIKDLAATLAPGQP 318

Query: 317 FYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTV 376
            Y +LY+  I+FF FFYTA+VFN +E A+NLKK G F+PGIRPGD+TA +ID +L R+T+
Sbjct: 319 VYTILYAAAIIFFCFFYTALVFNSRETAENLKKSGAFVPGIRPGDQTARYIDKILVRLTL 378

Query: 377 VGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKK 436
            G+ Y+V VC+ PE L+    VP    GTSLLIIV +V+D I Q+Q +++ QQY  + KK
Sbjct: 379 AGSIYMVLVCLLPEFLVLKYNVPFYFGGTSLLIIVVIVMDFIAQVQSFVMQQQYGSLMKK 438

Query: 437 SRSK 440
           +  K
Sbjct: 439 ANFK 442


>gi|85713162|ref|ZP_01044194.1| Preprotein translocase subunit SecY [Idiomarina baltica OS145]
 gi|85693032|gb|EAQ30998.1| Preprotein translocase subunit SecY [Idiomarina baltica OS145]
          Length = 442

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/422 (49%), Positives = 291/422 (68%), Gaps = 3/422 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           +LK R++F + A+IV+R G+++P+P ID    ++ F  +   I  +FNMFSGGA+ER +V
Sbjct: 17  ELKRRLLFVLGAIIVFRAGSFVPIPGIDAAVLAQLFSQQKDTIVAMFNMFSGGALERASV 76

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL     P L  LKKEGE GR+ I+QYTR+ T++L   Q+ GIA 
Sbjct: 77  FALGIMPYISASIIMQLATVVHPRLAELKKEGEAGRRKISQYTRWGTLILATFQSIGIAT 136

Query: 142 GLKN-GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL 200
           GL N   G+V D  + F F+ +++L+ GTMFL+WLGEQIT RGIGNG+S++IF GIVAGL
Sbjct: 137 GLPNLMPGLVIDPGFQFYFTAVVSLVTGTMFLMWLGEQITERGIGNGISILIFVGIVAGL 196

Query: 201 PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQ 260
           PS++    E  R G ++  L+LLI    +AV   V+F ER QRR+++ Y KRQ G ++F 
Sbjct: 197 PSAIGQTAEQARQGDLNILLLLLIGVIVLAVTYFVVFVERGQRRIVVNYAKRQQGRKVFA 256

Query: 261 DDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV--GLVDSLGHGRSFY 318
              ++LPLK+N AGV+P IFASS++L P TI  +          V   +  +L  G+  Y
Sbjct: 257 AQSTHLPLKVNMAGVIPPIFASSIILFPGTIATWFGSGDGVVADVLQQISMTLSPGQPLY 316

Query: 319 MVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVG 378
           ++LY+  I+FF FFYTA+VFNP+E ADNLKK G FIPGIRPG++T+ +ID V+TR+T+ G
Sbjct: 317 VLLYAAAIIFFCFFYTALVFNPRETADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLAG 376

Query: 379 AGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKSR 438
           A Y+  VC+ PE ++    V     GTSLLIIV V++D + Q+Q ++++ QY+ V KK+ 
Sbjct: 377 ALYITFVCLVPEFMMIAWNVQFYFGGTSLLIIVVVIMDFMAQVQTHMMSHQYDSVLKKAN 436

Query: 439 SK 440
            K
Sbjct: 437 LK 438


>gi|83748169|ref|ZP_00945196.1| Protein translocase subunit secY [Ralstonia solanacearum UW551]
 gi|207744556|ref|YP_002260948.1| preprotein translocase secy (membrane subunit) [Ralstonia
           solanacearum IPO1609]
 gi|83725137|gb|EAP72288.1| Protein translocase subunit secY [Ralstonia solanacearum UW551]
 gi|206595962|emb|CAQ62889.1| preprotein translocase secy (membrane subunit) [Ralstonia
           solanacearum IPO1609]
          Length = 448

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 218/423 (51%), Positives = 299/423 (70%), Gaps = 4/423 (0%)

Query: 22  DLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAV 81
           DL+ R+VF ++AL+VYR G +IP+P ID    ++ FQ +S GI G+FN+FSGGA+ R  V
Sbjct: 20  DLRRRLVFLVLALLVYRIGAHIPVPGIDPDQLAQLFQRQSGGILGMFNLFSGGALSRFTV 79

Query: 82  FSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAV 141
           F+LGIMPYISASII+QL+   +P LE+LKKEG+ G++ I QYTRY TV+L   QA GIAV
Sbjct: 80  FALGIMPYISASIIMQLLTIVLPQLESLKKEGQAGQRKITQYTRYGTVVLATFQALGIAV 139

Query: 142 GLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLP 201
            L+   G+V D    F  + +ITL+ GTMFL+WLGEQIT RG+GNG+S+IIF GI AGLP
Sbjct: 140 ALEAQPGLVLDPGLMFRATAVITLVTGTMFLMWLGEQITERGLGNGISIIIFGGIAAGLP 199

Query: 202 SSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQD 261
           +++  + EL R GS+     +L+ +   AV  +V+F ER QR++L+ Y KRQVGN+++  
Sbjct: 200 NAIGGLFELVRTGSMGIFSAILVVAIIGAVTFVVVFIERGQRKILVNYAKRQVGNKIYGG 259

Query: 262 DVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPT----WIVGLVDSLGHGRSF 317
             S+LPLKLN AGV+P IFASS++L PATI G+    +S      ++  L  +L  G+  
Sbjct: 260 QSSHLPLKLNMAGVIPPIFASSIILFPATIAGWFTAGNSTNPVTRFVKDLAATLSPGQPV 319

Query: 318 YMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVV 377
           Y++LY+  I+FF FFYTA+V+N +E ADNLKK G FIPGIRPG++T  +ID +L R+T+ 
Sbjct: 320 YILLYAAAIIFFCFFYTALVYNSREVADNLKKSGAFIPGIRPGEQTTRYIDKILVRLTLA 379

Query: 378 GAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVFKKS 437
           GA Y+  VC+ PE L+    VP    GTSLLIIV V +D + Q+Q Y+++QQYE + KK+
Sbjct: 380 GAIYITLVCLLPEFLVLRWNVPFYFGGTSLLIIVVVTMDFMAQVQSYVMSQQYESLMKKA 439

Query: 438 RSK 440
             K
Sbjct: 440 NFK 442


>gi|50086195|ref|YP_047705.1| preprotein translocase subunit SecY [Acinetobacter sp. ADP1]
 gi|49532171|emb|CAG69883.1| secretion protein [Acinetobacter sp. ADP1]
          Length = 452

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/431 (46%), Positives = 300/431 (69%), Gaps = 8/431 (1%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           + +++  R++F I AL+V+R G +IPLP ID ++ ++ F++      GLFNMFSGGA+ER
Sbjct: 22  KYREIIRRLMFLIGALLVFRLGAHIPLPGIDNVALARFFKANEGTFLGLFNMFSGGALER 81

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           M++ +LGIMPYISASIIVQL++  VPSLE LKKEGEQG++ INQYTRY T+LL ++Q  G
Sbjct: 82  MSILALGIMPYISASIIVQLMSTVVPSLEALKKEGEQGKRKINQYTRYGTLLLALVQGVG 141

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           +  GL + QGI   S   F    + +L+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIVA
Sbjct: 142 MCAGLIS-QGITLTSGLAFYIPAVTSLVAGTMFLMWLGEQITERGIGNGISMIIFAGIVA 200

Query: 199 GLPSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRM 258
           GLP+ ++      + G  S   +++    ++AV+A ++F E+AQRR+ + Y ++Q G R+
Sbjct: 201 GLPNQVIQAFTSVQNGQGSLIGIVVFALLSLAVLAAIVFIEKAQRRIPVNYAQKQQGRRI 260

Query: 259 FQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV-----GLVDSLGH 313
           F    ++LPLK+N AGV+P+IFASSLLL PA++  ++  +     IV      L   L  
Sbjct: 261 FTAQQTHLPLKINMAGVIPAIFASSLLLFPASLGQWLGSADPNAGIVKRSLQDLALVLSP 320

Query: 314 GRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTR 373
           G+  Y++L+   I+FF +FYTA+VF+PKE ++NLK+ G ++PGIRPG++TA ++D++L R
Sbjct: 321 GQPLYLMLFGTLIIFFCYFYTALVFSPKEVSENLKRSGAYVPGIRPGEQTARYLDHILNR 380

Query: 374 VTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEG- 432
           +T +GA Y+  VC+ P  L    G+P  L GTSLLI+V VV+D + Q+Q +L + QY+  
Sbjct: 381 LTFIGAIYITVVCLMPMILQNSFGIPFHLGGTSLLIVVVVVMDFMAQLQAHLTSHQYDNQ 440

Query: 433 -VFKKSRSKKK 442
            + +K+ +  K
Sbjct: 441 SLMRKTTAHPK 451


>gi|262280205|ref|ZP_06057989.1| secretion protein [Acinetobacter calcoaceticus RUH2202]
 gi|262257983|gb|EEY76717.1| secretion protein [Acinetobacter calcoaceticus RUH2202]
          Length = 452

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/435 (46%), Positives = 302/435 (69%), Gaps = 16/435 (3%)

Query: 19  RAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVER 78
           + +++  R+ F I AL+V+R G +IP+P I+  +    FQ+    I GLFNMFSGGA+ER
Sbjct: 22  KYREIIRRMSFLIGALLVFRLGAHIPVPGINNAALENLFQANQGTILGLFNMFSGGALER 81

Query: 79  MAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYG 138
           M++ +LGIMPYISASIIVQL++  +PSLE LKKEGEQG++ INQYTR  T+LL ++QA G
Sbjct: 82  MSILALGIMPYISASIIVQLMSTVIPSLEALKKEGEQGKRKINQYTRQGTLLLAVVQAVG 141

Query: 139 IAVGLKNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVA 198
           +  GL  GQGI       F    + +L+ GTMFL+WLGEQIT RGIGNG+S+IIF+GIV+
Sbjct: 142 MCAGLI-GQGITLSVGLEFYIPAVTSLVAGTMFLMWLGEQITERGIGNGISMIIFAGIVS 200

Query: 199 GLPSSL---VSVLELGRVGSISTPLMLLIFS-STVAVIALVIFFERAQRRLLIQYPKRQV 254
           GLP+ +   VS ++ G+   I     L+IF   ++ V+A ++F E+AQRR+ + Y ++Q 
Sbjct: 201 GLPNLIMQSVSSVDNGQTSLIG----LVIFGLLSLGVLAAIVFIEKAQRRIPVNYAQKQQ 256

Query: 255 GNRMFQDDVSYLPLKLNTAGVVPSIFASSLLLLPATIMGFIDVSSSPTWIV-----GLVD 309
           G R+F    ++LPLK+N AGV+P+IFASSLLL PA++  ++  + +   ++      L  
Sbjct: 257 GRRIFTAQQTHLPLKINMAGVIPAIFASSLLLFPASLGQWVGSADANAGLIKRSLQDLAL 316

Query: 310 SLGHGRSFYMVLYSVFIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDY 369
            L  G+  Y+VL+   I+FF +FYTA+VF+PKE ++NLK+ G ++PGIRPG++TA ++D+
Sbjct: 317 VLSPGQPLYLVLFGALIIFFCYFYTALVFSPKEVSENLKRSGAYVPGIRPGEQTARYLDH 376

Query: 370 VLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVLDTIVQIQGYLIAQQ 429
           +L R+T +GA Y+  +C+ P  L +  G+P SL GTSLLI+V VV+D + Q+Q +L + Q
Sbjct: 377 ILNRLTFIGAIYITVICLMPMILQSSFGIPFSLGGTSLLIVVVVVMDFMAQLQAHLTSHQ 436

Query: 430 YEG--VFKKSRSKKK 442
           Y+   + +K+ +  K
Sbjct: 437 YDNQTLMRKTTAHPK 451


>gi|241664512|ref|YP_002982872.1| preprotein translocase subunit SecY [Ralstonia pickettii 12D]
 gi|309782854|ref|ZP_07677574.1| preprotein translocase, SecY subunit [Ralstonia sp. 5_7_47FAA]
 gi|240866539|gb|ACS64200.1| preprotein translocase, SecY subunit [Ralstonia pickettii 12D]
 gi|308918278|gb|EFP63955.1| preprotein translocase, SecY subunit [Ralstonia sp. 5_7_47FAA]
          Length = 440

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 218/427 (51%), Positives = 301/427 (70%), Gaps = 4/427 (0%)

Query: 18  SRAKDLKSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVE 77
           ++  DL+ R+VF ++AL+VYR G +IP+P ID    ++ FQ +S GI G+FN+FSGGA+ 
Sbjct: 8   AKYGDLRRRLVFLVLALLVYRIGAHIPVPGIDPDQLAQLFQRQSGGILGMFNLFSGGALS 67

Query: 78  RMAVFSLGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVIN