RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780242|ref|YP_003064655.1| 50S ribosomal protein L15 [Candidatus Liberibacter asiaticus str. psy62] (151 letters) >gnl|CDD|36064 KOG0846, KOG0846, KOG0846, Mitochondrial/chloroplast ribosomal protein L15/L10 [Translation, ribosomal structure and biogenesis]. Length = 274 Score = 118 bits (297), Expect = 5e-28 Identities = 70/139 (50%), Positives = 86/139 (61%), Gaps = 4/139 (2%) Query: 14 KVKKRVARGIGSGTGKTAGRGVKGQKSRSGVSVRGFEGGQMPLYRRLPKRGFVNIAGSDF 73 K KKR RGI SG GKT+GRG KGQK R G + GFEGGQ PLYRR PK GF N + Sbjct: 34 KKKKRKGRGISSGLGKTSGRGHKGQKQRGGRKILGFEGGQTPLYRRFPKFGFGNGGRRQY 93 Query: 74 VTISLGLLQAYIDKDRLDCSSEIDASVLVASGLVRRSQR--GIRILSDG--DLKAKVVLR 129 + +SLG LQ ID R+D S ID L SGL+ R G+++ +DG + KAK+ + Sbjct: 94 LPLSLGRLQKLIDTGRIDPSQPIDMKTLKDSGLINPKGREYGVQLTADGADEFKAKINIE 153 Query: 130 VSGASASAVEKVEKLGGQV 148 VS AS A+ +EK GG V Sbjct: 154 VSRASVQAIAAIEKAGGSV 172 >gnl|CDD|30549 COG0200, RplO, Ribosomal protein L15 [Translation, ribosomal structure and biogenesis]. Length = 152 Score = 116 bits (293), Expect = 2e-27 Identities = 71/154 (46%), Positives = 98/154 (63%), Gaps = 6/154 (3%) Query: 1 MKLNEISYDKGSCKVKKRVARGIGSGTGKTAGRGVKGQKSRSGVSV--RGFEGGQMPLYR 58 M+LN++ +GS K +KRV RGIGSG GKT GRG KGQK+RSG GFEGGQMPLYR Sbjct: 1 MRLNDLKPARGSKKTRKRVGRGIGSGLGKTGGRGHKGQKARSGHKWVRPGFEGGQMPLYR 60 Query: 59 RLPKRGFVNIAGSDFVTISLGLLQAYIDKDRLDCSSEIDASVLVASGLVRRSQRGIRILS 118 RLPKRGF N S F + ++ + L E+ + L A+G++R+ + +++L Sbjct: 61 RLPKRGFTN---SKFKKVEYAVVNLGKLAELLPEGEEVTLASLKAAGVIRKLKDLVKVLG 117 Query: 119 DGDLKAKVVLRVS-GASASAVEKVEKLGGQVIVI 151 +G L V ++V AS SA+EK+E GG+V +I Sbjct: 118 NGKLTKAVPVKVKAKASKSAIEKIEAAGGKVELI 151 >gnl|CDD|144427 pfam00828, Ribosomal_L18e, Ribosomal protein L18e/L15. This family includes eukaryotic L18 as well as prokaryotic L15. Length = 122 Score = 89.6 bits (223), Expect = 3e-19 Identities = 49/126 (38%), Positives = 71/126 (56%), Gaps = 9/126 (7%) Query: 28 GKTAGRGVKGQKSRSGVSVRGFEGGQMPLYRRLPKRGFVNIAGS--DFVTISLGLLQAYI 85 GKT GRG KG + R+G FEGGQ+PLYRRL KRGF + S + ++L + Sbjct: 4 GKTRGRGRKGGRGRAGGQKHPFEGGQVPLYRRLGKRGFRRLFKSRKNRPPVNLS----KL 59 Query: 86 DKDRLDCSSEIDASVLVASGLVRRSQRGIRILSDGDLKAKVVLRVSGASASAVEKVEKLG 145 D+ L E+D LV G V +++L +G+L + ++ S SA EK+EK G Sbjct: 60 DRKMLKDGEEVDGETLVVVGTVT---DDVKVLGNGELTKPLTVKALKFSKSAREKIEKAG 116 Query: 146 GQVIVI 151 G+VI++ Sbjct: 117 GEVILL 122 >gnl|CDD|176671 cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein. Length = 114 Score = 27.6 bits (62), Expect = 1.3 Identities = 10/25 (40%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 126 VVLRVSGASASAVEKVEKLGGQVIV 150 V V A A +VE GG+V+V Sbjct: 65 VYFAVDDVDA-AAARVEAAGGKVLV 88 >gnl|CDD|146467 pfam03849, Tfb2, Transcription factor Tfb2. Length = 365 Score = 26.5 bits (59), Expect = 2.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 99 SVLVASGLVRRSQRGIRILSDG 120 ++L GL+ RS G+RI ++G Sbjct: 159 NLLKHGGLMERSDGGLRITNEG 180 >gnl|CDD|36653 KOG1440, KOG1440, KOG1440, CDP-diacylglycerol synthase [Lipid transport and metabolism]. Length = 432 Score = 26.4 bits (58), Expect = 3.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Query: 48 GFEGGQMPLYRRLPKRGFVNIAGSDFVTISLGLLQAYI 85 GF G+ PL + PK+ + G F T+ G+L +Y+ Sbjct: 240 GFFFGKTPLIKLSPKKTWEGFIGGTFGTVVFGILFSYV 277 >gnl|CDD|37983 KOG2772, KOG2772, KOG2772, Transaldolase [Carbohydrate transport and metabolism]. Length = 337 Score = 26.5 bits (58), Expect = 3.5 Identities = 11/50 (22%), Positives = 20/50 (40%), Gaps = 8/50 (16%) Query: 67 NIAGSDFVTISLGLLQAYIDKDRLDCSSEIDASVLVASGLVRRSQRGIRI 116 N+AG D++TIS LL + + L S + + ++ Sbjct: 247 NLAGVDYLTISPALLP--------QLVNSTEDQPLELSASHAKLKDLEKV 288 >gnl|CDD|144518 pfam00946, Paramyx_RNA_pol, Paramyxovirus RNA dependent RNA polymerase. Paramyxoviridae, like other non-segmented negative strand RNA viruses, have an RNA-dependent RNA polymerase composed of two subunits, a large protein L and a phosphoprotein P. This is a protein family of the L protein. The L protein confers the RNA polymerase activity on the complex. The P protein acts as a transcription factor. Length = 1161 Score = 26.1 bits (58), Expect = 4.3 Identities = 12/40 (30%), Positives = 15/40 (37%), Gaps = 6/40 (15%) Query: 54 MPLYRRLPKRGFVNIAGSDFVTISLGLLQAYIDKDRLDCS 93 + L R L R D VT +L L+ I LD Sbjct: 888 LNLSR-LFYRNI-----GDPVTEALADLKRLIKAGLLDSW 921 >gnl|CDD|144500 pfam00923, Transaldolase, Transaldolase. Length = 244 Score = 25.2 bits (56), Expect = 7.9 Identities = 7/18 (38%), Positives = 9/18 (50%) Query: 69 AGSDFVTISLGLLQAYID 86 AG D +TI L+A Sbjct: 211 AGCDTITIPPDTLEALAK 228 >gnl|CDD|29746 cd01143, YvrC, Periplasmic binding protein YvrC. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria and archaea. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.. Length = 195 Score = 24.8 bits (54), Expect = 9.8 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 121 DLKAKVVLRVSGASASAVEKVEKLGGQVIVI 151 LK +V+ S + A +EK++ G V+V+ Sbjct: 58 ALKPDLVIVSSSSLAELLEKLKDAGIPVVVL 88 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.137 0.372 Gapped Lambda K H 0.267 0.0748 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,617,540 Number of extensions: 78296 Number of successful extensions: 168 Number of sequences better than 10.0: 1 Number of HSP's gapped: 163 Number of HSP's successfully gapped: 16 Length of query: 151 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 66 Effective length of database: 4,426,972 Effective search space: 292180152 Effective search space used: 292180152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (24.2 bits)