PSIBLAST alignment of GI: 254780244 and protein with PDB id: 3ohc

>gi|309320341|pdb|3OHC|E Chain E, Structure Of The Thermus Thermophilus Ribosome Complexed With Erythromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes. Length = 160
>gi|309320362|pdb|3OHD|E Chain E, Structure Of The Thermus Thermophilus Ribosome Complexed With Erythromycin. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes Length = 160
 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 62/153 (40%), Positives = 87/153 (56%), Gaps = 1/153 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
             +    ++++ I R +    GGRRF F  LVVVGD + +VG     A EVP AV+KA  
Sbjct: 1   MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGY 60

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+RNM+ V L +  T+ H+     GA K++++ A  GTGVIAG   RA+ E+ G+ D++
Sbjct: 61  YARRNMVEVPLQN-GTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDIL 119

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRR 169
            K +GS NP N+  AT E LR      DV   R
Sbjct: 120 TKELGSRNPINIAYATMEALRQLRTKADVERLR 152