BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780242|ref|YP_003064655.1| 50S ribosomal protein L15 [Candidatus Liberibacter asiaticus str. psy62] (151 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780242|ref|YP_003064655.1| 50S ribosomal protein L15 [Candidatus Liberibacter asiaticus str. psy62] Length = 151 Score = 291 bits (745), Expect = 4e-81, Method: Compositional matrix adjust. Identities = 151/151 (100%), Positives = 151/151 (100%) Query: 1 MKLNEISYDKGSCKVKKRVARGIGSGTGKTAGRGVKGQKSRSGVSVRGFEGGQMPLYRRL 60 MKLNEISYDKGSCKVKKRVARGIGSGTGKTAGRGVKGQKSRSGVSVRGFEGGQMPLYRRL Sbjct: 1 MKLNEISYDKGSCKVKKRVARGIGSGTGKTAGRGVKGQKSRSGVSVRGFEGGQMPLYRRL 60 Query: 61 PKRGFVNIAGSDFVTISLGLLQAYIDKDRLDCSSEIDASVLVASGLVRRSQRGIRILSDG 120 PKRGFVNIAGSDFVTISLGLLQAYIDKDRLDCSSEIDASVLVASGLVRRSQRGIRILSDG Sbjct: 61 PKRGFVNIAGSDFVTISLGLLQAYIDKDRLDCSSEIDASVLVASGLVRRSQRGIRILSDG 120 Query: 121 DLKAKVVLRVSGASASAVEKVEKLGGQVIVI 151 DLKAKVVLRVSGASASAVEKVEKLGGQVIVI Sbjct: 121 DLKAKVVLRVSGASASAVEKVEKLGGQVIVI 151 >gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Score = 22.7 bits (47), Expect = 2.9, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 25/56 (44%) Query: 87 KDRLDCSSEIDASVLVASGLVRRSQRGIRILSDGDLKAKVVLRVSGASASAVEKVE 142 K L SEI S + + ++L +G KAK ++ +GA +E +E Sbjct: 114 KATLKNPSEITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEGIE 169 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 21.9 bits (45), Expect = 4.5, Method: Compositional matrix adjust. Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 65 FVNIAGSDFVTISLGL 80 F I+GSDFV + +G+ Sbjct: 209 FFTISGSDFVELFVGV 224 >gi|254780615|ref|YP_003065028.1| F0F1 ATP synthase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Score = 21.2 bits (43), Expect = 8.1, Method: Compositional matrix adjust. Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 45 SVRGFEGGQMPLYRRLPKRGFVNIAGSD 72 ++RGF+G Y LP+ F + D Sbjct: 442 TIRGFKGLVQGEYDHLPELAFYMVGSID 469 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.137 0.372 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,020 Number of Sequences: 1233 Number of extensions: 3280 Number of successful extensions: 8 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 5 length of query: 151 length of database: 328,796 effective HSP length: 67 effective length of query: 84 effective length of database: 246,185 effective search space: 20679540 effective search space used: 20679540 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 34 (17.7 bits)