RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780243|ref|YP_003064656.1| 50S ribosomal protein L30 [Candidatus Liberibacter asiaticus str. psy62] (64 letters) >gnl|CDD|180163 PRK05611, rpmD, 50S ribosomal protein L30; Reviewed. Length = 59 Score = 82.8 bits (206), Expect = 2e-17 Identities = 26/58 (44%), Positives = 37/58 (63%) Query: 7 MQKITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE 64 M+ + + + S I R QR L GLGL K+N L+DTP++RGMI+ V HLV++ E Sbjct: 1 MKTLKITLVKSLIGRKPKQRATLRGLGLRKINSTVELEDTPAIRGMINKVSHLVKVEE 58 >gnl|CDD|130375 TIGR01308, rpmD_bact, ribosomal protein L30, bacterial/organelle. This model describes bacterial (and organellar) 50S ribosomal protein L30. Homologous ribosomal proteins of the eukaryotic cytosol and of the archaea differ substantially in architecture, from bacterial L30 and also from each other, and are described by separate models. Length = 55 Score = 63.9 bits (156), Expect = 8e-12 Identities = 27/55 (49%), Positives = 36/55 (65%) Query: 10 ITVQQIGSPIRRPSVQRKVLIGLGLNKMNRCRVLDDTPSVRGMISTVHHLVRIVE 64 I V + S I RP QRK L LGL K+ R VL+D P++RGM++ V HLV++ E Sbjct: 1 IKVTLVRSLIGRPKKQRKTLKALGLRKIGRQVVLEDNPAIRGMVNKVKHLVKVEE 55 >gnl|CDD|180369 PRK06049, rpl30p, 50S ribosomal protein L30P; Reviewed. Length = 154 Score = 35.2 bits (82), Expect = 0.003 Identities = 11/29 (37%), Positives = 19/29 (65%) Query: 32 LGLNKMNRCRVLDDTPSVRGMISTVHHLV 60 L L+++N C ++ +TPS +GM+ V V Sbjct: 25 LRLHRVNHCVLVPETPSYKGMLQKVKDYV 53 >gnl|CDD|130376 TIGR01309, L30P_arch, 50S ribosomal protein L30P, archaeal. This model represents the archaeal ribosomal protein similar to longer (~ 250 residue) eukaryotic 60S ribosomal protein L7 and to the much shorter (~ 60 residue) bacterial 50S ribosomal protein L30. Protein naming follows the SwissProt designation as L30P, while the gene symbol rpmD follows TIGR usage. Length = 152 Score = 29.7 bits (67), Expect = 0.17 Identities = 9/25 (36%), Positives = 16/25 (64%) Query: 32 LGLNKMNRCRVLDDTPSVRGMISTV 56 L L+++N C + +TP+ GM+ V Sbjct: 23 LRLHRVNHCVLYPETPTYLGMLQKV 47 >gnl|CDD|132218 TIGR03174, cas_Csc3, CRISPR-associated protein Csc3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This protein family is a CRISPR-associated (Cas) family strictly associated with the Cyano subtype of CRISPR/Cas locus, found in several species of Cyanobacteria and several archaeal species. This family is designated Csc3 for CRISPR/Cas Subtype Cyano protein 3, as it is often the third gene upstream of the core cas genes, cas3-cas4-cas1-cas2. Length = 953 Score = 24.5 bits (53), Expect = 6.8 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 11 TVQQIGSPIRRPSVQRKVLI-GLGLNKMNRCRVLDDTP 47 +QQ+ P+R +R+++I G L+ ++ DD P Sbjct: 23 RLQQLDFPVRLNVKERRLVIAGFTLHDYHKHCHADDMP 60 >gnl|CDD|184920 PRK14956, PRK14956, DNA polymerase III subunits gamma and tau; Provisional. Length = 484 Score = 24.1 bits (52), Expect = 7.5 Identities = 13/45 (28%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Query: 21 RPSVQRKVLIGLGLNKMNRCRVLDDT-PSVRGMISTVHHLVRIVE 64 R S + KV + + K+ V + T PS+ G++ ++HL+ +V+ Sbjct: 350 RNSFEIKVFTEIQIKKL----VEELTYPSLAGLLDKINHLILMVQ 390 >gnl|CDD|162552 TIGR01833, HMG-CoA-S_euk, 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade. Hydroxymethylglutaryl(HMG)-CoA synthase is the first step of isopentenyl pyrophosphate (IPP) biosynthesis via the mevalonate pathway. This pathway is found mainly in eukaryotes, but also in archaea and some bacteria. This model is specific for eukaryotes. Length = 454 Score = 24.0 bits (52), Expect = 9.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Query: 27 KVLIGLGLNKMNRCRVLDDTPS 48 K IGLG KM C +D S Sbjct: 31 KYTIGLGQTKMGFCTDREDINS 52 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.136 0.377 Gapped Lambda K H 0.267 0.0592 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 983,922 Number of extensions: 45173 Number of successful extensions: 79 Number of sequences better than 10.0: 1 Number of HSP's gapped: 79 Number of HSP's successfully gapped: 8 Length of query: 64 Length of database: 5,994,473 Length adjustment: 35 Effective length of query: 29 Effective length of database: 5,238,193 Effective search space: 151907597 Effective search space used: 151907597 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 50 (23.3 bits)