RPSBLAST alignment for GI: 254780241 and conserved domain: TIGR02920

>gnl|CDD|131966 TIGR02920, acc_sec_Y2, accessory Sec system translocase SecY2. Members of this family are restricted to the Firmicutes lineage (low-GC Gram-positive bacteria) and appear to be paralogous to, and much more divergent than, the preprotein translocase SecY. Members include the SecY2 protein of the accessory Sec system in Streptococcus gordonii, involved in export of the highly glycosylated platelet-binding protein GspB. Length = 395
 Score =  144 bits (364), Expect = 5e-35
 Identities = 100/414 (24%), Positives = 192/414 (46%), Gaps = 28/414 (6%)

Query: 26  RIVFTIIALIVYRFGTYIPLPSIDFISYSKAFQSKSAGIFGLFNMFSGGAVERMAVFSLG 85
           +I+FT   LI+Y  G+YIP+P ++ +S  +  +      F +    +GG +  +++FSLG
Sbjct: 5   KILFTCFILIIYVLGSYIPIPFVE-VSK-QDMEGVKNSFFKIAIANTGGNLTTLSIFSLG 62

Query: 86  IMPYISASIIVQLIAATVPSLENLKKEGEQGRKVINQYTRYATVLLGILQAYGIAVGLKN 145
           + P++++ II+QL      S         Q  K      R+ T+++ I+Q   I     N
Sbjct: 63  LGPWMTSMIILQLF-----SFTKSDGFDAQSPKEQQYRERFLTLIIAIIQGLAIIHSFTN 117

Query: 146 GQGIVSDSDYFFVFSTIITLLGGTMFLVWLGEQITMRGIGNGVSLIIFSGIVAGLPSSLV 205
             G+   +    +    + L+ GT  LVWL +     GIG G   I+   ++  +PS++ 
Sbjct: 118 KNGLSDFN----MLLATLILVTGTCLLVWLADLNAKYGIG-GSMPIVLVSMLKNIPSNVF 172

Query: 206 SVLELGRVGSISTPLMLLIFSSTVAVIALVIFFERAQRRLLIQYPKRQVGNRMFQDDVSY 265
            + ++  +  I+  ++L + +       L+ F ERA+ R+    P   +      + +SY
Sbjct: 173 ELFQMSYIWLIALLILLTLVALF-----LLAFIERAEYRI----PVNDISLHNRSNLMSY 223

Query: 266 LPLKLNTAGVVPSIFASSLLLLPATIMGFI-DVSSSPTWIVGLVDSLGHGRSFYMVLYSV 324
           LP+KLN AG +  ++  SLL+LP  I+  +  +  + + I   V          +++Y +
Sbjct: 224 LPIKLNPAGGMMYMYVMSLLMLPQYIIILLGRIFPNSSLINNWVFQFSFSSPVGILIYLI 283

Query: 325 FIVFFAFFYTAIVFNPKEAADNLKKHGGFIPGIRPGDRTALHIDYVLTRVTVVGAGYLVC 384
             +  ++F+T +  NPKE + + +K G +IPGI PG  T  +++ +  R    G  +   
Sbjct: 284 LQMLLSYFFTFVNINPKEISKSFRKSGNYIPGIAPGKDTQRYLNRLARRFCWFGGVFNAF 343

Query: 385 VCIFPEALIAVTGVP----VSLSGTSLLIIVSVVLDTIVQIQGYLIAQQYEGVF 434
               P  L     VP     +      ++I  +  +   +I+  L   +Y+ + 
Sbjct: 344 QLGIP--LYFALFVPHLLTEAYIPGQFMMITGMSFNIADEIRTILYFDRYKPLL 395