PSIBLAST alignment of GI: 254780241 and protein with PDB id: 2yxr

>gi|157836739|pdb|2YXR|A Chain A, The Plug Domain Of The Secy Protein Stablizes The Closed State Of The Translocation Channel And Maintains A Membrane Seal Length = 426
 Score =  130 bits (328), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 70/426 (16%), Positives = 150/426 (35%), Gaps = 69/426 (16%)

Query: 24  KSRIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFS 83
           K ++ +T I L++Y     I +             ++   IFG              + +
Sbjct: 24  KEKLKWTGIVLVLYFIMGCIDVY---------TAGAQIPAIFG------------GTLIT 62

Query: 84  LGIMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGL 143
           LGI P ++A II+QL+  +   +  +     + R +     +  ++++  ++A       
Sbjct: 63  LGIGPIVTAGIIMQLLVGS--GIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGA- 119

Query: 144 KNGQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGL--- 200
               G          F  II +  G++ L++L E ++  GIG+G+ L I +G+   +   
Sbjct: 120 ----GAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVG 175

Query: 201 ---PSSLVSVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNR 257
              P   +       +  +     +     T+ V  +V++ E  +  + + + + +    
Sbjct: 176 ALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVG 235

Query: 258 MFQDDVSYLPLKLNTAGVVPSIFASSLLLLPA--------TIMGFIDVSSSPTWIVGLVD 309
            +       P+K      +P I A++L               +  +        + G+  
Sbjct: 236 KY-------PIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAY 288

Query: 310 SLGHGR------------SFYMVLYSVFIVFFAFFYT-AIVFNPKEAADNLKKHGGFIPG 356
            L                  YM+   +  V F  F+      +PK  A  +   G  I G
Sbjct: 289 YLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKG 348

Query: 357 IRPG-DRTALHIDYVLTRVTVVGAGYLVCVCIFPEALIAVTGVPVSLSGTSLLIIVSVVL 415
            R         +   +  +TV+ + ++  +      + A+        GT +L+ VS+V 
Sbjct: 349 FRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALG------GGTGVLLTVSIVY 402

Query: 416 DTIVQI 421
               Q+
Sbjct: 403 RMYEQL 408