>cd01658 Ribosomal_L30 Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.

Probab=99.88 E-value=6.6e-23 Score=143.36 Aligned_cols=54 Identities=46% Similarity=0.724 Sum_probs=53.2 Q ss_pred EEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEE Q ss_conf 599997336898989999999838346798289829978970798621114783 Q gi|254780243|r 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIV 63 (64) Q Consensus 10 ikItlvkS~iG~~~~~r~tl~~LGL~k~~~~v~~~dtP~irGmi~kV~hLV~Ve 63 (64) T Consensus 1 lkItlvrS~ig~~~~~r~tl~~LGL~k~~~~v~~~dtp~irGmi~kV~hLV~VE 54 (54) T cd01658 1 LKITLVKSLIGRPKKQRATLKALGLKKINQTVVHKDTPSIRGMINKVKHLVKVE 54 (54) T ss_pred CEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHHEEEC T ss_conf 959997068998989999999939997999889579978988999644646759

HHsearch alignment for GI: 254780243 and conserved domain: cd01658