HHsearch alignment for GI: 254780244 and conserved domain: COG0098

>COG0098 RpsE Ribosomal protein S5 [Translation, ribosomal structure and biogenesis].
Probab=100.00  E-value=0  Score=402.68  Aligned_cols=166  Identities=51%  Similarity=0.816  Sum_probs=160.3

Q ss_pred             HHHCCCCCCCEEEEEEECCCCEECCCCEEEEEEEEEEECCCCCCEEEEECCCCCHHHHHHHHHHHHHHCEEEEECCCCCC
Q ss_conf             21000011602100002244401278738467999998089983899704744247899999999963012522016687
Q gi|254780244|r   13 QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRT   92 (199)
Q Consensus        13 ~~~~~~~~~l~ekvi~v~RV~k~tkgGr~~sf~alvvvGn~~G~vG~G~GKa~ev~~Ai~KA~~~Akknli~V~~~~~~T   92 (199)
T Consensus        15 ~~~e~~~~~l~e~vv~inrV~K~~kgGRr~~F~alvVVGd~~G~VG~G~GKA~EV~~AIrKAi~~Ak~nii~V~~~~~~T   94 (181)
T COG0098          15 PIKEPEVDELLEKVVDINRVSKVVKGGRRFRFSALVVVGDRNGRVGFGIGKAKEVPEAIRKAIEDAKKNIIEVPRGNGHT   94 (181)
T ss_pred             CCCCHHHHHCCCCCEEEEEEEEEECCCEEEEEEEEEEEECCCCEEEEEECCHHHHHHHHHHHHHHHHHCEEEEECCCCCE
T ss_conf             76770665303001588977775137517889999999679980712003023568999999999984769985479964


Q ss_pred             CCEECCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCC
Q ss_conf             62001103376799996367544850304899999980944100454689888899999999995069989999861997
Q gi|254780244|r   93 LHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIK  172 (199)
Q Consensus        93 I~h~v~gk~g~~kV~l~Pap~G~Gi~a~~~vr~il~laGI~dv~aK~~GS~N~~NvvkAt~~AL~~~~t~~~iA~~RG~~  172 (199)
T Consensus        95 iph~v~Gk~g~~~V~L~PA~~GtGiiAGg~~r~vlelAGi~Dv~tks~GS~n~~N~vrAt~~aL~~~~~p~~ia~~Rg~~  174 (181)
T COG0098          95 IPHEVIGKHGAVKVLLKPAPEGTGIIAGGAVRAVLELAGIKDVLAKSLGSRNPINVVRATFDALKKLRTPEDVAAKRGKK  174 (181)
T ss_pred             EEEEEEEEECCEEEEEEECCCCCEEEECCHHHHHHHHCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHCCCC
T ss_conf             62687888784899998789985488473789999982800411102678984489999999999756999999871996


Q ss_pred             HHHHHH
Q ss_conf             989445
Q gi|254780244|r  173 HSLLQA  178 (199)
Q Consensus       173 i~~~~~  178 (199)
T Consensus       175 ~~~~~~  180 (181)
T COG0098         175 VEDILG  180 (181)
T ss_pred             CHHHHC
T ss_conf             065315