BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780244|ref|YP_003064657.1| 30S ribosomal protein S5
[Candidatus Liberibacter asiaticus str. psy62]
         (199 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|159184984|ref|NP_354907.2| 30S ribosomal protein S5 [Agrobacterium tumefaciens str. C58]
 gi|26399419|sp|Q8UE35|RS5_AGRT5 RecName: Full=30S ribosomal protein S5
 gi|159140260|gb|AAK87692.2| 30s ribosomal protein S5 [Agrobacterium tumefaciens str. C58]
          Length = 189

 Score =  197 bits (502), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 122/189 (64%), Positives = 153/189 (80%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ++R  RD+ QNREERD+  VD++VAINRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQEKRGSRDDRQNREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR++I V L DGRTLHHD  GRHGAGKV++RSA AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATESAKRDLIFVPLRDGRTLHHDVNGRHGAGKVLLRSAKAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+HDVVAKS GSSNP+N++RATF+ L+ Q HP+D+A +RG+K++ LQARR
Sbjct: 121 GPMRAVFETLGVHDVVAKSTGSSNPYNMVRATFDALKHQVHPKDIAAQRGLKYATLQARR 180

Query: 181 VVSSKSSSY 189
             S  +S  
Sbjct: 181 AASGNASEE 189


>gi|325293319|ref|YP_004279183.1| 30S ribosomal protein S5 [Agrobacterium sp. H13-3]
 gi|325061172|gb|ADY64863.1| 30S ribosomal protein S5 [Agrobacterium sp. H13-3]
          Length = 189

 Score =  197 bits (502), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 121/189 (64%), Positives = 153/189 (80%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ++R  RD+ QNREERD+  VD++VAINRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQEKRGSRDDRQNREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR++I V L DGRTLHHD  GRHGAGKV++RSA AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATESAKRDLIFVPLRDGRTLHHDVNGRHGAGKVLLRSAKAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+HDVVAKS GSSNP+N++RATF+ L+ Q HP+D+A +RG+K++ LQ+RR
Sbjct: 121 GPMRAVFETLGVHDVVAKSTGSSNPYNMVRATFDALKHQVHPKDIAAQRGLKYATLQSRR 180

Query: 181 VVSSKSSSY 189
             S  +S  
Sbjct: 181 AASGNASEE 189


>gi|114704501|ref|ZP_01437409.1| 30S ribosomal protein S5 [Fulvimarina pelagi HTCC2506]
 gi|114539286|gb|EAU42406.1| 30S ribosomal protein S5 [Fulvimarina pelagi HTCC2506]
          Length = 195

 Score =  197 bits (501), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 116/189 (61%), Positives = 149/189 (78%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           RDN ++REE+D+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVP
Sbjct: 4   RDNRRDREEQDDGFVDKLVHINRVAKVVKGGRRFGFAALVVVGDLKGRVGFGHGKAREVP 63

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           EA+RKATEAAKR++I V L DGRTLHHD  GRHGAGKV++R+A AGTG+IAGG +RAV E
Sbjct: 64  EAIRKATEAAKRDLIFVPLRDGRTLHHDVHGRHGAGKVLLRAAEAGTGIIAGGPMRAVFE 123

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            +GMHDVVAKS+GSSNP+N++RATFE L+  +HP+D+A +RGIK+S LQARR  ++    
Sbjct: 124 AVGMHDVVAKSLGSSNPYNMVRATFEGLKQATHPKDIAAKRGIKYSELQARRQAATGHHP 183

Query: 189 YSRDSKNKG 197
            +  S+   
Sbjct: 184 QAEPSEEAA 192


>gi|116251557|ref|YP_767395.1| 30S ribosomal protein S5 [Rhizobium leguminosarum bv. viciae 3841]
 gi|241204182|ref|YP_002975278.1| 30S ribosomal protein S5 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|189045481|sp|Q1MIC4|RS5_RHIL3 RecName: Full=30S ribosomal protein S5
 gi|115256205|emb|CAK07286.1| putative 30S ribosomal protein S5 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|240858072|gb|ACS55739.1| ribosomal protein S5 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 189

 Score =  197 bits (500), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 124/189 (65%), Positives = 151/189 (79%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ+ R QRD+ Q+REERD+  VD++VAINRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQERRPQRDDRQSREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR +I V L DGRTLHHD  GRHGAGKV++RSA  GTG+IAG
Sbjct: 61  HGKAREVPEAIRKATEAAKRELIFVPLRDGRTLHHDVHGRHGAGKVLLRSAKVGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LGMHDVVAKS GSSNP+N++RATF+ L+ Q HP+D+A +RGIK++ LQARR
Sbjct: 121 GPMRAVFETLGMHDVVAKSTGSSNPYNMVRATFDALKHQVHPKDIAAQRGIKYATLQARR 180

Query: 181 VVSSKSSSY 189
             S  +S  
Sbjct: 181 SASGNASEE 189


>gi|222148383|ref|YP_002549340.1| 30S ribosomal protein S5 [Agrobacterium vitis S4]
 gi|254764624|sp|B9JVQ4|RS5_AGRVS RecName: Full=30S ribosomal protein S5
 gi|221735371|gb|ACM36334.1| 30s ribosomal protein S5 [Agrobacterium vitis S4]
          Length = 189

 Score =  196 bits (498), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 124/189 (65%), Positives = 152/189 (80%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ++R  RD+ QNREERD+  VD++VAINRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQEKRGSRDDRQNREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR++I V L DGRTLHHD  GRHGAGKV++RSA AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATESAKRDLIFVPLRDGRTLHHDVHGRHGAGKVLLRSAKAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LGMHDVVAKS GSSNP+N++RATF+ L+ Q HP+DVA +RG+K++ LQARR
Sbjct: 121 GPMRAVFETLGMHDVVAKSTGSSNPYNMVRATFDALKHQVHPKDVAAQRGLKYATLQARR 180

Query: 181 VVSSKSSSY 189
             S   S  
Sbjct: 181 AASGNGSEE 189


>gi|15965126|ref|NP_385479.1| 30S ribosomal protein S5 [Sinorhizobium meliloti 1021]
 gi|150396224|ref|YP_001326691.1| 30S ribosomal protein S5 [Sinorhizobium medicae WSM419]
 gi|307314376|ref|ZP_07593982.1| ribosomal protein S5 [Sinorhizobium meliloti BL225C]
 gi|307322088|ref|ZP_07601464.1| ribosomal protein S5 [Sinorhizobium meliloti AK83]
 gi|26399446|sp|Q92QF3|RS5_RHIME RecName: Full=30S ribosomal protein S5
 gi|189045438|sp|A6U876|RS5_SINMW RecName: Full=30S ribosomal protein S5
 gi|15074306|emb|CAC45952.1| Probable 30S ribosomal protein S5 [Sinorhizobium meliloti 1021]
 gi|150027739|gb|ABR59856.1| ribosomal protein S5 [Sinorhizobium medicae WSM419]
 gi|306892270|gb|EFN23080.1| ribosomal protein S5 [Sinorhizobium meliloti AK83]
 gi|306899074|gb|EFN29716.1| ribosomal protein S5 [Sinorhizobium meliloti BL225C]
          Length = 189

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 119/189 (62%), Positives = 152/189 (80%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ+ R  R++ QNREERD+  VD++VAINRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQERRGSREDRQNREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR++I V L  GRTLHHD  GRHGAGKV++RSA  GTG+IAG
Sbjct: 61  HGKAREVPEAIRKATEAAKRDLIFVPLRGGRTLHHDVHGRHGAGKVLLRSAKPGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+HDVVAKS GSSNP+N++RATF+ L++Q HP+D+A +RG+K++ LQ+RR
Sbjct: 121 GPMRAVFETLGVHDVVAKSTGSSNPYNMVRATFDALKNQMHPKDIAAQRGMKYATLQSRR 180

Query: 181 VVSSKSSSY 189
           V +  +S  
Sbjct: 181 VSAGVASEE 189


>gi|86357322|ref|YP_469214.1| 30S ribosomal protein S5 [Rhizobium etli CFN 42]
 gi|190891372|ref|YP_001977914.1| 30S ribosomal protein S5 [Rhizobium etli CIAT 652]
 gi|209548952|ref|YP_002280869.1| 30S ribosomal protein S5 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|123512267|sp|Q2K9J9|RS5_RHIEC RecName: Full=30S ribosomal protein S5
 gi|226703379|sp|B3PWT8|RS5_RHIE6 RecName: Full=30S ribosomal protein S5
 gi|226703380|sp|B5ZYV2|RS5_RHILW RecName: Full=30S ribosomal protein S5
 gi|86281424|gb|ABC90487.1| 30S ribosomal protein S5 [Rhizobium etli CFN 42]
 gi|190696651|gb|ACE90736.1| 30S ribosomal protein S5 [Rhizobium etli CIAT 652]
 gi|209534708|gb|ACI54643.1| ribosomal protein S5 [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|327189688|gb|EGE56835.1| 30S ribosomal protein S5 [Rhizobium etli CNPAF512]
          Length = 189

 Score =  196 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 123/189 (65%), Positives = 151/189 (79%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ+ R QR++ Q+REERD+  VD++VAINRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQERRPQREDRQSREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR +I V L DGRTLHHD  GRHGAGKV++RSA  GTG+IAG
Sbjct: 61  HGKAREVPEAIRKATEAAKRELIFVPLRDGRTLHHDVHGRHGAGKVLLRSAKVGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LGMHDVVAKS GSSNP+N++RATF+ L+ Q HP+D+A +RGIK++ LQARR
Sbjct: 121 GPMRAVFETLGMHDVVAKSTGSSNPYNMVRATFDALKHQVHPKDIAAQRGIKYATLQARR 180

Query: 181 VVSSKSSSY 189
             S  +S  
Sbjct: 181 SASGNASEE 189


>gi|227821773|ref|YP_002825743.1| 30S ribosomal protein S5 [Sinorhizobium fredii NGR234]
 gi|254765202|sp|C3MAZ7|RS5_RHISN RecName: Full=30S ribosomal protein S5
 gi|227340772|gb|ACP24990.1| ribosomal protein S5 [Sinorhizobium fredii NGR234]
          Length = 189

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 121/189 (64%), Positives = 153/189 (80%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ+ R  R++ QNREERD+  VD++VAINRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQERRGSREDRQNREERDSEFVDKLVAINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR++I V L  GRTLHHD  GRHGAGKV++RSA AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATEAAKRDLIFVPLRGGRTLHHDVNGRHGAGKVLLRSAKAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+HDVVAKS GSSNP+N++RATF+ L++Q HP+D+A +RG+K++ LQARR
Sbjct: 121 GPMRAVFETLGVHDVVAKSTGSSNPYNMVRATFDALKNQMHPKDIAAQRGMKYATLQARR 180

Query: 181 VVSSKSSSY 189
           V +  +S  
Sbjct: 181 VAAGAASEE 189


>gi|315497990|ref|YP_004086794.1| ribosomal protein s5 [Asticcacaulis excentricus CB 48]
 gi|315416002|gb|ADU12643.1| ribosomal protein S5 [Asticcacaulis excentricus CB 48]
          Length = 191

 Score =  193 bits (490), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 100/191 (52%), Positives = 134/191 (70%), Gaps = 1/191 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA +    R++ + R E  +  V+++V INRV+  + GGRRF+F+ L+VVGD K +VGF 
Sbjct: 1   MA-RPSENRNDRRERTEEPSEFVEKLVHINRVAATVKGGRRFSFAALMVVGDQKGRVGFG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE AK++M+ + L + RTLHHDG GR GAGK+ +R+A  GTGVIAG
Sbjct: 60  HGKAREVPEAIRKATEEAKKSMVRIPLRESRTLHHDGYGRWGAGKIQLRAAPPGTGVIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVV KS+GSSNP+N++RATFE L+ QS PR +A +RG K   +  RR
Sbjct: 120 GPMRAVLETLGVSDVVGKSLGSSNPYNMVRATFEALKVQSSPRQIAAKRGKKVGDILTRR 179

Query: 181 VVSSKSSSYSR 191
              + S     
Sbjct: 180 NDGASSPESIE 190


>gi|319408748|emb|CBI82405.1| 30S ribosomal protein S5 [Bartonella schoenbuchensis R1]
          Length = 186

 Score =  192 bits (487), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 112/181 (61%), Positives = 142/181 (78%), Gaps = 2/181 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKER+ RD  + R E  +  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERNDRD--ERRNENSSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKAT++AKR MI V L  GRTLHHD  G HGAG+V++RSA AGTG+IAG
Sbjct: 59  HGKAREVPEAIRKATDSAKREMIYVPLRSGRTLHHDVEGCHGAGRVLLRSASAGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LG+ DVVAKS+GSSNP+N++RATF+ L+ Q HP+D+A +RGIK+S LQ+RR
Sbjct: 119 GPMRAIFETLGVQDVVAKSLGSSNPYNMVRATFDALKRQVHPKDIAAQRGIKYSTLQSRR 178

Query: 181 V 181
            
Sbjct: 179 Q 179


>gi|197104713|ref|YP_002130090.1| 30S ribosomal protein S5 [Phenylobacterium zucineum HLK1]
 gi|226703370|sp|B4R8N4|RS5_PHEZH RecName: Full=30S ribosomal protein S5
 gi|196478133|gb|ACG77661.1| 30S ribosomal protein S5 [Phenylobacterium zucineum HLK1]
          Length = 195

 Score =  191 bits (484), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 107/180 (59%), Positives = 137/180 (76%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++   + D     EERD+ IV+++V INRV+  + GGRRF+F+ L+VVGD K +VGF 
Sbjct: 1   MARRNEERGDRRNREEERDSEIVEKLVHINRVAATVKGGRRFSFAALMVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE AK++MI V L + RTLHHDG GR GAGKV++R+A  GTGVIAG
Sbjct: 61  HGKAREVPEAIRKATEEAKKSMIRVPLRESRTLHHDGAGRWGAGKVMVRAAPPGTGVIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVV KS+GSSNP+N++RATFE L++QS PR VA +RG K S +  RR
Sbjct: 121 GPMRAVLETLGVQDVVGKSVGSSNPYNMVRATFEALKAQSSPRQVAAKRGKKVSDVIGRR 180


>gi|154253194|ref|YP_001414018.1| 30S ribosomal protein S5 [Parvibaculum lavamentivorans DS-1]
 gi|189045427|sp|A7HWS8|RS5_PARL1 RecName: Full=30S ribosomal protein S5
 gi|154157144|gb|ABS64361.1| ribosomal protein S5 [Parvibaculum lavamentivorans DS-1]
          Length = 186

 Score =  191 bits (484), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 112/188 (59%), Positives = 141/188 (75%), Gaps = 4/188 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+KE   RD    REERD+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MARKENRDRD----REERDSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 56

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR MI V L +GRTLHHD  GRHGAG+V++R+A  GTG+IAG
Sbjct: 57  HGKAREVPEAIRKATEAAKRAMIRVPLREGRTLHHDVDGRHGAGRVVLRAAPPGTGIIAG 116

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKS+GSSNP+N++RATF+ L+++  PR VA RRG K S +  RR
Sbjct: 117 GPMRAVFETLGVQDVVAKSLGSSNPYNMVRATFDALKNEQSPRMVAARRGKKVSEIVGRR 176

Query: 181 VVSSKSSS 188
             ++  + 
Sbjct: 177 SDAAAEAG 184


>gi|218289989|ref|ZP_03494166.1| ribosomal protein S5 [Alicyclobacillus acidocaldarius LAA1]
 gi|258512653|ref|YP_003186087.1| 30S ribosomal protein S5 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218239974|gb|EED07161.1| ribosomal protein S5 [Alicyclobacillus acidocaldarius LAA1]
 gi|257479379|gb|ACV59698.1| ribosomal protein S5 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 164

 Score =  191 bits (484), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 71/163 (43%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V +NRV+  + GGRRF+FS LVVVGD +  VG     A+EVP+A+RK
Sbjct: 2   RIDPNQLELTERVVHVNRVAKVVKGGRRFSFSALVVVGDGQGHVGAGLGKAQEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+++I V +    T+ H+ +G  GAGKV+++ A AG+GVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKHLIEVPIRK-TTIPHEALGHFGAGKVLIKPAPAGSGVIAGGPVRAVLELAGIK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           D+V KS+GS+NP N++ AT + L+    P +VA  RG     +
Sbjct: 121 DIVTKSLGSNNPINMVHATIDALKQLKRPEEVARLRGKSLEEI 163


>gi|153009303|ref|YP_001370518.1| 30S ribosomal protein S5 [Ochrobactrum anthropi ATCC 49188]
 gi|239832105|ref|ZP_04680434.1| ribosomal protein S5 [Ochrobactrum intermedium LMG 3301]
 gi|189045426|sp|A6X0D5|RS5_OCHA4 RecName: Full=30S ribosomal protein S5
 gi|151561191|gb|ABS14689.1| ribosomal protein S5 [Ochrobactrum anthropi ATCC 49188]
 gi|239824372|gb|EEQ95940.1| ribosomal protein S5 [Ochrobactrum intermedium LMG 3301]
          Length = 186

 Score =  190 bits (483), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 117/180 (65%), Positives = 145/180 (80%), Gaps = 2/180 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ+ER++ D    REERD+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQRERNREDRG--REERDSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR+MI V L  GRTLHHD  GRHGAGKV++R+A AG G+IAG
Sbjct: 59  HGKAREVPEAIRKATEAAKRDMIFVPLRSGRTLHHDVEGRHGAGKVLLRAAPAGKGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKS+GSSNP+N++RATF+ L+ Q HP+D+A +RGIK+S LQARR
Sbjct: 119 GPMRAVFETLGVQDVVAKSLGSSNPYNMVRATFDALKHQMHPKDIAAQRGIKYSTLQARR 178


>gi|329889144|ref|ZP_08267487.1| ribosomal protein S5 [Brevundimonas diminuta ATCC 11568]
 gi|328844445|gb|EGF94009.1| ribosomal protein S5 [Brevundimonas diminuta ATCC 11568]
          Length = 199

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 108/198 (54%), Positives = 140/198 (70%), Gaps = 7/198 (3%)

Query: 1   MAQK------ERSQRDNWQ-NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDT 53
           MA++      +R++RDN     E  D+ I++++V INRV+  + GGRRF+F+ L+VVGD 
Sbjct: 1   MAREPQRGGGDRNRRDNRNAPVEGPDSDIIEKLVHINRVAATVKGGRRFSFAALMVVGDG 60

Query: 54  KSKVGFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMA 113
           K +VGF H  AREVPEA+RKATE AK+ MI V L + RTLHHDG GR GAGK++MR+A  
Sbjct: 61  KGRVGFGHGKAREVPEAIRKATEEAKKTMIKVPLRENRTLHHDGSGRWGAGKIMMRAAPP 120

Query: 114 GTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKH 173
           GTGVIAGG +RAV E LG+ DVV KS GSSNP+N+IRATFE L+ QS PR +A++RG K 
Sbjct: 121 GTGVIAGGPMRAVLETLGVQDVVGKSTGSSNPYNMIRATFEALKVQSSPRQIASKRGKKV 180

Query: 174 SLLQARRVVSSKSSSYSR 191
           S L  RR   + +     
Sbjct: 181 SDLMGRRNDGASAPEAVE 198


>gi|167645595|ref|YP_001683258.1| 30S ribosomal protein S5 [Caulobacter sp. K31]
 gi|189045407|sp|B0T2D9|RS5_CAUSK RecName: Full=30S ribosomal protein S5
 gi|167348025|gb|ABZ70760.1| ribosomal protein S5 [Caulobacter sp. K31]
          Length = 201

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 103/188 (54%), Positives = 133/188 (70%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           + R +RD     E  D+ IV+++V INRV+  + GGRRF+F+ L+VVGD K +VG+ H  
Sbjct: 13  QNRGRRDRNAPEERVDSDIVEKLVHINRVAATVKGGRRFSFAALMVVGDQKGRVGYGHGK 72

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           AREVPEA+RKATE AK+ M+ V L + RTLHHDG GR GAGKV+MR+A  GTGVIAGG +
Sbjct: 73  AREVPEAIRKATEEAKKTMVRVPLRESRTLHHDGYGRWGAGKVMMRAAPPGTGVIAGGPM 132

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
           RAV E LG+ DVVAKS GSSNP+N++RATFE L+ QS PR +A +RG K   +  RR   
Sbjct: 133 RAVLETLGVQDVVAKSTGSSNPYNMVRATFEALKVQSSPRQIAAKRGKKVGDILGRRADG 192

Query: 184 SKSSSYSR 191
           + +     
Sbjct: 193 ASAPDAIE 200


>gi|121602355|ref|YP_989014.1| 30S ribosomal protein S5 [Bartonella bacilliformis KC583]
 gi|171769263|sp|A1USR1|RS5_BARBK RecName: Full=30S ribosomal protein S5
 gi|120614532|gb|ABM45133.1| ribosomal protein S5 [Bartonella bacilliformis KC583]
          Length = 189

 Score =  189 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 116/183 (63%), Positives = 143/183 (78%), Gaps = 1/183 (0%)

Query: 1   MAQKERSQ-RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGF 59
           MAQKERS   D+ + R E     +D++V INRV+  + GGRRF F+ LVVVGD K +VGF
Sbjct: 1   MAQKERSDHNDSDERRNESGGEFIDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGF 60

Query: 60  AHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIA 119
            H  AREVPEA+RKATE+AKR MI V L  GRTLHHD  GRHGAG+V++RSA AGTG+IA
Sbjct: 61  GHGKAREVPEAIRKATESAKREMIYVPLRSGRTLHHDVEGRHGAGRVLLRSASAGTGIIA 120

Query: 120 GGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           GG++RA+ E LGM DVVAKS+GSSNP+N++RATF+ L+ Q HPRD+A +RGIK+S LQAR
Sbjct: 121 GGSMRAIFETLGMQDVVAKSLGSSNPYNMVRATFDALKRQMHPRDIAAQRGIKYSTLQAR 180

Query: 180 RVV 182
           R  
Sbjct: 181 RQY 183


>gi|254780244|ref|YP_003064657.1| 30S ribosomal protein S5 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039921|gb|ACT56717.1| 30S ribosomal protein S5 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 199

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 199/199 (100%), Positives = 199/199 (100%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA
Sbjct: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG
Sbjct: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR
Sbjct: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180

Query: 181 VVSSKSSSYSRDSKNKGGN 199
           VVSSKSSSYSRDSKNKGGN
Sbjct: 181 VVSSKSSSYSRDSKNKGGN 199


>gi|158424161|ref|YP_001525453.1| 30S ribosomal protein S5 [Azorhizobium caulinodans ORS 571]
 gi|172047977|sp|A8IAP6|RS5_AZOC5 RecName: Full=30S ribosomal protein S5
 gi|158331050|dbj|BAF88535.1| ribosomal protein S5 [Azorhizobium caulinodans ORS 571]
          Length = 185

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 113/188 (60%), Positives = 143/188 (76%), Gaps = 4/188 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+     R++   RE+RDN+ VD++V INRV+  + GGRRF F+ LV+VGD K +VGF 
Sbjct: 1   MAR----DREHRAEREDRDNTFVDKLVHINRVAKVVKGGRRFGFAALVIVGDQKGRVGFG 56

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR +I V L +GRTLHHD  G HGAGKVI+R+A AGTG+IAG
Sbjct: 57  HGKAREVPEAIRKATESAKRALIRVPLREGRTLHHDVHGHHGAGKVILRAAPAGTGIIAG 116

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+HDVVAKS GSSNP+N++RATF+ L +Q  PR VA RRG+K S LQ+RR
Sbjct: 117 GPMRAVFETLGVHDVVAKSFGSSNPYNMVRATFDALTNQDSPRSVAARRGLKVSQLQSRR 176

Query: 181 VVSSKSSS 188
            V    ++
Sbjct: 177 RVEDAEAT 184


>gi|304391470|ref|ZP_07373412.1| ribosomal protein S5 [Ahrensia sp. R2A130]
 gi|303295699|gb|EFL90057.1| ribosomal protein S5 [Ahrensia sp. R2A130]
          Length = 191

 Score =  189 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 108/191 (56%), Positives = 144/191 (75%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ+      N +  E+ D+   D++V INRV+  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MAQRPERGGRNNRRDEKPDDGFTDKLVHINRVAKVVKGGKRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKA+EAAKR++I V L DGRTLHHD  GRHGAGK+IMR+A AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKASEAAKRDLIFVPLADGRTLHHDVHGRHGAGKIIMRAAPAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E++GM DVVAKS+GSSNP+N++RA F+ L+ Q HP+D+A++RG+K+S LQ RR
Sbjct: 121 GPVRAVFEMVGMSDVVAKSLGSSNPYNMVRAAFDGLKRQMHPKDIASQRGLKYSTLQERR 180

Query: 181 VVSSKSSSYSR 191
                + + + 
Sbjct: 181 RDLIGAEAGAE 191


>gi|49475777|ref|YP_033818.1| 30S ribosomal protein S5 [Bartonella henselae str. Houston-1]
 gi|73919032|sp|Q6G2Y2|RS5_BARHE RecName: Full=30S ribosomal protein S5
 gi|49238584|emb|CAF27825.1| 30S ribosomal protein s5 [Bartonella henselae str. Houston-1]
          Length = 182

 Score =  189 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 119/181 (65%), Positives = 143/181 (79%), Gaps = 6/181 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKERS+RD      ER++  VDR+V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERSERD------ERESEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEAVRKATE+AKR MI V L  GRTLHHD  G HGAG+V++RSA AGTG+IAG
Sbjct: 55  HGKAREVPEAVRKATESAKRGMIYVPLRSGRTLHHDLEGHHGAGRVLLRSASAGTGIIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM DVVAKS+GSSNP+N++RATF+ L+ Q HPRD+A +RGIK+S LQARR
Sbjct: 115 GPMRAIFETLGMQDVVAKSLGSSNPYNMVRATFDALKRQMHPRDIAAQRGIKYSTLQARR 174

Query: 181 V 181
            
Sbjct: 175 Q 175


>gi|329850224|ref|ZP_08265069.1| ribosomal protein S5 [Asticcacaulis biprosthecum C19]
 gi|328840539|gb|EGF90110.1| ribosomal protein S5 [Asticcacaulis biprosthecum C19]
          Length = 191

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 104/191 (54%), Positives = 137/191 (71%), Gaps = 1/191 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA +    R + ++R E  +  V+++VAINRV+  + GGRRF+F+ L+VVGD K +VG+ 
Sbjct: 1   MA-RPSDNRGDRRDRTEEPSEFVEKLVAINRVAATVKGGRRFSFAALMVVGDQKGRVGYG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE AK+++I V L + RTLHHDG GR GAGK+ MR+A  GTGVIAG
Sbjct: 60  HGKAREVPEAIRKATEEAKKSLIRVPLRESRTLHHDGYGRWGAGKIQMRAAPPGTGVIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVV KSIGSSNP+N++RATFE L+ QS PR +A++RG K + L  RR
Sbjct: 120 GPMRAVLETLGVSDVVGKSIGSSNPYNMVRATFEALKVQSSPRQIASKRGKKVADLLQRR 179

Query: 181 VVSSKSSSYSR 191
              + S     
Sbjct: 180 NDGASSPEAME 190


>gi|254420072|ref|ZP_05033796.1| ribosomal protein S5 [Brevundimonas sp. BAL3]
 gi|196186249|gb|EDX81225.1| ribosomal protein S5 [Brevundimonas sp. BAL3]
          Length = 202

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 102/177 (57%), Positives = 129/177 (72%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +  D+ IV+++V INRV+  + GGRRF+F+ L+VVGD K +VGF H  AREVPEA+RKAT
Sbjct: 26  DGPDSDIVEKLVHINRVAATVKGGRRFSFAALMVVGDGKGRVGFGHGKAREVPEAIRKAT 85

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+ MI V L + RTLHHDG GR GAGK++MR+A  GTGVIAGG +RAV E LG+ DV
Sbjct: 86  EEAKKTMIRVPLRENRTLHHDGNGRWGAGKIMMRAAPPGTGVIAGGPMRAVLETLGVQDV 145

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           V KS GSSNP+N+IRATFE L+ QS PR VA++RG K + L  RR   + +      
Sbjct: 146 VGKSTGSSNPYNMIRATFEALKVQSSPRQVASKRGKKVADLMGRRNDGASAPEAVES 202


>gi|254470510|ref|ZP_05083914.1| ribosomal protein S5 [Pseudovibrio sp. JE062]
 gi|211960821|gb|EEA96017.1| ribosomal protein S5 [Pseudovibrio sp. JE062]
          Length = 187

 Score =  188 bits (477), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 110/185 (59%), Positives = 143/185 (77%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           R + ++REERD+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVP
Sbjct: 3   RQDNRDREERDSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVP 62

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           EA+RKATEAAKR M+ V L +GRTLHHD  GRHGAGKV++R+A AGTG+IAGG +RAV E
Sbjct: 63  EAIRKATEAAKRTMVRVPLREGRTLHHDVEGRHGAGKVVLRAAPAGTGIIAGGPMRAVFE 122

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            LG+ DVVAKS+G+SNP+N++RATF+ L+ +  PR VA RRG+K S LQARR  +  ++ 
Sbjct: 123 TLGVQDVVAKSLGTSNPYNMVRATFDALKKEDSPRSVAARRGLKVSSLQARRRDNDDAAP 182

Query: 189 YSRDS 193
              ++
Sbjct: 183 VKAEA 187


>gi|328543375|ref|YP_004303484.1| 30S ribosomal protein S5 [Polymorphum gilvum SL003B-26A1]
 gi|326413120|gb|ADZ70183.1| 30S ribosomal protein S5 [Polymorphum gilvum SL003B-26A1]
          Length = 189

 Score =  188 bits (477), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 115/193 (59%), Positives = 147/193 (76%), Gaps = 4/193 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++  +RD    REERD+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MARQDMRERD----REERDSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 56

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR MI V L +GRTLHHD  GRHGAGKVI+R+A AGTG+IAG
Sbjct: 57  HGKAREVPEAIRKATEAAKRAMIRVPLREGRTLHHDVEGRHGAGKVILRAAPAGTGIIAG 116

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKS+GSSNP+N++RATF  L  +  PR VA RRG+K S+LQ+RR
Sbjct: 117 GPMRAVFETLGVQDVVAKSLGSSNPYNMVRATFAALTKEDSPRSVAARRGLKVSVLQSRR 176

Query: 181 VVSSKSSSYSRDS 193
             + ++   + ++
Sbjct: 177 RDTDEAVPAAAEA 189


>gi|240850818|ref|YP_002972218.1| 30S ribosomal protein S5 [Bartonella grahamii as4aup]
 gi|240267941|gb|ACS51529.1| 30S ribosomal protein S5 [Bartonella grahamii as4aup]
          Length = 182

 Score =  187 bits (475), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 121/181 (66%), Positives = 143/181 (79%), Gaps = 6/181 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKER +R      EERDN  VDR+V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERGER------EERDNEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEAVRKATE+AKR MI V L  GRTLHHD  GRHGAG+V++RSA AGTG+IAG
Sbjct: 55  HGKAREVPEAVRKATESAKRGMIYVPLRSGRTLHHDLEGRHGAGRVLLRSASAGTGIIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM DVVAKS+GSSNP+N++RATF+ L+ Q HPRD+A +RGIK+S LQARR
Sbjct: 115 GPMRAIFEALGMQDVVAKSLGSSNPYNMVRATFDALKHQMHPRDIAAQRGIKYSTLQARR 174

Query: 181 V 181
            
Sbjct: 175 R 175


>gi|23097591|ref|NP_691057.1| 30S ribosomal protein S5 [Oceanobacillus iheyensis HTE831]
 gi|26399345|sp|P59123|RS5_OCEIH RecName: Full=30S ribosomal protein S5
 gi|22775814|dbj|BAC12092.1| 30S ribosomal protein S5 [Oceanobacillus iheyensis HTE831]
          Length = 167

 Score =  187 bits (475), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 106/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA++K
Sbjct: 4   NIDPNKLDLEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIKK 63

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A + AK+N+ISV ++ G T+ H+  G+ G+G V+M+ A  GTGVI+GG +RA+ E+ G+ 
Sbjct: 64  AVDDAKKNLISVPIV-GTTIPHEIHGQFGSGNVLMKPAAEGTGVISGGPVRAILELAGVG 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+ P N+IRAT   L +     DVA  RG     L  
Sbjct: 123 DILTKSLGSNTPINMIRATLNGLTNLKTAEDVAKLRGKSVEELLG 167


>gi|302382635|ref|YP_003818458.1| ribosomal protein S5 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193263|gb|ADL00835.1| ribosomal protein S5 [Brevundimonas subvibrioides ATCC 15264]
          Length = 208

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 104/181 (57%), Positives = 133/181 (73%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +  D+ IV+++V INRV+  + GGRRF+F+ L+VVGD K +VGF H  AREVPEA+RKAT
Sbjct: 28  DGPDSDIVEKLVHINRVAATVKGGRRFSFAALMVVGDGKGRVGFGHGKAREVPEAIRKAT 87

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+ MI V L + RTLHHDG GR GAGK++MR+A  GTGVIAGG +RAV E LG+ DV
Sbjct: 88  EEAKKTMIRVPLRENRTLHHDGNGRWGAGKIMMRAAPPGTGVIAGGPMRAVLETLGVADV 147

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKN 195
           VAKS GSSNP+N+IRATFE L+ QS PR VA++RG K S L  RR   + +   + ++  
Sbjct: 148 VAKSTGSSNPYNMIRATFEALKVQSSPRQVASKRGKKVSDLMGRRNDGASAIEAAPEAVE 207

Query: 196 K 196
            
Sbjct: 208 S 208


>gi|288957439|ref|YP_003447780.1| small subunit ribosomal protein S5 [Azospirillum sp. B510]
 gi|288909747|dbj|BAI71236.1| small subunit ribosomal protein S5 [Azospirillum sp. B510]
          Length = 189

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 98/189 (51%), Positives = 131/189 (69%), Gaps = 1/189 (0%)

Query: 1   MAQKE-RSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGF 59
           MA++       + Q RE  ++ +++++V INRV+  + GGRRF F+ LVVVGD K +VG 
Sbjct: 1   MARERGERDNRDRQPREREESELIEKLVGINRVAKVVKGGRRFGFAALVVVGDGKGRVGV 60

Query: 60  AHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIA 119
               AREVPEA+RKAT+ AKR MI V L +GRTLHHD  G  GAGKV++R+A AGTG+IA
Sbjct: 61  GSGKAREVPEAIRKATDQAKRGMIRVPLREGRTLHHDSNGHFGAGKVVLRAAPAGTGIIA 120

Query: 120 GGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           GG +RA+ E LG+ DVV KSIG+SNPHN+I+ATF+ L   + PR VA RRG + S +  R
Sbjct: 121 GGPMRAIFEALGVADVVTKSIGTSNPHNMIKATFDALTQVTSPRSVAARRGRRVSDILGR 180

Query: 180 RVVSSKSSS 188
           R   +   +
Sbjct: 181 REAGAGQEA 189


>gi|163868633|ref|YP_001609842.1| 30S ribosomal protein S5 [Bartonella tribocorum CIP 105476]
 gi|254764627|sp|A9IW04|RS5_BART1 RecName: Full=30S ribosomal protein S5
 gi|161018289|emb|CAK01847.1| 30S ribosomal protein S5 [Bartonella tribocorum CIP 105476]
          Length = 182

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 121/181 (66%), Positives = 143/181 (79%), Gaps = 6/181 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKER +R      EERDN  VDR+V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERGER------EERDNEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEAVRKATE+AKR MI V L  GRTLHHD  GRHGAG+V++RSA AGTG+IAG
Sbjct: 55  HGKAREVPEAVRKATESAKRGMIYVPLRSGRTLHHDLEGRHGAGRVLLRSASAGTGIIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM DVVAKS+GSSNP+N++RATF+ L+ Q HPRD+A +RGIK+S LQARR
Sbjct: 115 GPMRAIFEALGMQDVVAKSLGSSNPYNMVRATFDALKHQMHPRDIAAQRGIKYSTLQARR 174

Query: 181 V 181
            
Sbjct: 175 R 175


>gi|317126878|ref|YP_004093160.1| ribosomal protein S5 [Bacillus cellulosilyticus DSM 2522]
 gi|315471826|gb|ADU28429.1| ribosomal protein S5 [Bacillus cellulosilyticus DSM 2522]
          Length = 165

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 79/165 (47%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A EVPEA+RK
Sbjct: 2   RIDPNKLELEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGMGKALEVPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I+V +  G T+ H   GR GAG V ++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AIEDAKKNLIAVPI-QGTTIPHQITGRFGAGSVFLKPASEGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+NP N++RAT E LR    P DVA  RG     L  
Sbjct: 121 DILSKSLGSNNPINMVRATIEGLRDVKSPEDVAKLRGKTVEELLG 165


>gi|220930982|ref|YP_002507890.1| ribosomal protein S5 [Halothermothrix orenii H 168]
 gi|219992292|gb|ACL68895.1| ribosomal protein S5 [Halothermothrix orenii H 168]
          Length = 166

 Score =  186 bits (473), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +N +     + +R+V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+R
Sbjct: 2   KNIDPDKLDLEERVVNINRVAKVVKGGRRFSFSALVVVGDGNGHVGVGFGKANEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E  K+N+I V +++  T+ H+ VG  GAGKV+++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KGVEDGKKNLIKVPIVN-TTIPHEIVGEFGAGKVLLKPAAPGTGVIAGGPVRAVVELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GSSNP N+++AT   L       +VA+ RG     L  
Sbjct: 121 GDILTKSLGSSNPINMVKATLTGLSQLKTIEEVADLRGKDVEELMG 166


>gi|163760816|ref|ZP_02167895.1| 30S ribosomal protein S5 [Hoeflea phototrophica DFL-43]
 gi|162281860|gb|EDQ32152.1| 30S ribosomal protein S5 [Hoeflea phototrophica DFL-43]
          Length = 186

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 114/188 (60%), Positives = 143/188 (76%), Gaps = 2/188 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R  RDN    EERD+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAKEGR--RDNRGREEERDSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR++I V L  GRTLHHD  GRHGAGKV++RSA  GTG+IAG
Sbjct: 59  HGKAREVPEAIRKATESAKRDLIFVPLRSGRTLHHDVHGRHGAGKVLLRSAKPGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LGM DVVAKS GSSNP+N++RATF+ L++Q HP+D+A +R IK+S LQ RR
Sbjct: 119 GPMRAVFETLGMQDVVAKSTGSSNPYNMVRATFDALKNQMHPKDIAAQRSIKYSTLQERR 178

Query: 181 VVSSKSSS 188
             ++    
Sbjct: 179 GPAAGGEE 186


>gi|323490640|ref|ZP_08095845.1| 30S ribosomal protein S5 [Planococcus donghaensis MPA1U2]
 gi|323395732|gb|EGA88573.1| 30S ribosomal protein S5 [Planococcus donghaensis MPA1U2]
          Length = 166

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 104/166 (62%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V INRV+  + GGRRF FS LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   RRIDPNKLELEERVVTINRVAKVVKGGRRFRFSALVVVGDKNGNVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++   T  H  +GR GAG+++++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLIEVPMVK-GTTPHLVIGRFGAGQILIKPASPGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GSS P N++RAT   L       +VA  RG     L  
Sbjct: 121 QDILSKSLGSSTPINMVRATINGLTQLKSADEVAKLRGKSIEELLG 166


>gi|319405881|emb|CBI79513.1| 30S ribosomal protein S5 [Bartonella sp. AR 15-3]
          Length = 182

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 6/181 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKERS RD      ER++  +DR+V INRVS  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERSDRD------ERNSEFIDRLVHINRVSKVVKGGRRFGFAALVVVGDQKGRVGFG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEAVRKATE+AKR MI V L  GRTLHHD  GRHGAG V++R+A AGTG+IAG
Sbjct: 55  HGKAREVPEAVRKATESAKREMIYVPLRSGRTLHHDVEGRHGAGYVLLRAASAGTGIIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM D+VAKS+GSSNP+N++RATF+ L+ Q HP+++A +RGIK+S+LQARR
Sbjct: 115 GPMRAIFETLGMQDIVAKSLGSSNPYNMVRATFDALKHQVHPKNIAAQRGIKYSVLQARR 174

Query: 181 V 181
            
Sbjct: 175 Q 175


>gi|115525568|ref|YP_782479.1| 30S ribosomal protein S5 [Rhodopseudomonas palustris BisA53]
 gi|122295424|sp|Q07KN5|RS5_RHOP5 RecName: Full=30S ribosomal protein S5
 gi|115519515|gb|ABJ07499.1| SSU ribosomal protein S5P [Rhodopseudomonas palustris BisA53]
          Length = 190

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 110/181 (60%), Positives = 137/181 (75%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA +      +   REERD+  VD++V INRV+  + GG+RF F+ LVV+GD K +VGF 
Sbjct: 1   MAGERERGGRDRGPREERDSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKRN+  V L +GRTLHHD  GRHGAG+V +R+A AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATESAKRNLTRVPLREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKSIGSSNP+N++RATF+ L+ Q  PR VA RR IK S LQ+RR
Sbjct: 121 GPMRAVFETLGIQDVVAKSIGSSNPYNMVRATFDALKHQDSPRSVAARRNIKVSTLQSRR 180

Query: 181 V 181
           V
Sbjct: 181 V 181


>gi|297582467|ref|YP_003698247.1| 30S ribosomal protein S5 [Bacillus selenitireducens MLS10]
 gi|297140924|gb|ADH97681.1| ribosomal protein S5 [Bacillus selenitireducens MLS10]
          Length = 165

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     I +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A EVPEA+RK
Sbjct: 2   RIDPTKLEIEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGMGKALEVPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E  K+NMI V +  G T+ H   G+ GAG V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AIEDGKKNMIQVPI-QGTTIPHQITGKFGAGSVLLKPASEGTGVIAGGPVRAVLELAGIG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+NP N++RAT + L     P +VA  RG     L  
Sbjct: 121 DILSKSLGSNNPINMVRATIQGLDEMKSPEEVAKLRGKSVEELLG 165


>gi|152973973|ref|YP_001373490.1| 30S ribosomal protein S5 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|171769268|sp|A7GK37|RS5_BACCN RecName: Full=30S ribosomal protein S5
 gi|152022725|gb|ABS20495.1| ribosomal protein S5 [Bacillus cytotoxicus NVH 391-98]
          Length = 166

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   RRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V L+ G ++ H+ +G  GAG+V ++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLIEVPLV-GTSIPHEIIGHFGAGEVFLKPAAEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT   L       +VA  RG     L  
Sbjct: 121 QDILSKSLGSNTPINMIRATVNGLSELKRAEEVAKLRGKSVEELLG 166


>gi|84515653|ref|ZP_01003014.1| 30S ribosomal protein S5 [Loktanella vestfoldensis SKA53]
 gi|84510095|gb|EAQ06551.1| 30S ribosomal protein S5 [Loktanella vestfoldensis SKA53]
          Length = 194

 Score =  186 bits (471), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 107/192 (55%), Positives = 143/192 (74%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++ ++  N + REE+     DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MAERDNNRGGNRRPREEQAPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V+L DGRTLHHD  GRHGAG+V+MRSA AGTG+IAG
Sbjct: 61  KGKAKEVPEAIRKATEQAKRQMIRVALRDGRTLHHDIEGRHGAGRVVMRSAPAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVV+KSIGS NP+N+IRAT + L+ +  PR+VA RRG K + +  +R
Sbjct: 121 GPMRAVFEMLGVQDVVSKSIGSQNPYNMIRATMDGLQKEQSPRNVAQRRGKKVADILPKR 180

Query: 181 VVSSKSSSYSRD 192
             ++ +S+   +
Sbjct: 181 EDAADTSAQVAE 192


>gi|228989335|ref|ZP_04149326.1| 30S ribosomal protein S5 [Bacillus pseudomycoides DSM 12442]
 gi|228995518|ref|ZP_04155186.1| 30S ribosomal protein S5 [Bacillus mycoides Rock3-17]
 gi|229003143|ref|ZP_04160989.1| 30S ribosomal protein S5 [Bacillus mycoides Rock1-4]
 gi|228758106|gb|EEM07305.1| 30S ribosomal protein S5 [Bacillus mycoides Rock1-4]
 gi|228764247|gb|EEM13126.1| 30S ribosomal protein S5 [Bacillus mycoides Rock3-17]
 gi|228770413|gb|EEM18986.1| 30S ribosomal protein S5 [Bacillus pseudomycoides DSM 12442]
          Length = 166

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+RK
Sbjct: 3   RIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I+V L+ G T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  AIEDAKKNLITVPLV-GTTIPHTINGHFGAGEVFLKPAAEGTGVIAGGPVRAVLELAGVQ 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+ P N+IRAT   L       DVA  RG     L  
Sbjct: 122 DILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEELLG 166


>gi|163796902|ref|ZP_02190859.1| 30S ribosomal protein S5 [alpha proteobacterium BAL199]
 gi|159177891|gb|EDP62440.1| 30S ribosomal protein S5 [alpha proteobacterium BAL199]
          Length = 191

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 98/179 (54%), Positives = 132/179 (73%), Gaps = 1/179 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+ +R  R N Q+R   D+ +++++V INRV+  + GGRRF F+ +V+VGD + +VG  
Sbjct: 1   MARTDRQDR-NKQDRNREDSDLIEKLVGINRVAKVVKGGRRFGFAAIVIVGDQRGRVGHG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVPEA+RKATE AKR MI V L +GRTLHHD  GR GAGKV +R+A AGTG+IAG
Sbjct: 60  SGKAREVPEAIRKATEQAKRTMIRVPLREGRTLHHDINGRFGAGKVTLRAATAGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           G +RA+ E LG+HDVVAKS+G+SNPHN+I+ATF+ L +   PR +A +RG K + +  R
Sbjct: 120 GPMRAIFEALGVHDVVAKSLGTSNPHNMIKATFDALVNIQSPRAIAGKRGKKVAEIFGR 178


>gi|146340074|ref|YP_001205122.1| 30S ribosomal protein S5 [Bradyrhizobium sp. ORS278]
 gi|146192880|emb|CAL76885.1| 30S ribosomal subunit protein S5 [Bradyrhizobium sp. ORS278]
          Length = 194

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 110/190 (57%), Positives = 140/190 (73%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA +      + + REERD+  VD++V INRV+  + GG+RF F+ LVV+GD K +VGF 
Sbjct: 5   MAGERERGGRDRKEREERDSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFG 64

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKAT++AKRN+  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAG
Sbjct: 65  HGKAREVPEAIRKATDSAKRNLTRVALREGRTLHHDIFGRHGAGRVYLRAAPAGTGIIAG 124

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKSIGSSNP+N++RATF  L+ Q  PR VA RR IK S LQARR
Sbjct: 125 GPMRAVFETLGIQDVVAKSIGSSNPYNMVRATFNALKHQDSPRSVAARRNIKVSTLQARR 184

Query: 181 VVSSKSSSYS 190
           V     ++  
Sbjct: 185 VGGDAEAAAD 194


>gi|49474387|ref|YP_032429.1| 30S ribosomal protein S5 [Bartonella quintana str. Toulouse]
 gi|73919033|sp|Q6FZD9|RS5_BARQU RecName: Full=30S ribosomal protein S5
 gi|49239891|emb|CAF26289.1| 30s ribosomal protein s5 [Bartonella quintana str. Toulouse]
          Length = 182

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 121/181 (66%), Positives = 143/181 (79%), Gaps = 6/181 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKER +RD      ERD   VDR+V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERGERD------ERDGEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEAVRKATEAAKR MI V L  GRTLHHD  GRHGAG+V++RSA AGTG+IAG
Sbjct: 55  HGKAREVPEAVRKATEAAKRGMIYVPLRSGRTLHHDLEGRHGAGRVLLRSASAGTGIIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM DVVAKS+GSSNP+N++RATF+ L+ Q HPRD+A +RGIK+S+LQARR
Sbjct: 115 GPMRAIFETLGMQDVVAKSLGSSNPYNMVRATFDALKHQMHPRDIAVQRGIKYSILQARR 174

Query: 181 V 181
            
Sbjct: 175 Q 175


>gi|229009636|ref|ZP_04166862.1| 30S ribosomal protein S5 [Bacillus mycoides DSM 2048]
 gi|229131135|ref|ZP_04260047.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-ST196]
 gi|229165115|ref|ZP_04292910.1| 30S ribosomal protein S5 [Bacillus cereus AH621]
 gi|228618378|gb|EEK75408.1| 30S ribosomal protein S5 [Bacillus cereus AH621]
 gi|228652348|gb|EEL08273.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-ST196]
 gi|228751658|gb|EEM01458.1| 30S ribosomal protein S5 [Bacillus mycoides DSM 2048]
          Length = 166

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 104/166 (62%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   QRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I+V L+ G T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLIAVPLV-GTTIPHTINGHFGAGEVFLKPAAEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT   L       DVA  RG     L  
Sbjct: 121 QDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEELLG 166


>gi|307946303|ref|ZP_07661638.1| ribosomal protein S5 [Roseibium sp. TrichSKD4]
 gi|307769967|gb|EFO29193.1| ribosomal protein S5 [Roseibium sp. TrichSKD4]
          Length = 188

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 109/173 (63%), Positives = 135/173 (78%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           R + + R+ERD+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVP
Sbjct: 3   RQDNRERDERDSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVP 62

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           EA+RKATEAAKR MI V L +GRTLHHD  GRHGAGKVI+RSA  GTG+IAGG +RAV E
Sbjct: 63  EAIRKATEAAKRTMIRVPLREGRTLHHDVEGRHGAGKVILRSAPPGTGIIAGGPMRAVFE 122

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
            LG+ DVVAKS+G+SNP+N++RATF  L  +  PR VA RRG+K S++Q+RR 
Sbjct: 123 TLGVQDVVAKSLGTSNPYNMVRATFAALTKEDSPRSVAARRGLKVSVIQSRRR 175


>gi|319404408|emb|CBI78011.1| 30S ribosomal protein S5 [Bartonella rochalimae ATCC BAA-1498]
          Length = 182

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 116/181 (64%), Positives = 142/181 (78%), Gaps = 6/181 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKERS RD      ERD+  VD++V INRVS  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERSDRD------ERDSEFVDKLVHINRVSKVVKGGRRFGFAALVVVGDQKGRVGFG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEAVRKATE+AKR MI V L  GRTLHHD  GRHGAG V++R+A AGTG+IAG
Sbjct: 55  HGKAREVPEAVRKATESAKREMIHVPLRSGRTLHHDVEGRHGAGYVLLRAASAGTGIIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM DV+AKS+GSSNP+N++RATF+ L+ Q HP+ +A +RGIK+S+LQ+RR
Sbjct: 115 GPMRAIFETLGMQDVIAKSLGSSNPYNMVRATFDALKRQVHPKSIAAQRGIKYSVLQSRR 174

Query: 181 V 181
            
Sbjct: 175 Q 175


>gi|89100332|ref|ZP_01173197.1| 30S ribosomal protein S5 [Bacillus sp. NRRL B-14911]
 gi|89084953|gb|EAR64089.1| 30S ribosomal protein S5 [Bacillus sp. NRRL B-14911]
          Length = 166

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 106/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+RK
Sbjct: 3   RIDPNKLELEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGHVGFGTGKAQEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I V ++ G T+ H  +G  GAG+++++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  AIEDAKKNLIEVPMV-GTTIPHQIIGHFGAGEILLKPASEGTGVIAGGPVRAVLELAGVA 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+G++ P N++RAT E L +     DVA  RG     L  
Sbjct: 122 DILSKSLGTNTPINMVRATLEGLNNLKRAEDVAKLRGKSVEELLG 166


>gi|163938135|ref|YP_001643019.1| 30S ribosomal protein S5 [Bacillus weihenstephanensis KBAB4]
 gi|229053973|ref|ZP_04195407.1| 30S ribosomal protein S5 [Bacillus cereus AH603]
 gi|163860332|gb|ABY41391.1| ribosomal protein S5 [Bacillus weihenstephanensis KBAB4]
 gi|228721391|gb|EEL72912.1| 30S ribosomal protein S5 [Bacillus cereus AH603]
          Length = 166

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 104/166 (62%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   QRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I+V L+ G T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLIAVPLV-GTTIPHTINGHFGAGEVFLKPAAEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+G++ P N+IRAT   L       DVA  RG     L  
Sbjct: 121 QDILSKSLGTNTPINMIRATVNGLSELKRAEDVAKLRGKSVEELLG 166


>gi|293375406|ref|ZP_06621687.1| ribosomal protein S5 [Turicibacter sanguinis PC909]
 gi|325844463|ref|ZP_08168190.1| ribosomal protein S5 [Turicibacter sp. HGF1]
 gi|292645959|gb|EFF63988.1| ribosomal protein S5 [Turicibacter sanguinis PC909]
 gi|325489137|gb|EGC91521.1| ribosomal protein S5 [Turicibacter sp. HGF1]
          Length = 167

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 72/167 (43%), Positives = 106/167 (63%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            Q  +  + ++ +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+
Sbjct: 2   RQIIDPSNLTLEERVVTINRVTKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA E+AK+N+I V ++ G T+ H   G  G+G V+++ A AGTGVIAGG +R V E+ G
Sbjct: 62  KKAVESAKKNLIYVPIV-GTTIPHQITGEFGSGSVLLKPASAGTGVIAGGPVRNVLELAG 120

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + D+++KS+GS+ P N++RAT   L +      VA  RG     +  
Sbjct: 121 VQDILSKSLGSNTPINMVRATINGLENLKTVERVAELRGKTVEEILG 167


>gi|212637971|ref|YP_002314491.1| 30S ribosomal protein S5 [Anoxybacillus flavithermus WK1]
 gi|226703326|sp|B7GJ84|RS5_ANOFW RecName: Full=30S ribosomal protein S5
 gi|212559451|gb|ACJ32506.1| Ribosomal protein S5 [Anoxybacillus flavithermus WK1]
          Length = 166

 Score =  185 bits (469), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+VA+NRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   RRIDPNKLELEERVVAVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I+V ++ G T+ H+ +G  GAG++I++ A  GTGVIAGG  RAV E+ G+
Sbjct: 62  KAIEDAKKNLITVPIV-GTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KSIGS+ P N++RAT + L+      +VA  RG     L  
Sbjct: 121 SDILSKSIGSNTPINMVRATIDGLKQLKRAEEVAKLRGKTVEELLG 166


>gi|319407409|emb|CBI81060.1| 30S ribosomal protein S5 [Bartonella sp. 1-1C]
          Length = 182

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 118/181 (65%), Positives = 142/181 (78%), Gaps = 6/181 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKERS RD      ERD+  VD++V INRVS  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQKERSDRD------ERDSEFVDKLVHINRVSKVVKGGRRFGFAALVVVGDQKGRVGFG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEAVRKATEAAKR MI V L  GRTLHHD  GRHGAG V++R+A AGTG+IAG
Sbjct: 55  HGKAREVPEAVRKATEAAKREMIHVPLRSGRTLHHDVEGRHGAGYVLLRAASAGTGIIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM DVVAKS+GSSNP+N++RATF+ L+ Q HP+ +A +RGIK+S+LQ+RR
Sbjct: 115 GPMRAIFETLGMQDVVAKSLGSSNPYNMVRATFDALKRQVHPKSIAAQRGIKYSVLQSRR 174

Query: 181 V 181
            
Sbjct: 175 Q 175


>gi|148256375|ref|YP_001240960.1| 30S ribosomal protein S5 [Bradyrhizobium sp. BTAi1]
 gi|172047000|sp|A4YSK9|RS5_BRASO RecName: Full=30S ribosomal protein S5
 gi|172047311|sp|A5ELL0|RS5_BRASB RecName: Full=30S ribosomal protein S5
 gi|146408548|gb|ABQ37054.1| SSU ribosomal protein S5P [Bradyrhizobium sp. BTAi1]
          Length = 190

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 110/190 (57%), Positives = 140/190 (73%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA +      + + REERD+  VD++V INRV+  + GG+RF F+ LVV+GD K +VGF 
Sbjct: 1   MAGERERGGRDRKEREERDSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKAT++AKRN+  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATDSAKRNLTRVALREGRTLHHDIFGRHGAGRVYLRAAPAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKSIGSSNP+N++RATF  L+ Q  PR VA RR IK S LQARR
Sbjct: 121 GPMRAVFETLGIQDVVAKSIGSSNPYNMVRATFNALKHQDSPRSVAARRNIKVSTLQARR 180

Query: 181 VVSSKSSSYS 190
           V     ++  
Sbjct: 181 VGGDAEAAAD 190


>gi|56418658|ref|YP_145976.1| 30S ribosomal protein S5 [Geobacillus kaustophilus HTA426]
 gi|261417624|ref|YP_003251306.1| 30S ribosomal protein S5 [Geobacillus sp. Y412MC61]
 gi|297528499|ref|YP_003669774.1| ribosomal protein S5 [Geobacillus sp. C56-T3]
 gi|319765282|ref|YP_004130783.1| ribosomal protein S5 [Geobacillus sp. Y412MC52]
 gi|73919055|sp|Q5L3S2|RS5_GEOKA RecName: Full=30S ribosomal protein S5
 gi|56378500|dbj|BAD74408.1| 30S ribosomal protein S5 [Geobacillus kaustophilus HTA426]
 gi|261374081|gb|ACX76824.1| ribosomal protein S5 [Geobacillus sp. Y412MC61]
 gi|297251751|gb|ADI25197.1| ribosomal protein S5 [Geobacillus sp. C56-T3]
 gi|317110148|gb|ADU92640.1| ribosomal protein S5 [Geobacillus sp. Y412MC52]
          Length = 166

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+VA+NRV+  + GGRR  FS LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RRIDPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +G  GAG++I++ A  GTGVIAGG  RAV E+ G+
Sbjct: 62  KAIEDAKKNLIEVPIV-GTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KSIGS+ P N++RATF+ L+      DVA  RG     L  
Sbjct: 121 SDILSKSIGSNTPINMVRATFDGLKQLKRAEDVARLRGKTVEELLG 166


>gi|295694854|ref|YP_003588092.1| ribosomal protein S5 [Bacillus tusciae DSM 2912]
 gi|295410456|gb|ADG04948.1| ribosomal protein S5 [Bacillus tusciae DSM 2912]
          Length = 165

 Score =  184 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++VAINRV+  + GGRRF+FS +VVVGD    VG     A EVP+A+RK
Sbjct: 2   RVDPNQLELTEKVVAINRVAKVVKGGRRFSFSAVVVVGDGNGWVGAGLGKAGEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+  V L  G TL H+ VG  GAGKV+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLFHVPLR-GTTLPHEVVGHFGAGKVLLKPASPGTGVIAGGPVRAVLELAGVK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+NP N++ AT   L+    P +VA  RG     +  
Sbjct: 121 DILTKSLGSNNPLNMVNATITGLKQLKRPEEVARLRGKTLQEILG 165


>gi|254294423|ref|YP_003060446.1| 30S ribosomal protein S5 [Hirschia baltica ATCC 49814]
 gi|254042954|gb|ACT59749.1| ribosomal protein S5 [Hirschia baltica ATCC 49814]
          Length = 192

 Score =  184 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 106/192 (55%), Positives = 141/192 (73%), Gaps = 1/192 (0%)

Query: 1   MAQKERSQR-DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGF 59
           MA+  R +     ++R+E  + IVD++VAINRV+  + GG+ F F+ LVVVGD K +VGF
Sbjct: 1   MARDNRERGGRKGRDRDEEQSEIVDKLVAINRVAKVVKGGKNFGFAALVVVGDQKGRVGF 60

Query: 60  AHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIA 119
            H  AREVPEA+RKATE AK+ M+ V L +GRTLHHDG GR GAGKV +R+A AGTGVIA
Sbjct: 61  GHGKAREVPEAIRKATEEAKKTMVRVPLREGRTLHHDGSGRWGAGKVHLRAAPAGTGVIA 120

Query: 120 GGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           GG +RAV EVLG+ DVVAKSIGSSNP+N++RAT + L+ Q+ PR VA++RG+K   +  R
Sbjct: 121 GGPMRAVLEVLGVQDVVAKSIGSSNPYNMVRATVQALKGQASPRQVASKRGLKVQDIVGR 180

Query: 180 RVVSSKSSSYSR 191
           R   +  +  ++
Sbjct: 181 RTDGAGVAEVAQ 192


>gi|30260318|ref|NP_842695.1| 30S ribosomal protein S5 [Bacillus anthracis str. Ames]
 gi|42779208|ref|NP_976455.1| 30S ribosomal protein S5 [Bacillus cereus ATCC 10987]
 gi|47525383|ref|YP_016732.1| 30S ribosomal protein S5 [Bacillus anthracis str. 'Ames Ancestor']
 gi|47570524|ref|ZP_00241151.1| ribosomal protein S5 [Bacillus cereus G9241]
 gi|49183161|ref|YP_026413.1| 30S ribosomal protein S5 [Bacillus anthracis str. Sterne]
 gi|49481680|ref|YP_034479.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145091|ref|YP_081738.1| 30S ribosomal protein S5 [Bacillus cereus E33L]
 gi|65317576|ref|ZP_00390535.1| COG0098: Ribosomal protein S5 [Bacillus anthracis str. A2012]
 gi|170689731|ref|ZP_02880904.1| ribosomal protein S5 [Bacillus anthracis str. A0465]
 gi|170709452|ref|ZP_02899857.1| ribosomal protein S5 [Bacillus anthracis str. A0389]
 gi|177656219|ref|ZP_02937181.1| ribosomal protein S5 [Bacillus anthracis str. A0174]
 gi|190569426|ref|ZP_03022309.1| ribosomal protein S5 [Bacillus anthracis Tsiankovskii-I]
 gi|196036971|ref|ZP_03104344.1| ribosomal protein S5 [Bacillus cereus W]
 gi|196042426|ref|ZP_03109686.1| ribosomal protein S5 [Bacillus cereus NVH0597-99]
 gi|206972321|ref|ZP_03233268.1| 30S ribosomal protein S5 [Bacillus cereus AH1134]
 gi|217957702|ref|YP_002336246.1| 30S ribosomal protein S5 [Bacillus cereus AH187]
 gi|218234482|ref|YP_002364976.1| 30S ribosomal protein S5 [Bacillus cereus B4264]
 gi|218895262|ref|YP_002443673.1| ribosomal protein S5 [Bacillus cereus G9842]
 gi|218901331|ref|YP_002449165.1| ribosomal protein S5 [Bacillus cereus AH820]
 gi|222093897|ref|YP_002527947.1| 30S ribosomal protein s5 [Bacillus cereus Q1]
 gi|225862179|ref|YP_002747557.1| 30S ribosomal protein S5 [Bacillus cereus 03BB102]
 gi|227812800|ref|YP_002812809.1| 30S ribosomal protein S5 [Bacillus anthracis str. CDC 684]
 gi|228898880|ref|ZP_04063162.1| 30S ribosomal protein S5 [Bacillus thuringiensis IBL 4222]
 gi|228905924|ref|ZP_04069821.1| 30S ribosomal protein S5 [Bacillus thuringiensis IBL 200]
 gi|228912866|ref|ZP_04076513.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228919077|ref|ZP_04082456.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228925380|ref|ZP_04088476.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931629|ref|ZP_04094535.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228937430|ref|ZP_04100076.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228943932|ref|ZP_04106317.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228950675|ref|ZP_04112809.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228956568|ref|ZP_04118364.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228963227|ref|ZP_04124396.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228970316|ref|ZP_04130975.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976886|ref|ZP_04137298.1| 30S ribosomal protein S5 [Bacillus thuringiensis Bt407]
 gi|228983382|ref|ZP_04143595.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229015528|ref|ZP_04172525.1| 30S ribosomal protein S5 [Bacillus cereus AH1273]
 gi|229021737|ref|ZP_04178319.1| 30S ribosomal protein S5 [Bacillus cereus AH1272]
 gi|229027975|ref|ZP_04184128.1| 30S ribosomal protein S5 [Bacillus cereus AH1271]
 gi|229041032|ref|ZP_04189795.1| 30S ribosomal protein S5 [Bacillus cereus AH676]
 gi|229067892|ref|ZP_04201209.1| 30S ribosomal protein S5 [Bacillus cereus F65185]
 gi|229074188|ref|ZP_04207234.1| 30S ribosomal protein S5 [Bacillus cereus Rock4-18]
 gi|229077427|ref|ZP_04210078.1| 30S ribosomal protein S5 [Bacillus cereus Rock4-2]
 gi|229083447|ref|ZP_04215795.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-44]
 gi|229089258|ref|ZP_04220539.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-42]
 gi|229094849|ref|ZP_04225854.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-29]
 gi|229100926|ref|ZP_04231730.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-28]
 gi|229107813|ref|ZP_04237449.1| 30S ribosomal protein S5 [Bacillus cereus Rock1-15]
 gi|229113803|ref|ZP_04243238.1| 30S ribosomal protein S5 [Bacillus cereus Rock1-3]
 gi|229119789|ref|ZP_04249050.1| 30S ribosomal protein S5 [Bacillus cereus 95/8201]
 gi|229125644|ref|ZP_04254676.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-Cer4]
 gi|229136973|ref|ZP_04265600.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-ST26]
 gi|229142933|ref|ZP_04271374.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-ST24]
 gi|229148536|ref|ZP_04276792.1| 30S ribosomal protein S5 [Bacillus cereus m1550]
 gi|229153905|ref|ZP_04282035.1| 30S ribosomal protein S5 [Bacillus cereus ATCC 4342]
 gi|229159300|ref|ZP_04287324.1| 30S ribosomal protein S5 [Bacillus cereus R309803]
 gi|229170978|ref|ZP_04298579.1| 30S ribosomal protein S5 [Bacillus cereus MM3]
 gi|229176727|ref|ZP_04304131.1| 30S ribosomal protein S5 [Bacillus cereus 172560W]
 gi|229182521|ref|ZP_04309772.1| 30S ribosomal protein S5 [Bacillus cereus BGSC 6E1]
 gi|229188412|ref|ZP_04315460.1| 30S ribosomal protein S5 [Bacillus cereus ATCC 10876]
 gi|229194517|ref|ZP_04321320.1| 30S ribosomal protein S5 [Bacillus cereus m1293]
 gi|229601308|ref|YP_002864778.1| 30S ribosomal protein S5 [Bacillus anthracis str. A0248]
 gi|254686626|ref|ZP_05150485.1| 30S ribosomal protein S5 [Bacillus anthracis str. CNEVA-9066]
 gi|254726294|ref|ZP_05188076.1| 30S ribosomal protein S5 [Bacillus anthracis str. A1055]
 gi|254735299|ref|ZP_05193007.1| 30S ribosomal protein S5 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254739491|ref|ZP_05197189.1| 30S ribosomal protein S5 [Bacillus anthracis str. Kruger B]
 gi|254751237|ref|ZP_05203275.1| 30S ribosomal protein S5 [Bacillus anthracis str. Vollum]
 gi|254756854|ref|ZP_05208882.1| 30S ribosomal protein S5 [Bacillus anthracis str. Australia 94]
 gi|296500960|ref|YP_003662660.1| 30S ribosomal protein S5 [Bacillus thuringiensis BMB171]
 gi|300119560|ref|ZP_07057104.1| 30S ribosomal protein S5 [Bacillus cereus SJ1]
 gi|301051864|ref|YP_003790075.1| 30S ribosomal protein S5 [Bacillus anthracis CI]
 gi|38372417|sp|Q81VR3|RS5_BACAN RecName: Full=30S ribosomal protein S5
 gi|73919025|sp|Q73F79|RS5_BACC1 RecName: Full=30S ribosomal protein S5
 gi|73919028|sp|Q6HPP1|RS5_BACHK RecName: Full=30S ribosomal protein S5
 gi|81689829|sp|Q63H73|RS5_BACCZ RecName: Full=30S ribosomal protein S5
 gi|30253639|gb|AAP24181.1| 30S ribosomal protein S5 [Bacillus anthracis str. Ames]
 gi|42735123|gb|AAS39063.1| ribosomal protein S5 [Bacillus cereus ATCC 10987]
 gi|47500531|gb|AAT29207.1| ribosomal protein S5 [Bacillus anthracis str. 'Ames Ancestor']
 gi|47552808|gb|EAL11232.1| ribosomal protein S5 [Bacillus cereus G9241]
 gi|49177088|gb|AAT52464.1| ribosomal protein S5 [Bacillus anthracis str. Sterne]
 gi|49333236|gb|AAT63882.1| ribosomal protein L18 (50S ribosomal protein L18) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978560|gb|AAU20110.1| ribosomal protein L18 (50S ribosomal protein L18) [Bacillus cereus
           E33L]
 gi|170125636|gb|EDS94558.1| ribosomal protein S5 [Bacillus anthracis str. A0389]
 gi|170666318|gb|EDT17108.1| ribosomal protein S5 [Bacillus anthracis str. A0465]
 gi|172079835|gb|EDT64950.1| ribosomal protein S5 [Bacillus anthracis str. A0174]
 gi|190559463|gb|EDV13465.1| ribosomal protein S5 [Bacillus anthracis Tsiankovskii-I]
 gi|195990422|gb|EDX54417.1| ribosomal protein S5 [Bacillus cereus W]
 gi|196026745|gb|EDX65392.1| ribosomal protein S5 [Bacillus cereus NVH0597-99]
 gi|206732895|gb|EDZ50070.1| 30S ribosomal protein S5 [Bacillus cereus AH1134]
 gi|217064304|gb|ACJ78554.1| ribosomal protein S5 [Bacillus cereus AH187]
 gi|218162439|gb|ACK62431.1| ribosomal protein S5 [Bacillus cereus B4264]
 gi|218536082|gb|ACK88480.1| ribosomal protein S5 [Bacillus cereus AH820]
 gi|218544065|gb|ACK96459.1| ribosomal protein S5 [Bacillus cereus G9842]
 gi|221237945|gb|ACM10655.1| ribosomal protein L18 (50S ribosomal protein L18) [Bacillus cereus
           Q1]
 gi|225787983|gb|ACO28200.1| 30S ribosomal protein S5 [Bacillus cereus 03BB102]
 gi|227005921|gb|ACP15664.1| 30S ribosomal protein S5 [Bacillus anthracis str. CDC 684]
 gi|228588983|gb|EEK46998.1| 30S ribosomal protein S5 [Bacillus cereus m1293]
 gi|228595086|gb|EEK52857.1| 30S ribosomal protein S5 [Bacillus cereus ATCC 10876]
 gi|228600976|gb|EEK58545.1| 30S ribosomal protein S5 [Bacillus cereus BGSC 6E1]
 gi|228606770|gb|EEK64187.1| 30S ribosomal protein S5 [Bacillus cereus 172560W]
 gi|228612518|gb|EEK69739.1| 30S ribosomal protein S5 [Bacillus cereus MM3]
 gi|228624192|gb|EEK80994.1| 30S ribosomal protein S5 [Bacillus cereus R309803]
 gi|228629586|gb|EEK86283.1| 30S ribosomal protein S5 [Bacillus cereus ATCC 4342]
 gi|228634952|gb|EEK91525.1| 30S ribosomal protein S5 [Bacillus cereus m1550]
 gi|228640554|gb|EEK96943.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-ST24]
 gi|228646511|gb|EEL02718.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-ST26]
 gi|228657836|gb|EEL13642.1| 30S ribosomal protein S5 [Bacillus cereus BDRD-Cer4]
 gi|228663690|gb|EEL19269.1| 30S ribosomal protein S5 [Bacillus cereus 95/8201]
 gi|228669674|gb|EEL25081.1| 30S ribosomal protein S5 [Bacillus cereus Rock1-3]
 gi|228675662|gb|EEL30870.1| 30S ribosomal protein S5 [Bacillus cereus Rock1-15]
 gi|228682505|gb|EEL36578.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-28]
 gi|228688592|gb|EEL42465.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-29]
 gi|228694097|gb|EEL47779.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-42]
 gi|228699880|gb|EEL52517.1| 30S ribosomal protein S5 [Bacillus cereus Rock3-44]
 gi|228705877|gb|EEL58212.1| 30S ribosomal protein S5 [Bacillus cereus Rock4-2]
 gi|228708958|gb|EEL61085.1| 30S ribosomal protein S5 [Bacillus cereus Rock4-18]
 gi|228715251|gb|EEL67110.1| 30S ribosomal protein S5 [Bacillus cereus F65185]
 gi|228727329|gb|EEL78523.1| 30S ribosomal protein S5 [Bacillus cereus AH676]
 gi|228733363|gb|EEL84192.1| 30S ribosomal protein S5 [Bacillus cereus AH1271]
 gi|228739605|gb|EEL90019.1| 30S ribosomal protein S5 [Bacillus cereus AH1272]
 gi|228745751|gb|EEL95756.1| 30S ribosomal protein S5 [Bacillus cereus AH1273]
 gi|228776372|gb|EEM24725.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228782856|gb|EEM31022.1| 30S ribosomal protein S5 [Bacillus thuringiensis Bt407]
 gi|228789425|gb|EEM37345.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796485|gb|EEM43924.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228803133|gb|EEM49955.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228809026|gb|EEM55511.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228815765|gb|EEM62001.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228822263|gb|EEM68245.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228828057|gb|EEM73785.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834302|gb|EEM79843.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228840602|gb|EEM85864.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228846802|gb|EEM91807.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228853739|gb|EEM98499.1| 30S ribosomal protein S5 [Bacillus thuringiensis IBL 200]
 gi|228860780|gb|EEN05158.1| 30S ribosomal protein S5 [Bacillus thuringiensis IBL 4222]
 gi|229265716|gb|ACQ47353.1| 30S ribosomal protein S5 [Bacillus anthracis str. A0248]
 gi|296322012|gb|ADH04940.1| 30S ribosomal protein S5 [Bacillus thuringiensis BMB171]
 gi|298723032|gb|EFI63930.1| 30S ribosomal protein S5 [Bacillus cereus SJ1]
 gi|300374033|gb|ADK02937.1| 30S ribosomal protein S5 [Bacillus cereus biovar anthracis str. CI]
 gi|324324118|gb|ADY19378.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar finitimus
           YBT-020]
 gi|326937922|gb|AEA13818.1| 30S ribosomal protein S5 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 166

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+RK
Sbjct: 3   RIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I+V L+ G T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  AIEDAKKNLIAVPLV-GTTIPHTINGHFGAGEVFLKPAAEGTGVIAGGPVRAVLELAGVQ 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+ P N+IRAT   L       DVA  RG     L  
Sbjct: 122 DILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEELLG 166


>gi|16125514|ref|NP_420078.1| 30S ribosomal protein S5 [Caulobacter crescentus CB15]
 gi|221234260|ref|YP_002516696.1| 30S ribosomal protein S5 [Caulobacter crescentus NA1000]
 gi|295688923|ref|YP_003592616.1| 30S ribosomal protein S5 [Caulobacter segnis ATCC 21756]
 gi|26399480|sp|Q9A8T6|RS5_CAUCR RecName: Full=30S ribosomal protein S5
 gi|254764631|sp|B8H4F1|RS5_CAUCN RecName: Full=30S ribosomal protein S5
 gi|13422596|gb|AAK23246.1| ribosomal protein S5 [Caulobacter crescentus CB15]
 gi|220963432|gb|ACL94788.1| SSU ribosomal protein S5P [Caulobacter crescentus NA1000]
 gi|295430826|gb|ADG09998.1| ribosomal protein S5 [Caulobacter segnis ATCC 21756]
          Length = 201

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 106/200 (53%), Positives = 136/200 (68%), Gaps = 9/200 (4%)

Query: 1   MAQKERSQRDNWQ---------NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVG 51
           MA+ E+ + +  Q           E  D+ IV+++V INRV+  + GGRRF+F+ L+VVG
Sbjct: 1   MARGEQQRGEGGQRRDRRDRNAPEERVDSDIVEKLVHINRVAATVKGGRRFSFAALMVVG 60

Query: 52  DTKSKVGFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSA 111
           D K +VGF H  AREVPEA+RKATE AK+ MI V L + RTLHHDG GR GAGKV+MR+A
Sbjct: 61  DQKGRVGFGHGKAREVPEAIRKATEEAKKTMIRVPLRESRTLHHDGAGRWGAGKVMMRAA 120

Query: 112 MAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGI 171
             GTGVIAGG +RAV E LG+ DVVAKS GSSNP+N++RATFE L+ QS PR +A +RG 
Sbjct: 121 PPGTGVIAGGPMRAVLETLGVQDVVAKSTGSSNPYNMVRATFEALKVQSSPRQIAAKRGK 180

Query: 172 KHSLLQARRVVSSKSSSYSR 191
           K   +  RR   + +     
Sbjct: 181 KVGDILGRRADGASAPEAIE 200


>gi|154248698|ref|YP_001419656.1| ribosomal protein S5 [Xanthobacter autotrophicus Py2]
 gi|226703398|sp|A7IPQ3|RS5_XANP2 RecName: Full=30S ribosomal protein S5
 gi|154162783|gb|ABS69999.1| ribosomal protein S5 [Xanthobacter autotrophicus Py2]
          Length = 185

 Score =  184 bits (468), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 110/170 (64%), Positives = 134/170 (78%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
           DN+ VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATE+A
Sbjct: 15  DNTFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATESA 74

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           KR +I V L +GRTLHHD  G HGAGKVI+R+A AGTG+IAGG +RAV E LGMHDVVAK
Sbjct: 75  KRALIRVPLREGRTLHHDVHGHHGAGKVILRAAPAGTGIIAGGPMRAVFETLGMHDVVAK 134

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           S GSSNP+N++RATF+ L++Q  PR VA RRGIK S LQ+RR V    ++
Sbjct: 135 SFGSSNPYNMVRATFDALKNQDSPRSVAARRGIKVSQLQSRRRVEDAEAT 184


>gi|90424920|ref|YP_533290.1| 30S ribosomal protein S5 [Rhodopseudomonas palustris BisB18]
 gi|122475734|sp|Q211G5|RS5_RHOPB RecName: Full=30S ribosomal protein S5
 gi|90106934|gb|ABD88971.1| SSU ribosomal protein S5P [Rhodopseudomonas palustris BisB18]
          Length = 190

 Score =  184 bits (467), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 109/181 (60%), Positives = 137/181 (75%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA +      +   REERD+  VD++V INRV+  + GG+RF F+ LVV+GD K +VGF 
Sbjct: 1   MAGERERGGGHRGPREERDSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKRN+  V L +GRTLHHD  GRHGAG+V +R+A AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATESAKRNLTRVPLREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKSIGSSNP+N++RATF+ L+ Q  PR VA RR +K S LQ+RR
Sbjct: 121 GPMRAVFETLGIQDVVAKSIGSSNPYNMVRATFDALKHQDSPRSVAARRNLKVSTLQSRR 180

Query: 181 V 181
           V
Sbjct: 181 V 181


>gi|138893801|ref|YP_001124254.1| 30S ribosomal protein S5 [Geobacillus thermodenitrificans NG80-2]
 gi|196251007|ref|ZP_03149689.1| ribosomal protein S5 [Geobacillus sp. G11MC16]
 gi|189045416|sp|A4IJK5|RS5_GEOTN RecName: Full=30S ribosomal protein S5
 gi|134265314|gb|ABO65509.1| Ribosomal protein S5 [Geobacillus thermodenitrificans NG80-2]
 gi|196209479|gb|EDY04256.1| ribosomal protein S5 [Geobacillus sp. G11MC16]
          Length = 166

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+VAINRV+  + GGRR  FS LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RRIDPNKLELEERVVAINRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N++ V ++ G T+ H+ +G  GAG++I++ A  GTGVIAGG  RAV E+ G+
Sbjct: 62  KAIEDAKKNLMEVPIV-GTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KSIGS+ P N++RATF+ L+      DVA  RG     L  
Sbjct: 121 SDILSKSIGSNTPINMVRATFDGLKQLKRAEDVAKLRGKTVEELLG 166


>gi|30018397|ref|NP_830028.1| 30S ribosomal protein S5 [Bacillus cereus ATCC 14579]
 gi|118475896|ref|YP_893047.1| 30S ribosomal protein S5 [Bacillus thuringiensis str. Al Hakam]
 gi|38372412|sp|Q81J25|RS5_BACCR RecName: Full=30S ribosomal protein S5
 gi|171472995|sp|A0R8J7|RS5_BACAH RecName: Full=30S ribosomal protein S5
 gi|29893937|gb|AAP07229.1| SSU ribosomal protein S5P [Bacillus cereus ATCC 14579]
 gi|118415121|gb|ABK83540.1| SSU ribosomal protein S5P [Bacillus thuringiensis str. Al Hakam]
          Length = 167

 Score =  184 bits (467), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+RK
Sbjct: 4   RIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIRK 63

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I+V L+ G T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 64  AIEDAKKNLIAVPLV-GTTIPHTINGHFGAGEVFLKPAAEGTGVIAGGPVRAVLELAGVQ 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+ P N+IRAT   L       DVA  RG     L  
Sbjct: 123 DILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEELLG 167


>gi|56961949|ref|YP_173671.1| 30S ribosomal protein S5 [Bacillus clausii KSM-K16]
 gi|73919030|sp|Q5WLP5|RS5_BACSK RecName: Full=30S ribosomal protein S5
 gi|56908183|dbj|BAD62710.1| 30S ribosomal protein S5 [Bacillus clausii KSM-K16]
          Length = 166

 Score =  184 bits (466), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           ++ +     + +++V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RSIDPNTLELEEKVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGMGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V +++  T+ H  VGR GAG+V ++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAVEDAKKNLIEVPIVN-TTIPHQIVGRFGAGRVFLKPASEGTGVIAGGPVRAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV++KS+GSSNP N++RAT   L +     +VA  RG     L  
Sbjct: 121 GDVLSKSLGSSNPINMVRATITGLTNLKRAEEVAKLRGKSVEELLG 166


>gi|133964|sp|P02357|RS5_BACST RecName: Full=30S ribosomal protein S5; Short=BS5; AltName:
           Full=BS6
 gi|143417|gb|AAA22699.1| ribosomal protein S5 [Geobacillus stearothermophilus]
          Length = 166

 Score =  183 bits (465), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +        + +R+VA+NRV+  + GGRR  FS LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RRINPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +G  GAG++I++ A  GTGVIAGG  RAV E+ G+
Sbjct: 62  KAIEDAKKNLIEVPIV-GTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KSIGS+ P N++RATF+ L+      DVA  RG     L  
Sbjct: 121 SDILSKSIGSNTPINMVRATFDGLKQLKRAEDVAKLRGKTVEELLG 166


>gi|118591164|ref|ZP_01548563.1| 30S ribosomal protein S5 [Stappia aggregata IAM 12614]
 gi|118436240|gb|EAV42882.1| 30S ribosomal protein S5 [Stappia aggregata IAM 12614]
          Length = 188

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 109/173 (63%), Positives = 136/173 (78%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           R   ++R+ERD+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVP
Sbjct: 3   RQENRDRDERDSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVP 62

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           EA+RKATEAAKR MI V L +GRTLHHD  GRHGAGKV++R+A AGTG+IAGG +RAV E
Sbjct: 63  EAIRKATEAAKRTMIRVPLREGRTLHHDVEGRHGAGKVLLRAAPAGTGIIAGGPMRAVFE 122

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
            LG+ DVVAKS+G+SNP+N++RATF  L  +  PR VA RRG+K S+LQ+RR 
Sbjct: 123 TLGVQDVVAKSLGTSNPYNMVRATFAALTKEDSPRSVAARRGLKVSVLQSRRR 175


>gi|83594003|ref|YP_427755.1| 30S ribosomal protein S5 [Rhodospirillum rubrum ATCC 11170]
 gi|91207884|sp|Q2RQX7|RS5_RHORT RecName: Full=30S ribosomal protein S5
 gi|83576917|gb|ABC23468.1| SSU ribosomal protein S5P [Rhodospirillum rubrum ATCC 11170]
          Length = 199

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 94/171 (54%), Positives = 120/171 (70%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
            QR+     +ERD   +D++V INRV+  + GGRRFAF+ LVVVGD K +VGF    ARE
Sbjct: 16  DQRNRSPRSDERDEEFLDKLVHINRVAKVVKGGRRFAFAALVVVGDGKGRVGFGTGKARE 75

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VPEA+RKAT+ AKR MI V L +GRTLHHD  G  GAG V +RSA AGTG+I+GG +RAV
Sbjct: 76  VPEAIRKATDQAKRTMIKVPLREGRTLHHDTNGHFGAGWVTLRSAPAGTGIISGGPMRAV 135

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            E +G+ DVV K  G++NP+N+I+ATF+ L +   PR VA RRG K   + 
Sbjct: 136 FETMGVQDVVGKCTGTTNPYNMIKATFDALVNSQAPRQVAARRGKKVGDIV 186


>gi|319654885|ref|ZP_08008960.1| 30S ribosomal protein S5 [Bacillus sp. 2_A_57_CT2]
 gi|317393448|gb|EFV74211.1| 30S ribosomal protein S5 [Bacillus sp. 2_A_57_CT2]
          Length = 166

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+  + GGRRF FS LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RRIDPNKLELEERVVTVNRVAKVVKGGRRFRFSALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N++ V ++ G T+ H  +G  GAG+++++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLVEVPMV-GTTIPHQVIGHFGAGEILLKPASEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+G++ P N++RAT   L       DVA  RG     L  
Sbjct: 121 GDILSKSLGTNTPINMVRATLNGLTQLKRAEDVAKLRGKSVEELLG 166


>gi|302871515|ref|YP_003840151.1| ribosomal protein S5 [Caldicellulosiruptor obsidiansis OB47]
 gi|302574374|gb|ADL42165.1| ribosomal protein S5 [Caldicellulosiruptor obsidiansis OB47]
          Length = 168

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 106/165 (64%), Gaps = 1/165 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  + +   + +R+V INRV+  + GG+R  FS +VVVGD    VG  H  A E+P+A+
Sbjct: 3   QKRIDPKGLDLKERVVNINRVAKVVKGGKRLKFSAIVVVGDENGHVGAGHGKAAEIPDAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA E AK+++I V ++ G T+ H+ +G  GA KV+++ A  GTGVIAGG +RAVCE+ G
Sbjct: 63  RKAIEDAKKHLIEVPIV-GTTIPHEAIGDFGASKVLIKPAPEGTGVIAGGPVRAVCELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + D+  KS+GS+NP NV+ AT E L+    P DVA  RG     +
Sbjct: 122 IKDIRTKSLGSNNPANVVHATIEALKQLRRPEDVARIRGKTLEEI 166


>gi|295401903|ref|ZP_06811866.1| ribosomal protein S5 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109278|ref|YP_003987594.1| ribosomal protein S5 [Geobacillus sp. Y4.1MC1]
 gi|294976033|gb|EFG51648.1| ribosomal protein S5 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214379|gb|ADP72983.1| ribosomal protein S5 [Geobacillus sp. Y4.1MC1]
          Length = 166

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V++NRV+  + GGRR  FS LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   RRIDPNKLELEERVVSVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +G  GAGK+I++ A  GTGVIAGG  RAV E+ G+
Sbjct: 62  KAIEDAKKNLIEVPIV-GTTIPHEVIGHFGAGKIILKPASEGTGVIAGGPARAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KSIGS+ P N++RAT + L+      DVA  RG     L  
Sbjct: 121 SDILSKSIGSNTPINMVRATVDGLKQLKRAEDVARLRGKTVEELLG 166


>gi|312115704|ref|YP_004013300.1| ribosomal protein S5 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220833|gb|ADP72201.1| ribosomal protein S5 [Rhodomicrobium vannielii ATCC 17100]
          Length = 193

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 97/173 (56%), Positives = 128/173 (73%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVP+A++KAT++AK
Sbjct: 19  SEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPDAIKKATDSAK 78

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RN+I V L +GRTLHHD  G HGAGKV +R+A  GTG+IAGG +RAV E LG+ DVVAKS
Sbjct: 79  RNLIRVPLREGRTLHHDVHGHHGAGKVFLRAAPPGTGIIAGGPMRAVFETLGVQDVVAKS 138

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           IG+SNP+N++RATF+ L+ +  PR VA RRG K S +  RR   ++    ++ 
Sbjct: 139 IGTSNPYNMVRATFDALKHEDSPRGVAARRGKKVSEIVTRRRDGAEGQVSAQA 191


>gi|239825710|ref|YP_002948334.1| 30S ribosomal protein S5 [Geobacillus sp. WCH70]
 gi|259495309|sp|C5D3T4|RS5_GEOSW RecName: Full=30S ribosomal protein S5
 gi|239806003|gb|ACS23068.1| ribosomal protein S5 [Geobacillus sp. WCH70]
          Length = 166

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+VA+NRV+  + GGRR  FS LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   RRIDPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +G  GAGK+I++ A  GTGVIAGG  RAV E+ G+
Sbjct: 62  KAIEDAKKNLIEVPIV-GTTIPHEVIGHFGAGKIILKPASEGTGVIAGGPARAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KSIGS+ P N++RAT + L+      DVA  RG     L  
Sbjct: 121 SDILSKSIGSNTPINMVRATVDGLKQLKRAEDVARLRGKTVEELLG 166


>gi|238928138|ref|ZP_04659898.1| 30S ribosomal protein S5 [Selenomonas flueggei ATCC 43531]
 gi|238884098|gb|EEQ47736.1| 30S ribosomal protein S5 [Selenomonas flueggei ATCC 43531]
          Length = 168

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 78/166 (46%), Positives = 107/166 (64%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           ++ E       +R+V INRVS  + GGRR +FS LVVVG+ K KVG     A EVPEA+R
Sbjct: 3   RHNENETPEFEERVVFINRVSKVVKGGRRSSFSALVVVGNKKGKVGVGLGKAAEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+++I V L + RT+ H+  G  GAG+V+++ A  GTGVIAGG +RAV E+ G+
Sbjct: 63  KGVEDAKKSLIEVPLREERTVPHEITGIFGAGRVLLKPATKGTGVIAGGPVRAVLELAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GSSNP+N++RAT E L     P +VA  RG     +  
Sbjct: 123 RDILTKSLGSSNPNNMVRATMEGLLGLKSPAEVAALRGKSVHEIFG 168


>gi|288554742|ref|YP_003426677.1| 30S ribosomal protein S5 [Bacillus pseudofirmus OF4]
 gi|288545902|gb|ADC49785.1| 30S ribosomal protein S5 [Bacillus pseudofirmus OF4]
          Length = 166

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/166 (43%), Positives = 110/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +++VA+NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RRIDPNTLELEEKVVAVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGMGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G ++ H+ +G  GAG+V+++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAVEDAKKNLIEVPVV-GTSIPHEIIGHFGAGRVLLKPASEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+NP N++RAT + L+      +VA  RG     L  
Sbjct: 121 GDILSKSLGSNNPINMVRATMQGLKELKRAEEVAKLRGKSVEELLG 166


>gi|147676671|ref|YP_001210886.1| 30S ribosomal protein S5 [Pelotomaculum thermopropionicum SI]
 gi|226703369|sp|A5D5H1|RS5_PELTS RecName: Full=30S ribosomal protein S5
 gi|146272768|dbj|BAF58517.1| ribosomal protein S5 [Pelotomaculum thermopropionicum SI]
          Length = 166

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +       +++V INRV+  + GGRRF+FS L+VVGD    VG     A EVPEA+RK
Sbjct: 3   RIDASKLETTEKVVFINRVAKVVKGGRRFSFSALMVVGDGNGHVGAGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NMI V L  G T+ H+ +G  GAGKV+++ A  GTGVIAGG +RA+ E+ G+ 
Sbjct: 63  GIEDAKKNMIKVPLA-GTTIPHEVIGEFGAGKVLLKPAAPGTGVIAGGPVRAILELAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+N +N++RAT E L+S   P +VA  RG     L  
Sbjct: 122 DILTKSLGSNNANNMVRATIEALKSLKTPEEVARLRGKPVEELLG 166


>gi|294497002|ref|YP_003560702.1| 30S ribosomal protein S5 [Bacillus megaterium QM B1551]
 gi|295702367|ref|YP_003595442.1| 30S ribosomal protein S5 [Bacillus megaterium DSM 319]
 gi|294346939|gb|ADE67268.1| 30S ribosomal protein S5 [Bacillus megaterium QM B1551]
 gi|294800026|gb|ADF37092.1| 30S ribosomal protein S5 [Bacillus megaterium DSM 319]
          Length = 166

 Score =  182 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 108/166 (65%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   RRIDPNKLELEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I+V ++ G T+ H+ +G+ GAG++ ++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLITVPMV-GTTIPHEILGQFGAGQIFLKPASEGTGVIAGGPVRAVLELGGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N++RAT   L +     DVA  RG     L  
Sbjct: 121 SDILSKSLGSNTPINMVRATLNGLANLKRAEDVAKLRGKTVEELLG 166


>gi|296131853|ref|YP_003639100.1| ribosomal protein S5 [Thermincola sp. JR]
 gi|296030431|gb|ADG81199.1| ribosomal protein S5 [Thermincola potens JR]
          Length = 166

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 71/163 (43%), Positives = 105/163 (64%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + +++V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 5   DASKLELTEKVVNINRVAKVVKGGRRFSFSALVVVGDGNGYVGAGLGKASEVPEAIRKGI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+++I V ++ G T+ H+ +G  GAGKV+++ A  GTGVIAGG +RA+ E+ G+ D+
Sbjct: 65  EDAKKHLIHVPIV-GTTIPHEVIGHFGAGKVLLKPAAPGTGVIAGGPVRAILELAGVRDI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + KS+GS+N +N+I AT + L++     +VA  RG     L  
Sbjct: 124 LTKSLGSNNANNMIHATMDALKNLKRAEEVARLRGKTVEELLG 166


>gi|229542186|ref|ZP_04431246.1| ribosomal protein S5 [Bacillus coagulans 36D1]
 gi|229326606|gb|EEN92281.1| ribosomal protein S5 [Bacillus coagulans 36D1]
          Length = 166

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF FS LVVVGD    VGF    A+EVP+A+RK
Sbjct: 3   RIDPNKLELEERVVTINRVAKVVKGGRRFRFSALVVVGDRNGHVGFGTGKAQEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N++ V +  G T+ H+ VG  GAGK++++    GTGVIAGG +RA+ E+ G+ 
Sbjct: 63  AVEDAKKNLVEVPIS-GTTIPHEVVGHFGAGKILLKPGSPGTGVIAGGPVRAILELAGIA 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+ +KS+GS+ P N+IRAT + ++      +VA  R      L  
Sbjct: 122 DITSKSLGSNTPINMIRATMDGIKQLKRADEVAKLRNKSVEELLG 166


>gi|323141373|ref|ZP_08076264.1| ribosomal protein S5 [Phascolarctobacterium sp. YIT 12067]
 gi|322414122|gb|EFY04950.1| ribosomal protein S5 [Phascolarctobacterium sp. YIT 12067]
          Length = 166

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E ++N + +++V INRV+  + GGRRF+F+ LVVVGD    VG     A EVPEA+RK
Sbjct: 3   NFENKENELQEKVVFINRVAKVVKGGRRFSFAALVVVGDENGHVGMGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+++V L+ G T+ H+ +G  GAG+V ++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  GVEDAKKNLVTVPLV-GTTIPHENIGVFGAGRVFLKPAAEGTGVIAGGPVRAVLELAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS GSSNP+N++RAT E L+S      VA  RG     L  
Sbjct: 122 DILTKSQGSSNPNNMVRATIEGLKSLKSAEAVAALRGKTVEELLG 166


>gi|16801825|ref|NP_472093.1| 30S ribosomal protein S5 [Listeria innocua Clip11262]
 gi|26399439|sp|Q927M4|RS5_LISIN RecName: Full=30S ribosomal protein S5
 gi|16415300|emb|CAC97990.1| ribosomal protein S5 [Listeria innocua Clip11262]
          Length = 167

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 3   EQIDGNKLDLEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGHVGFGTGKAQEVPDAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+NM+ V  +D  T+ H  VG  G G+++++ A AG+GV AGG +RAV E+ G+
Sbjct: 63  KAVEDAKKNMVFVPTVD-TTIPHTVVGHFGGGEILLKPASAGSGVTAGGPVRAVLELAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +KS+GS+ P N++RAT + ++   +  DVA  RG     L  
Sbjct: 122 ADVSSKSLGSNTPINMVRATIDGIKQLKNAEDVAKLRGKTVEELLG 167


>gi|226492493|ref|NP_001150762.1| 30S ribosomal protein S5 [Zea mays]
 gi|195641594|gb|ACG40265.1| 30S ribosomal protein S5 [Zea mays]
          Length = 318

 Score =  182 bits (461), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 94/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +    +  ++   +R+V +NRV+  + GGR+ ++  +VVVGD K  VG     A+EV EA
Sbjct: 151 DMDREQRPNDDFTERVVQVNRVTKVVKGGRQLSYRAIVVVGDMKGHVGVGVGKAKEVTEA 210

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           + KA    +RN+++V L    T  H     +GA KV++R A  G+GVIAGGA+R V E+ 
Sbjct: 211 ITKAAMNGRRNLVTVPLTKYSTFPHRADADYGAAKVMLRPACPGSGVIAGGAVRVVLEMA 270

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K + S NP N  RAT +  +     +DVA  RGI    L
Sbjct: 271 GVENALGKQLRSKNPLNNARATIKATQMMKQFKDVAEERGIPMEEL 316


>gi|222529713|ref|YP_002573595.1| 30S ribosomal protein S5 [Caldicellulosiruptor bescii DSM 6725]
 gi|312127243|ref|YP_003992117.1| 30S ribosomal protein S5 [Caldicellulosiruptor hydrothermalis 108]
 gi|312135479|ref|YP_004002817.1| 30S ribosomal protein S5 [Caldicellulosiruptor owensensis OL]
 gi|312622062|ref|YP_004023675.1| 30S ribosomal protein S5 [Caldicellulosiruptor kronotskyensis 2002]
 gi|312793922|ref|YP_004026845.1| 30S ribosomal protein S5 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|254764626|sp|B9MKG4|RS5_ANATD RecName: Full=30S ribosomal protein S5
 gi|222456560|gb|ACM60822.1| ribosomal protein S5 [Caldicellulosiruptor bescii DSM 6725]
 gi|311775530|gb|ADQ05017.1| ribosomal protein S5 [Caldicellulosiruptor owensensis OL]
 gi|311777262|gb|ADQ06748.1| ribosomal protein S5 [Caldicellulosiruptor hydrothermalis 108]
 gi|312181062|gb|ADQ41232.1| ribosomal protein S5 [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312202529|gb|ADQ45856.1| ribosomal protein S5 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 168

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  + +   + +R+V INRV+  + GG+R  FS +VVVGD    VG  H  A E+P+A+
Sbjct: 3   QKRIDPKGLDLKERVVNINRVAKVVKGGKRLKFSAIVVVGDENGHVGAGHGKAAEIPDAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA E AK+++I V ++ G T+ H+ +G  GA KV+++ A  GTGVIAGGA+RAVCE+ G
Sbjct: 63  RKAIEDAKKHLIEVPIV-GTTIPHEAIGDFGASKVLIKPAPEGTGVIAGGAVRAVCELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + D+  KS+GS+NP NV+ AT E L+    P +VA  RG     +
Sbjct: 122 IKDIRTKSLGSNNPANVVHATIEALKQLRRPEEVARIRGKTLEEI 166


>gi|146297268|ref|YP_001181039.1| ribosomal protein S5 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|172046030|sp|A4XLR3|RS5_CALS8 RecName: Full=30S ribosomal protein S5
 gi|145410844|gb|ABP67848.1| SSU ribosomal protein S5P [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 168

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 73/166 (43%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  + ++ ++ +R+V INRV+  + GG+R  FS +VVVGD    VG  H  A E+P+A+
Sbjct: 3   QKRIDPKELNLKERVVNINRVAKVVKGGKRLKFSAIVVVGDENGHVGAGHGKAAEIPDAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA E AK+++I V ++ G T+ H+ +G  GA KV+++ A  GTGVIAGGA+RAVCE+ G
Sbjct: 63  RKAIEDAKKHLIEVPIV-GTTIPHEAIGDFGASKVLIKPAPEGTGVIAGGAVRAVCELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           + D+  KS+GS+NP NV+ AT E L+    P +VA  RG     + 
Sbjct: 122 IKDIRTKSLGSNNPANVVHATIEALKQLKKPEEVARLRGKTLEEII 167


>gi|83858549|ref|ZP_00952071.1| 30S ribosomal protein S5 [Oceanicaulis alexandrii HTCC2633]
 gi|83853372|gb|EAP91224.1| 30S ribosomal protein S5 [Oceanicaulis alexandrii HTCC2633]
          Length = 193

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 101/176 (57%), Positives = 125/176 (71%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
             +  +VD++V INRV+  + GGR F F+ L VVGD K +VGF    AREVPEA+RKATE
Sbjct: 18  NAEPELVDKLVQINRVAKTVKGGRNFQFAALAVVGDQKGRVGFGQGKAREVPEAIRKATE 77

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK+ M+ V L +GRTLHHD  GR GAGKVI+RSA  GTGVIAGG +RAV E LG+ DVV
Sbjct: 78  EAKKMMVRVPLREGRTLHHDAKGRWGAGKVILRSAPPGTGVIAGGPMRAVLESLGVQDVV 137

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           AKS GSSNP+N++RATFE L++Q+ PR VA +RGIK + L  RR   + S      
Sbjct: 138 AKSTGSSNPYNMVRATFEALKAQNSPRTVAAKRGIKVADLVERRQDGASSPEAIES 193


>gi|289435881|ref|YP_003465753.1| hypothetical protein lse_2520 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172125|emb|CBH28671.1| rpsE [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313636130|gb|EFS01998.1| ribosomal protein S5 [Listeria seeligeri FSL S4-171]
          Length = 167

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 71/166 (42%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 3   EQIDGNKLDLEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGHVGFGTGKAQEVPDAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+NM+ V  ++  T+ H  VG  G G+++++ A AG+GV AGG +RAV E+ G+
Sbjct: 63  KAVEDAKKNMVLVPTVN-TTIPHTVVGHFGGGEILLKPASAGSGVTAGGPVRAVLELAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +KS+GS+ P N++RAT + ++   +  DVA  RG     L  
Sbjct: 122 ADVSSKSLGSNTPINMVRATIDGIKQLKNAEDVAKLRGKTVEELLG 167


>gi|89053099|ref|YP_508550.1| 30S ribosomal protein S5 [Jannaschia sp. CCS1]
 gi|122499563|sp|Q28UT7|RS5_JANSC RecName: Full=30S ribosomal protein S5
 gi|88862648|gb|ABD53525.1| SSU ribosomal protein S5P [Jannaschia sp. CCS1]
          Length = 197

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 105/197 (53%), Positives = 139/197 (70%), Gaps = 4/197 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++E   R   +NREE      DR+VAINRVS  + GG+RF F+ LVVVGD + +VGF 
Sbjct: 1   MAERENRGRGRGRNREEETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR +I V L +GRTLHHD  G HGAGKV+MR+A  GTG+IAG
Sbjct: 61  KGKAKEVPEAIRKATEQAKRQLIRVPLKEGRTLHHDVKGHHGAGKVVMRTAPEGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVV+KS GS NP+N+IRAT + LR++S PR VA+RRG K + +  +R
Sbjct: 121 GPMRAVFEMLGVKDVVSKSTGSQNPYNMIRATLDGLRNESSPRQVASRRGKKVADILPKR 180

Query: 181 ----VVSSKSSSYSRDS 193
                +  + +  S ++
Sbjct: 181 DDHPQIDGEQAPVSEEA 197


>gi|85709039|ref|ZP_01040105.1| 30S ribosomal protein S5 [Erythrobacter sp. NAP1]
 gi|85690573|gb|EAQ30576.1| 30S ribosomal protein S5 [Erythrobacter sp. NAP1]
          Length = 269

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 98/167 (58%), Positives = 125/167 (74%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            REE D+ I++++V INRVS  + GG+RF F+ LVVVGD + +VGF H  AREVPEA+ K
Sbjct: 87  KREEEDDGIIEKLVHINRVSKTVKGGKRFGFAALVVVGDGQGRVGFGHGKAREVPEAITK 146

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           AT AA++ MI V L +GRTLHHDG GR GAGKV +R+A  GTG+IAGG +RAV E LG+ 
Sbjct: 147 ATAAARKKMIRVPLKEGRTLHHDGNGRFGAGKVTVRTAPPGTGIIAGGPMRAVFESLGVA 206

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           DVV KS+G+SNP+N+IRATF+ L  Q+ P+ VA RRG K + L  R 
Sbjct: 207 DVVTKSVGTSNPYNMIRATFDALADQTSPKSVAQRRGKKVADLLGRG 253


>gi|125975401|ref|YP_001039311.1| SSU ribosomal protein S5P [Clostridium thermocellum ATCC 27405]
 gi|256005312|ref|ZP_05430278.1| ribosomal protein S5 [Clostridium thermocellum DSM 2360]
 gi|281419363|ref|ZP_06250378.1| ribosomal protein S5 [Clostridium thermocellum JW20]
 gi|171769994|sp|A3DJI9|RS5_CLOTH RecName: Full=30S ribosomal protein S5
 gi|125715626|gb|ABN54118.1| SSU ribosomal protein S5P [Clostridium thermocellum ATCC 27405]
 gi|255990748|gb|EEU00864.1| ribosomal protein S5 [Clostridium thermocellum DSM 2360]
 gi|281406983|gb|EFB37246.1| ribosomal protein S5 [Clostridium thermocellum JW20]
 gi|316939517|gb|ADU73551.1| ribosomal protein S5 [Clostridium thermocellum DSM 1313]
          Length = 166

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 68/166 (40%), Positives = 99/166 (59%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q  +     + +++V I RV+  + GGR F FS LVVVGD    VG     A E+P+A+R
Sbjct: 2   QRIDASVLDLKEKVVNIGRVTKVVKGGRNFRFSALVVVGDENGHVGSGMGKAAEIPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+N+I V +++  T+ H+ +G  GAGKV+++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KGIEDAKKNLIKVPIVN-TTIPHEVIGEFGAGKVLLKPAQPGTGVIAGGPVRAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+  KS+GS+NP N++ AT E L       +VA  R      +  
Sbjct: 121 KDIRTKSLGSNNPINMVHATIEGLSRLKTAEEVAKLRNKTVEEILG 166


>gi|78044312|ref|YP_361101.1| 30S ribosomal protein S5 [Carboxydothermus hydrogenoformans Z-2901]
 gi|91207856|sp|Q3A9T3|RS5_CARHZ RecName: Full=30S ribosomal protein S5
 gi|77996427|gb|ABB15326.1| ribosomal protein S5 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 167

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + ++++AINR +  + GGRRF+FS LVVVGD K  VG     A EVP+A+RK
Sbjct: 3   RIDASQLELSEKVIAINRTAKVVKGGRRFSFSALVVVGDQKGHVGVGLGKAPEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V +++  T+ H+ +G  GAGKV+++ A  GTGVIAG A+RA+ E+ G+ 
Sbjct: 63  GIEDAKKNLIKVPIVN-TTIPHEIIGEAGAGKVLLKPAAPGTGVIAGSAVRAILEMAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           D++ KS+GS+NPHN+  AT E L+S      VA  RG   + +
Sbjct: 122 DILTKSLGSNNPHNMAHATIEALKSLKTVEMVAKLRGKTPAEI 164


>gi|16804653|ref|NP_466138.1| 30S ribosomal protein S5 [Listeria monocytogenes EGD-e]
 gi|46908787|ref|YP_015176.1| 30S ribosomal protein S5 [Listeria monocytogenes str. 4b F2365]
 gi|47093981|ref|ZP_00231715.1| ribosomal protein S5 [Listeria monocytogenes str. 4b H7858]
 gi|47097186|ref|ZP_00234751.1| ribosomal protein S5 [Listeria monocytogenes str. 1/2a F6854]
 gi|116873981|ref|YP_850762.1| 30S ribosomal protein S5 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217966186|ref|YP_002351864.1| ribosomal protein S5 [Listeria monocytogenes HCC23]
 gi|224499288|ref|ZP_03667637.1| 30S ribosomal protein S5 [Listeria monocytogenes Finland 1988]
 gi|224503591|ref|ZP_03671898.1| 30S ribosomal protein S5 [Listeria monocytogenes FSL R2-561]
 gi|226225160|ref|YP_002759267.1| ribosomal protein S5 [Listeria monocytogenes Clip81459]
 gi|254825024|ref|ZP_05230025.1| ribosomal protein S5 [Listeria monocytogenes FSL J1-194]
 gi|254829064|ref|ZP_05233751.1| ribosomal protein S5 [Listeria monocytogenes FSL N3-165]
 gi|254830953|ref|ZP_05235608.1| 30S ribosomal protein S5 [Listeria monocytogenes 10403S]
 gi|254854179|ref|ZP_05243527.1| ribosomal protein S5 [Listeria monocytogenes FSL R2-503]
 gi|254899934|ref|ZP_05259858.1| 30S ribosomal protein S5 [Listeria monocytogenes J0161]
 gi|254912860|ref|ZP_05262872.1| 30S ribosomal protein S5 [Listeria monocytogenes J2818]
 gi|254931115|ref|ZP_05264474.1| ribosomal protein S5 [Listeria monocytogenes HPB2262]
 gi|254937240|ref|ZP_05268937.1| ribosomal protein S5 [Listeria monocytogenes F6900]
 gi|254991837|ref|ZP_05274027.1| 30S ribosomal protein S5 [Listeria monocytogenes FSL J2-064]
 gi|255023514|ref|ZP_05295500.1| 30S ribosomal protein S5 [Listeria monocytogenes FSL J1-208]
 gi|255026525|ref|ZP_05298511.1| 30S ribosomal protein S5 [Listeria monocytogenes FSL J2-003]
 gi|255028292|ref|ZP_05300243.1| 30S ribosomal protein S5 [Listeria monocytogenes LO28]
 gi|255519657|ref|ZP_05386894.1| 30S ribosomal protein S5 [Listeria monocytogenes FSL J1-175]
 gi|284800499|ref|YP_003412364.1| 30S ribosomal protein S5 [Listeria monocytogenes 08-5578]
 gi|284993685|ref|YP_003415453.1| 30S ribosomal protein S5 [Listeria monocytogenes 08-5923]
 gi|290891800|ref|ZP_06554797.1| ribosomal protein S5 [Listeria monocytogenes FSL J2-071]
 gi|300763634|ref|ZP_07073632.1| ribosomal protein S5 [Listeria monocytogenes FSL N1-017]
 gi|26399429|sp|Q8Y446|RS5_LISMO RecName: Full=30S ribosomal protein S5
 gi|67461155|sp|Q71WG3|RS5_LISMF RecName: Full=30S ribosomal protein S5
 gi|123461450|sp|A0ALV1|RS5_LISW6 RecName: Full=30S ribosomal protein S5
 gi|16412103|emb|CAD00693.1| ribosomal protein S5 [Listeria monocytogenes EGD-e]
 gi|46882060|gb|AAT05353.1| ribosomal protein S5 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47014445|gb|EAL05413.1| ribosomal protein S5 [Listeria monocytogenes str. 1/2a F6854]
 gi|47017642|gb|EAL08441.1| ribosomal protein S5 [Listeria monocytogenes str. 4b H7858]
 gi|116742859|emb|CAK21983.1| ribosomal protein S5 [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|217335456|gb|ACK41250.1| ribosomal protein S5 [Listeria monocytogenes HCC23]
 gi|225877622|emb|CAS06336.1| ribosomal protein S5 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258601474|gb|EEW14799.1| ribosomal protein S5 [Listeria monocytogenes FSL N3-165]
 gi|258607571|gb|EEW20179.1| ribosomal protein S5 [Listeria monocytogenes FSL R2-503]
 gi|258609846|gb|EEW22454.1| ribosomal protein S5 [Listeria monocytogenes F6900]
 gi|284056061|gb|ADB67002.1| 30S ribosomal protein S5 [Listeria monocytogenes 08-5578]
 gi|284059152|gb|ADB70091.1| 30S ribosomal protein S5 [Listeria monocytogenes 08-5923]
 gi|290558394|gb|EFD91911.1| ribosomal protein S5 [Listeria monocytogenes FSL J2-071]
 gi|293582662|gb|EFF94694.1| ribosomal protein S5 [Listeria monocytogenes HPB2262]
 gi|293590859|gb|EFF99193.1| 30S ribosomal protein S5 [Listeria monocytogenes J2818]
 gi|293594265|gb|EFG02026.1| ribosomal protein S5 [Listeria monocytogenes FSL J1-194]
 gi|300515911|gb|EFK42960.1| ribosomal protein S5 [Listeria monocytogenes FSL N1-017]
 gi|307572204|emb|CAR85383.1| rpsE [Listeria monocytogenes L99]
 gi|328468100|gb|EGF39106.1| 30S ribosomal protein S5 [Listeria monocytogenes 1816]
 gi|328469787|gb|EGF40704.1| 30S ribosomal protein S5 [Listeria monocytogenes 220]
          Length = 167

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 3   EQIDGNKLDLEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGHVGFGTGKAQEVPDAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+NM+ V  +D  T+ H  VG  G G+++++ A AG+GV AGG +RAV E+ G+
Sbjct: 63  KAVEDAKKNMVLVPTVD-TTIPHTVVGHFGGGEILLKPASAGSGVTAGGPVRAVLELAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +KS+GS+ P N++RAT + ++   +  DVA  RG     L  
Sbjct: 122 ADVSSKSLGSNTPINMVRATIDGIKQLKNAEDVAKLRGKTVEELLG 167


>gi|296447547|ref|ZP_06889469.1| ribosomal protein S5 [Methylosinus trichosporium OB3b]
 gi|296254935|gb|EFH02040.1| ribosomal protein S5 [Methylosinus trichosporium OB3b]
          Length = 190

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 110/190 (57%), Positives = 143/190 (75%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++    R   ++R++RD+  VDR+V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAREPEGGRGRDRDRDDRDSEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR++I V L +GRTLHHD  GRHGAG+V++R+A  GTG+IAG
Sbjct: 61  HGKAREVPEAIRKATEAAKRSLIRVPLREGRTLHHDVNGRHGAGRVVLRAAPPGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+HD+VAKS GSSNP+N+IRATF+ L ++  PR VA RR +K S LQARR
Sbjct: 121 GPMRAVFETLGVHDIVAKSQGSSNPYNMIRATFDALENEDSPRSVAARRSLKVSALQARR 180

Query: 181 VVSSKSSSYS 190
             +   +  +
Sbjct: 181 QGAEAEAVDA 190


>gi|326792590|ref|YP_004310411.1| ribosomal protein S5 [Clostridium lentocellum DSM 5427]
 gi|326543354|gb|ADZ85213.1| ribosomal protein S5 [Clostridium lentocellum DSM 5427]
          Length = 170

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V I RV+  + GGR F FS LVVVGD    VG     A E+P A
Sbjct: 3   KRLTIDPSTMDLQEKVVTIKRVTKVVKGGRTFRFSALVVVGDGNGHVGVGLGKAMEIPNA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA + AK+N+I +   D  +++H+  G  G+ +V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 63  IQKAIDDAKKNLIYIERNDADSIYHEFYGEFGSARVLLKPAKEGTGVIAGGPARAVLELA 122

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E LR+   P  VA  RG     +  
Sbjct: 123 GIRNIRTKSLGSNNKKNVVHATIEGLRALKTPSQVAKLRGKSVEEILG 170


>gi|297588208|ref|ZP_06946852.1| 30S ribosomal protein S5 [Finegoldia magna ATCC 53516]
 gi|297574897|gb|EFH93617.1| 30S ribosomal protein S5 [Finegoldia magna ATCC 53516]
          Length = 175

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N+E     + +R+V INRV+  + GGR F F+ LVVVGD    VG     A+EVPEA+RK
Sbjct: 12  NKEIEGLELEERVVNINRVAKVVKGGRNFRFAALVVVGDKNGHVGVGIGKAQEVPEAIRK 71

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A++ AK+++ +V +++  T+ H   G  GAG+V+++ A  GTGVIAGG +RAVCE+ G+ 
Sbjct: 72  ASQDAKKHIFTVPIVN-TTIPHQVTGIFGAGRVLLKPAGEGTGVIAGGPVRAVCELAGIK 130

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           DV +KS+G+SNP N++ AT E L+S      VA  RG     +
Sbjct: 131 DVRSKSLGTSNPQNIVNATVEGLKSLKTAEQVAKLRGKSVEEI 173


>gi|23014071|ref|ZP_00053908.1| COG0098: Ribosomal protein S5 [Magnetospirillum magnetotacticum
           MS-1]
 gi|83312212|ref|YP_422476.1| 30S ribosomal protein S5 [Magnetospirillum magneticum AMB-1]
 gi|123541305|sp|Q2W2K8|RS5_MAGMM RecName: Full=30S ribosomal protein S5
 gi|82947053|dbj|BAE51917.1| Ribosomal protein S5 [Magnetospirillum magneticum AMB-1]
          Length = 210

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 97/170 (57%), Positives = 125/170 (73%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
               RE  ++  VD++V INRV+  + GGRRFAF+ LVVVGD K +VG     AREVPEA
Sbjct: 30  EQTPREREESEFVDKLVHINRVAKVVKGGRRFAFAALVVVGDAKGRVGCGSGKAREVPEA 89

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKATE AKRNMI ++L +GRTLHHD  G  GAG+VI+R+A AGTG+IAGG +RAV E +
Sbjct: 90  IRKATEQAKRNMIKIALREGRTLHHDAYGHFGAGRVILRAAPAGTGIIAGGPMRAVFETM 149

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G+ DVVAK +G+SNPHN+I+ATF+ L + + PR VA +RG K   +  RR
Sbjct: 150 GVQDVVAKCLGTSNPHNMIKATFDALINLASPRHVAAKRGKKVGEIIGRR 199


>gi|170780749|ref|YP_001709081.1| 30S ribosomal protein S5 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169155317|emb|CAQ00420.1| 30S ribosomal protein S5 [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 219

 Score =  181 bits (459), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 79/184 (42%), Positives = 113/184 (61%), Gaps = 1/184 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           D+   R+   +  ++R+V INRVS  + GGRRF+F+ LV+VGD    VG  +  AREVP 
Sbjct: 35  DSRGGRDADKSQFLERVVTINRVSKVVKGGRRFSFTALVIVGDGNGLVGVGYGKAREVPT 94

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ K  E AK+N   V  + G T+ H   G   AG V++R A AGTGVIAGG +RAV E 
Sbjct: 95  AISKGVEEAKKNFFRVPRI-GLTIPHAVQGEASAGVVLLRPASAGTGVIAGGPVRAVLEC 153

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
            G+HDV++KS+GSSN  N++ AT E L+    PR VA RRG++   +   R++ ++ +  
Sbjct: 154 AGIHDVLSKSLGSSNTINIVHATVEALKQLEEPRAVAARRGLELEQVVPARILRAQRAEA 213

Query: 190 SRDS 193
              +
Sbjct: 214 DAKA 217


>gi|121534651|ref|ZP_01666472.1| ribosomal protein S5 [Thermosinus carboxydivorans Nor1]
 gi|121306671|gb|EAX47592.1| ribosomal protein S5 [Thermosinus carboxydivorans Nor1]
          Length = 166

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +  +  + +++V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   RIDYSNLDLKEKVVFINRVAKVVKGGRRFSFSALVVVGDGNGYVGAGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V ++ G T+ H+ +G  GAGKV+++ A  GTGVIAGG +RAV E+ G+H
Sbjct: 63  GVEDAKKNLIKVPIV-GTTIPHEVIGEFGAGKVLLKPASEGTGVIAGGPVRAVLELAGIH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN +N++RAT E L+      DVA  RG     L  
Sbjct: 122 DILTKSLGSSNANNMVRATIEGLKQLKRAEDVAALRGKTVQELLG 166


>gi|304438379|ref|ZP_07398320.1| 30S ribosomal protein S5 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304368745|gb|EFM22429.1| 30S ribosomal protein S5 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 168

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 78/166 (46%), Positives = 106/166 (63%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           ++ E       +R+V INRVS  + GGRR +FS LVVVG+ K KVG     A EVPEA+R
Sbjct: 3   RHNENETPEFEERVVFINRVSKVVKGGRRSSFSALVVVGNKKGKVGVGLGKAAEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+++I V L + RT+ H+  G  GAG+V+++ A  GTGVIAGG  RAV E+ G+
Sbjct: 63  KGIEDAKKSLIEVPLREERTVPHEITGIFGAGRVLLKPAAKGTGVIAGGPARAVLELAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GSSNP+N++RAT E L     P +VA  RG     +  
Sbjct: 123 RDILTKSLGSSNPNNMVRATMEGLMGLKSPAEVAALRGKSVHEIFG 168


>gi|114570328|ref|YP_757008.1| 30S ribosomal protein S5 [Maricaulis maris MCS10]
 gi|122315798|sp|Q0ANR7|RS5_MARMM RecName: Full=30S ribosomal protein S5
 gi|114340790|gb|ABI66070.1| SSU ribosomal protein S5P [Maricaulis maris MCS10]
          Length = 201

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 105/177 (59%), Positives = 132/177 (74%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +ERD+ +VD++V INRV+  + GGR F F+ LVVVGDTK +VGF    AREVPEA+RKAT
Sbjct: 25  QERDDELVDKLVHINRVAKTVKGGRNFQFAALVVVGDTKGRVGFGQGKAREVPEAIRKAT 84

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           + AK+NMI V L +GRTLHHDG GRHGAGKV++R+A  GTGVIAGG +RAV E LG+ DV
Sbjct: 85  DEAKKNMIRVPLREGRTLHHDGKGRHGAGKVVLRAAPPGTGVIAGGPMRAVLETLGIQDV 144

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           VAKS+G+SNP+N+IRAT + L+ QS PR VA +RG+K   L  RR   + S      
Sbjct: 145 VAKSVGTSNPYNMIRATMDALKLQSSPRSVAAKRGLKVGDLVNRRDDGASSPEAIEA 201


>gi|148273785|ref|YP_001223346.1| 30S ribosomal protein S5 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831715|emb|CAN02684.1| 30S ribosomal protein S5 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 221

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 79/184 (42%), Positives = 113/184 (61%), Gaps = 1/184 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           D+   R+   +  ++R+V INRVS  + GGRRF+F+ LV+VGD    VG  +  AREVP 
Sbjct: 37  DSRGGRDADKSQFLERVVTINRVSKVVKGGRRFSFTALVIVGDGNGLVGVGYGKAREVPT 96

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ K  E AK+N   V  + G T+ H   G   AG V++R A AGTGVIAGG +RAV E 
Sbjct: 97  AISKGVEEAKKNFFRVPRI-GLTIPHAVQGEASAGVVLLRPASAGTGVIAGGPVRAVLEC 155

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
            G+HDV++KS+GSSN  N++ AT E L+    PR VA RRG++   +   R++ ++ +  
Sbjct: 156 AGIHDVLSKSLGSSNTINIVHATVEALKQLEEPRAVAARRGLELEQVVPARILRAQRAEA 215

Query: 190 SRDS 193
              +
Sbjct: 216 DAKA 219


>gi|217976750|ref|YP_002360897.1| 30S ribosomal protein S5 [Methylocella silvestris BL2]
 gi|254765695|sp|B8ELE6|RS5_METSB RecName: Full=30S ribosomal protein S5
 gi|217502126|gb|ACK49535.1| ribosomal protein S5 [Methylocella silvestris BL2]
          Length = 189

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 3/192 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++    R   ++REERD+  +DR+V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAREGEGGR--GRDREERDSEFMDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR++I V L +GRTLHHD  GRHGAG+V++R+A AGTG+IAG
Sbjct: 59  HGKAREVPEAIRKATESAKRSLIRVPLREGRTLHHDVNGRHGAGRVVLRAAPAGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGMHDVVAKS GSSNP+N++RATF+ L  Q  PR VA RR +K S+LQ RR
Sbjct: 119 GPMRAIFETLGMHDVVAKSQGSSNPYNMVRATFDALGRQDSPRAVAARRNLKVSVLQGRR 178

Query: 181 VVSSKSSSYSRD 192
               ++ + S  
Sbjct: 179 P-GGEAEAASEA 189


>gi|110634013|ref|YP_674221.1| 30S ribosomal protein S5 [Mesorhizobium sp. BNC1]
 gi|122965960|sp|Q11HR9|RS5_MESSB RecName: Full=30S ribosomal protein S5
 gi|110284997|gb|ABG63056.1| SSU ribosomal protein S5P [Chelativorans sp. BNC1]
          Length = 185

 Score =  180 bits (458), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 103/161 (63%), Positives = 131/161 (81%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATE+AK
Sbjct: 17  SEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATESAK 76

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R++I V L +GRTLHHD  G HGAG+V+MR+A  GTG+IAGG +RAV E LG+ DVVAKS
Sbjct: 77  RDLIFVPLREGRTLHHDVGGHHGAGRVLMRAAKPGTGIIAGGPMRAVFETLGVQDVVAKS 136

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           +GSSNP+N++RATF+ L+ Q HP+D+A +RGIK+S LQARR
Sbjct: 137 LGSSNPYNMVRATFDALKRQMHPKDIAAQRGIKYSTLQARR 177


>gi|39997932|ref|NP_953883.1| 30S ribosomal protein S5 [Geobacter sulfurreducens PCA]
 gi|73919056|sp|Q749A4|RS5_GEOSL RecName: Full=30S ribosomal protein S5
 gi|39984877|gb|AAR36233.1| ribosomal protein S5 [Geobacter sulfurreducens PCA]
 gi|298506871|gb|ADI85594.1| ribosomal protein S5 [Geobacter sulfurreducens KN400]
          Length = 162

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 75/159 (47%), Positives = 109/159 (68%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                D ++ D++V I+RV+  + GGRRF+FS LVVVGD    VG+    A EVPEA+RK
Sbjct: 3   KINPNDLNLTDKVVHISRVAKVVKGGRRFSFSALVVVGDGNGCVGYGLGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V +++G T+ ++ +G  GAG+V+++ A AGTGVIAGGA RAV E  G+H
Sbjct: 63  GVEQAKKNLIKVPIVEGHTIPYEVLGHFGAGRVLIKPASAGTGVIAGGAARAVFEAAGLH 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIK 172
           +V++K +GS+NPHNV++A F  L     P ++  RRG+ 
Sbjct: 123 NVLSKCLGSNNPHNVVKAAFNGLAQLRSPEEIMARRGVT 161


>gi|144900901|emb|CAM77765.1| 30S ribosomal protein S5 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 214

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 98/167 (58%), Positives = 125/167 (74%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E  +N  VD++V INRV+  + GGRRFAF+ LVVVGD K +VG+    AREVPEA+RK
Sbjct: 39  RPEREENEFVDKLVHINRVAKVVKGGRRFAFAALVVVGDAKGRVGYGSGKAREVPEAIRK 98

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           ATE AKRNMI V+L +GRTLHHD  G  GAG+V++R+A AGTG+IAGG +RAV E +G+ 
Sbjct: 99  ATEQAKRNMIKVNLREGRTLHHDVTGHFGAGRVVLRAAPAGTGIIAGGPMRAVFETMGVA 158

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           DVVAK +G+SNPHN+I+ATF+ L S + PR VA +RG K   +  RR
Sbjct: 159 DVVAKCLGTSNPHNMIKATFDALVSLNSPRSVAAKRGKKVGDIIGRR 205


>gi|15612714|ref|NP_241017.1| 30S ribosomal protein S5 [Bacillus halodurans C-125]
 gi|7388206|sp|Q9Z9J7|RS5_BACHD RecName: Full=30S ribosomal protein S5
 gi|4512421|dbj|BAA75288.1| rpsE homologue (identity of 88% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172763|dbj|BAB03870.1| 30S ribosomal protein S5 [Bacillus halodurans C-125]
          Length = 166

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +++VAINRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA+R
Sbjct: 2   RRIDPNTLELEEKVVAINRVAKVVKGGRRFRFAALVVVGDKNGRVGFGMGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ VGR GAG+V+++ A  GTGVIAGG +RAV ++ G+
Sbjct: 62  KAVEDAKKNLIEVPIV-GTTIPHEIVGRFGAGRVLLKPASEGTGVIAGGPVRAVLDLAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+NP N++RAT + L+      DVA  RG     L  
Sbjct: 121 GDILSKSLGSNNPINMVRATVKGLQELKRAEDVAKLRGKTVEELLG 166


>gi|172056157|ref|YP_001812617.1| ribosomal protein S5 [Exiguobacterium sibiricum 255-15]
 gi|171988678|gb|ACB59600.1| ribosomal protein S5 [Exiguobacterium sibiricum 255-15]
          Length = 166

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  E   + + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RQLEINMDQLEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+NM++V +++  T+ H+  G  GAG V ++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNMVNVPIVN-TTIPHEINGIFGAGHVFLKPASEGTGVIAGGPVRAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +D+++KS+GSS P N++RAT + L S     DVA  RG     L+ 
Sbjct: 121 NDILSKSLGSSTPINMVRATVKGLTSLKRAEDVAKLRGKTVEELRG 166


>gi|329770023|ref|ZP_08261418.1| 30S ribosomal protein S5 [Gemella sanguinis M325]
 gi|328837334|gb|EGF86964.1| 30S ribosomal protein S5 [Gemella sanguinis M325]
          Length = 165

 Score =  180 bits (458), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +EE      +R+VAI RV+  + GGRRF FS LVVVGD   +VGF    A+EVP+A++K
Sbjct: 2   RQEEIKKEFEERVVAIRRVAKVVKGGRRFRFSALVVVGDKNGRVGFGTGKAQEVPDAIKK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A EAAK N+I+V +++  T+ H+  G+ GAG V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AVEAAKHNLITVPVVN-GTIPHEITGQFGAGSVLVKPAAPGTGVIAGGPVRAVLELAGIS 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           ++++KS+GS+ P N++RAT E L        VA  RG     L  
Sbjct: 121 NILSKSLGSNTPVNMVRATIEGLTRLQTVEHVAALRGKSVEELLG 165


>gi|52078626|ref|YP_077417.1| 30S ribosomal protein S5 [Bacillus licheniformis ATCC 14580]
 gi|52783988|ref|YP_089817.1| 30S ribosomal protein S5 [Bacillus licheniformis ATCC 14580]
 gi|319649099|ref|ZP_08003307.1| 30S ribosomal protein S5 [Bacillus sp. BT1B_CT2]
 gi|73919029|sp|Q65P90|RS5_BACLD RecName: Full=30S ribosomal protein S5
 gi|52001837|gb|AAU21779.1| ribosomal protein S5 [Bacillus licheniformis ATCC 14580]
 gi|52346490|gb|AAU39124.1| RpsE [Bacillus licheniformis ATCC 14580]
 gi|317388799|gb|EFV69618.1| 30S ribosomal protein S5 [Bacillus sp. BT1B_CT2]
          Length = 168

 Score =  180 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 76/168 (45%), Positives = 108/168 (64%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           N +  +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA
Sbjct: 2   NMRRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA E AK+N+I V ++ G T+ H+ +GR GAG ++++ A  GTGVIAGG +RAV E+ 
Sbjct: 62  IRKAVEDAKKNLIEVPMV-GTTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ D+++KS+GS+ P N+IRAT + L       DVA  RG     L  
Sbjct: 121 GVSDILSKSLGSNTPINMIRATVQGLSELKRAEDVAKLRGKSVEELLG 168


>gi|311029066|ref|ZP_07707156.1| 30S ribosomal protein S5 [Bacillus sp. m3-13]
          Length = 167

 Score =  180 bits (457), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 72/167 (43%), Positives = 108/167 (64%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            ++ +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+
Sbjct: 2   RRSIDPNKLELEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGNVGFGTGKAQEVPEAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA E AK+N+++V ++ G T+ H  +G  G+G+++++ A  GTGVIAGG +RAV E+ G
Sbjct: 62  RKAIEDAKKNLVAVPIV-GTTIPHQVLGEFGSGEILLKPASEGTGVIAGGPVRAVLELAG 120

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + D+++KS+GS+ P N+IRAT   L+      DVA  RG     L  
Sbjct: 121 VQDILSKSLGSNTPINMIRATLNGLKQLKRAEDVAKLRGKTVEELLG 167


>gi|227555870|ref|ZP_03985917.1| ribosomal protein S5 [Enterococcus faecalis HH22]
 gi|227175037|gb|EEI56009.1| ribosomal protein S5 [Enterococcus faecalis HH22]
          Length = 166

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           + +   + DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPKHLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIRKAI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N++ V ++ G T+ H+ +G  G G+++M+ A+ G GV AGG +RAV E+ G+ D+
Sbjct: 65  EDAKKNLVEVPMV-GSTIPHEVIGVFGGGRILMKPAVEGFGVAAGGPVRAVLELAGVADI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GS+ P NV+RAT E L+      +VA  RG     +  
Sbjct: 124 TSKSLGSNTPINVVRATVEGLKQLKRAEEVAALRGKSVEEIIG 166


>gi|163745561|ref|ZP_02152921.1| 30S ribosomal protein S5 [Oceanibulbus indolifex HEL-45]
 gi|161382379|gb|EDQ06788.1| 30S ribosomal protein S5 [Oceanibulbus indolifex HEL-45]
          Length = 193

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 104/192 (54%), Positives = 135/192 (70%), Gaps = 1/192 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+ +    +    R+E      DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MARDDNRGGNRRNQRDET-PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAG
Sbjct: 60  KGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDMHGRHGAGKVVMRTAPEGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVV+KSIGS NP+N+IRAT + L+ +  PR VA RRG K + +  +R
Sbjct: 120 GPMRAVFEMLGVKDVVSKSIGSQNPYNMIRATLDGLKKEQSPRSVAQRRGKKVADILPKR 179

Query: 181 VVSSKSSSYSRD 192
             + +SS+   +
Sbjct: 180 EDNVESSAQVAE 191


>gi|312877382|ref|ZP_07737347.1| ribosomal protein S5 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795856|gb|EFR12220.1| ribosomal protein S5 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 168

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  + +   + +R+V INRV+  + GG+R  FS +VVVGD    VG  H  A E+P+A+
Sbjct: 3   QKRIDPKGLDLKERVVNINRVAKVVKGGKRLKFSAIVVVGDENGHVGAGHGKAAEIPDAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA E AK+++I V ++ G T+ H+ +G  GA KV+++ A  GTGVIAGGA+RAVCE+ G
Sbjct: 63  RKAIEDAKKHLIKVPIV-GTTIPHEAIGDFGASKVLIKPAPEGTGVIAGGAVRAVCELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + D+  KS+GS+NP NV+ AT E L+    P +VA  RG     +
Sbjct: 122 IKDIRTKSLGSNNPANVVHATIEALKQLRRPEEVARIRGKTFEEI 166


>gi|291482505|dbj|BAI83580.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. natto BEST195]
          Length = 168

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 4   RRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 63

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +GR GAG ++++ A  GTGVIAGG +RAV E+ G+
Sbjct: 64  KAVEDAKKNLIEVPMV-GTTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT + L       DVA  RG     L  
Sbjct: 123 ADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEELLG 168


>gi|16077201|ref|NP_388014.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307945|ref|ZP_03589792.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312266|ref|ZP_03594071.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317200|ref|ZP_03598494.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321463|ref|ZP_03602757.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|311070780|ref|YP_003975703.1| 30S ribosomal protein S5 [Bacillus atrophaeus 1942]
 gi|321313804|ref|YP_004206091.1| 30S ribosomal protein S5 [Bacillus subtilis BSn5]
 gi|1173265|sp|P21467|RS5_BACSU RecName: Full=30S ribosomal protein S5; Short=BS5
 gi|1044981|gb|AAB06816.1| ribosomal protein S5 [Bacillus subtilis]
 gi|2632400|emb|CAB11909.1| ribosomal protein S5 [Bacillus subtilis subsp. subtilis str. 168]
 gi|310871297|gb|ADP34772.1| 30S ribosomal protein S5 [Bacillus atrophaeus 1942]
 gi|320020078|gb|ADV95064.1| 30S ribosomal protein S5 [Bacillus subtilis BSn5]
          Length = 166

 Score =  180 bits (457), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +GR GAG ++++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAVEDAKKNLIEVPMV-GTTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT + L       DVA  RG     L  
Sbjct: 121 ADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEELLG 166


>gi|241888993|ref|ZP_04776297.1| ribosomal protein S5 [Gemella haemolysans ATCC 10379]
 gi|329768290|ref|ZP_08259791.1| 30S ribosomal protein S5 [Gemella haemolysans M341]
 gi|241864242|gb|EER68620.1| ribosomal protein S5 [Gemella haemolysans ATCC 10379]
 gi|328837489|gb|EGF87118.1| 30S ribosomal protein S5 [Gemella haemolysans M341]
          Length = 165

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +EE      +R+VAI RV+  + GGRRF FS LVVVGD   +VGF    A+EVP+A+RK
Sbjct: 2   RQEEIKKEFEERVVAIRRVAKVVKGGRRFRFSALVVVGDKNGRVGFGTGKAQEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A EAAK N+I+V +++  T+ H+ +G+ GAG V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AVEAAKHNLITVPVVN-GTIPHEIIGQFGAGSVLIKPAAPGTGVIAGGPVRAVLELSGIS 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           ++++KS+GS+ P N++RAT E L        VA  RG     L  
Sbjct: 121 NILSKSLGSNTPVNMVRATIEGLTRLQTVEHVAALRGKSVEELLG 165


>gi|284049240|ref|YP_003399579.1| ribosomal protein S5 [Acidaminococcus fermentans DSM 20731]
 gi|283953461|gb|ADB48264.1| ribosomal protein S5 [Acidaminococcus fermentans DSM 20731]
          Length = 166

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 114/165 (69%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++D+   +R+V INRV+  + GGRRF+FS LVVVGD   KVG     A EVPEA+RK
Sbjct: 3   NYEKQDDGFKERVVFINRVAKVVKGGRRFSFSALVVVGDENGKVGMGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             + AK+N+I+V L  G T+ H+ +G  GAG+V+++ AM GTGVIAGG +RAV E+ G+ 
Sbjct: 63  GVDDAKKNLITVPL-KGTTIPHEVIGVFGAGRVLLKPAMEGTGVIAGGPVRAVLELAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS G+SNP+NV+RAT E L+S  + +DVA  RG     L  
Sbjct: 122 DILTKSQGTSNPNNVVRATLEGLKSLKNAKDVAALRGKTVEELLG 166


>gi|296333130|ref|ZP_06875584.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672832|ref|YP_003864503.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149746|gb|EFG90641.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411075|gb|ADM36193.1| 30S ribosomal protein S5 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|328551834|gb|AEB22326.1| 30S ribosomal protein S5 [Bacillus amyloliquefaciens TA208]
          Length = 166

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +GR GAG ++++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAVEDAKKNLIEVPMV-GTTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT + L       +VA  RG     L  
Sbjct: 121 ADILSKSLGSNTPINMIRATLQGLSELKRAEEVAKLRGKSVEELLG 166


>gi|154684651|ref|YP_001419812.1| 30S ribosomal protein S5 [Bacillus amyloliquefaciens FZB42]
 gi|308172024|ref|YP_003918729.1| 30S ribosomal protein S5 [Bacillus amyloliquefaciens DSM 7]
 gi|171854996|sp|A7Z0Q5|RS5_BACA2 RecName: Full=30S ribosomal protein S5
 gi|154350502|gb|ABS72581.1| RpsE [Bacillus amyloliquefaciens FZB42]
 gi|307604888|emb|CBI41259.1| ribosomal protein S5 [Bacillus amyloliquefaciens DSM 7]
 gi|328910092|gb|AEB61688.1| 30S ribosomal protein S5 [Bacillus amyloliquefaciens LL3]
          Length = 168

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 4   RRIDPSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 63

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +GR GAG ++++ A  GTGVIAGG +RAV E+ G+
Sbjct: 64  KAVEDAKKNLIEVPMV-GTTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT + L       +VA  RG     L  
Sbjct: 123 ADILSKSLGSNTPINMIRATLQGLSELKRAEEVAKLRGKSVEELLG 168


>gi|293402518|ref|ZP_06646653.1| ribosomal protein S5 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291304032|gb|EFE45286.1| ribosomal protein S5 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 172

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/173 (43%), Positives = 113/173 (65%), Gaps = 2/173 (1%)

Query: 6   RSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAR 65
           R +R   +NR+       +R+V INRV+  + GGRRF F+ LVV+GD K +VGF    A 
Sbjct: 2   RMERKPRRNRDVEK-EFEERVVTINRVTKVVKGGRRFRFAALVVIGDKKGRVGFGTGKAN 60

Query: 66  EVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRA 125
           EVP+A++KA E AK+N+ +V ++ G T+ H+  GR+GAG++ +R A  GTGVIAGG +RA
Sbjct: 61  EVPDAIKKAVEDAKKNVFNVPIV-GTTIPHEITGRYGAGEIFLRPATEGTGVIAGGPVRA 119

Query: 126 VCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V E+ G++D+++K +GS  P N++RAT   L+      DVA  RG K   ++ 
Sbjct: 120 VLELAGINDILSKCLGSRTPINMVRATIAALKDLKTIEDVARLRGKKPEEIRG 172


>gi|169823869|ref|YP_001691480.1| 30S ribosomal protein S5 [Finegoldia magna ATCC 29328]
 gi|302379774|ref|ZP_07268258.1| ribosomal protein S5 [Finegoldia magna ACS-171-V-Col3]
 gi|303234778|ref|ZP_07321404.1| ribosomal protein S5 [Finegoldia magna BVS033A4]
 gi|167830674|dbj|BAG07590.1| 30S ribosomal protein S5 [Finegoldia magna ATCC 29328]
 gi|302312362|gb|EFK94359.1| ribosomal protein S5 [Finegoldia magna ACS-171-V-Col3]
 gi|302494119|gb|EFL53899.1| ribosomal protein S5 [Finegoldia magna BVS033A4]
          Length = 168

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N+E     + +R+V INRV+  + GGR F F+ LVVVGD    VG     A+EVPEA+RK
Sbjct: 5   NKEIEGLELEERVVNINRVAKVVKGGRNFRFAALVVVGDKNGHVGVGIGKAQEVPEAIRK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A++ AK+++ +V +++  T+ H   G  GAG+V+++ A  GTGVIAGG +RAVCE+ G+ 
Sbjct: 65  ASQDAKKHIFTVPIVN-TTIPHQVTGIFGAGRVLLKPAGEGTGVIAGGPVRAVCELAGIK 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           DV +KS+G+SNP N++ AT E L+S      VA  RG     +
Sbjct: 124 DVRSKSLGTSNPQNIVNATVEGLKSLKTAEQVAKLRGKSVEEI 166


>gi|242039059|ref|XP_002466924.1| hypothetical protein SORBIDRAFT_01g016780 [Sorghum bicolor]
 gi|241920778|gb|EER93922.1| hypothetical protein SORBIDRAFT_01g016780 [Sorghum bicolor]
          Length = 317

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 60/166 (36%), Positives = 94/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +    +  ++   +R+V +NRV+  + GGR+ ++  +VVVGD K  VG     A+EV EA
Sbjct: 150 DMDREQRPNDDFTERVVQVNRVTKVVKGGRQLSYRAIVVVGDMKGHVGVGVGKAKEVTEA 209

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           + KA    +RN+++V L    T  H     +GA +V++R A  G+GVIAGGA+R V E+ 
Sbjct: 210 ITKAAMNGRRNLVTVPLTKYSTFPHRADADYGAARVMLRPACPGSGVIAGGAVRVVLEMA 269

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K + S NP N  RAT +  +     +DVA  RG+    L
Sbjct: 270 GVENALGKQLRSKNPLNNARATIKATQMMKQFKDVAEERGVPMEEL 315


>gi|299820972|ref|ZP_07052861.1| 30S ribosomal protein S5 [Listeria grayi DSM 20601]
 gi|299817993|gb|EFI85228.1| 30S ribosomal protein S5 [Listeria grayi DSM 20601]
          Length = 167

 Score =  180 bits (456), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 71/166 (42%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 3   EQIDGNKLDLEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGHVGFGTGKAQEVPDAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA + AK+NMI V  ++  T+ H  VG  G G+++++ A AG+GV AGG +RAV E+ G+
Sbjct: 63  KAVDDAKKNMIFVPTVN-TTIPHTVVGNFGGGEILLKPASAGSGVTAGGPVRAVLELAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +KS+GS+ P N++RAT + ++   +  DVA  RG     L  
Sbjct: 122 ADVSSKSLGSNTPINMVRATIDGIKQLKNAADVAKLRGKTVEELLG 167


>gi|315122801|ref|YP_004063290.1| 30S ribosomal protein S5 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496203|gb|ADR52802.1| 30S ribosomal protein S5 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 196

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 173/196 (88%), Positives = 187/196 (95%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQKERSQRDNWQNREERDNSI+DRIV+INRVSTALPGGRRFAFSVLVVVGDTKSK GFA
Sbjct: 1   MAQKERSQRDNWQNREERDNSIIDRIVSINRVSTALPGGRRFAFSVLVVVGDTKSKAGFA 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           HSTAREVPEAVRKATEAAKRNM+S+SLLDGRTLHHDG+GRHGAGKV++RSAM GTGVIAG
Sbjct: 61  HSTAREVPEAVRKATEAAKRNMVSISLLDGRTLHHDGLGRHGAGKVLIRSAMPGTGVIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GAIRAVCEVLG+HD+VAKSIGSSNPHNV+RATF+ LRSQSHPRD+ANRRGIKHSLLQARR
Sbjct: 121 GAIRAVCEVLGVHDIVAKSIGSSNPHNVVRATFKALRSQSHPRDIANRRGIKHSLLQARR 180

Query: 181 VVSSKSSSYSRDSKNK 196
           VVSSKS   S   ++K
Sbjct: 181 VVSSKSKVSSNHGEDK 196


>gi|160914543|ref|ZP_02076758.1| hypothetical protein EUBDOL_00549 [Eubacterium dolichum DSM 3991]
 gi|158433701|gb|EDP11990.1| hypothetical protein EUBDOL_00549 [Eubacterium dolichum DSM 3991]
          Length = 169

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 77/169 (45%), Positives = 111/169 (65%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           +    R ER+    +R+V INRV+  + GGRRF F+ LVV+GD K +VGF    A EVP+
Sbjct: 2   ERKPRRNEREKEFEERVVTINRVTKVVKGGRRFRFAALVVIGDKKGRVGFGTGKANEVPD 61

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++KA E AK+N+  V ++ G T+ H+ VG +GAG+V +R A  GTGVIAGGA+R V E+
Sbjct: 62  AIKKAIEDAKKNVFRVPVI-GTTIPHEIVGTYGAGEVFLRPASEGTGVIAGGAVRDVLEL 120

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G++DV++K IGS  P N++ AT E L++     +VA  RG K   ++ 
Sbjct: 121 AGINDVLSKCIGSRTPINMVHATVEALQNLKTVEEVARLRGKKPEEIRG 169


>gi|327438295|dbj|BAK14660.1| ribosomal protein S5 [Solibacillus silvestris StLB046]
          Length = 166

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF FS LVVVGD    VGF    A+EVP+A+RK
Sbjct: 3   RIDANKLELEERVVTINRVAKVVKGGRRFRFSALVVVGDKNGHVGFGTGKAQEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I V  + G T  H   GR GAG ++++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  AVEDAKKNLIEVPRV-GGTTPHLVQGRFGAGSILIKPAAPGTGVIAGGPVRAVLELAGIT 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+ P N++RAT   L       +VA  RG     L  
Sbjct: 122 DILSKSLGSNTPINMVRATVAGLTELKRVEEVAKLRGKSVEELLG 166


>gi|167767786|ref|ZP_02439839.1| hypothetical protein CLOSS21_02321 [Clostridium sp. SS2/1]
 gi|317497078|ref|ZP_07955405.1| ribosomal protein S5 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710525|gb|EDS21104.1| hypothetical protein CLOSS21_02321 [Clostridium sp. SS2/1]
 gi|291558873|emb|CBL37673.1| SSU ribosomal protein S5P [butyrate-producing bacterium SSC/2]
 gi|316895623|gb|EFV17778.1| ribosomal protein S5 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 169

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 93/163 (57%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + +R+V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA+RK  
Sbjct: 7   DPSQLELEERVVSIKRVTKVVKGGRNMRFAALVVVGDKNGHVGAGLGKAAEIPEAIRKGK 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           EAA ++++ V + +  T  HD  G  G   V+++++  GTG+IAGG  R V E+ G  ++
Sbjct: 67  EAAMKSLVEVPIDEKGTTPHDFTGNFGGASVLLKTSPEGTGIIAGGPSRIVLELAGYKNI 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GS+N  NV+ AT E L++   P  VA  RG     L  
Sbjct: 127 RSKSLGSNNKQNVVLATIEGLKNLKTPEQVAKLRGKSVEELLG 169


>gi|296282599|ref|ZP_06860597.1| 30S ribosomal protein S5 [Citromicrobium bathyomarinum JL354]
          Length = 284

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 98/167 (58%), Positives = 129/167 (77%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            REE D+ I++++V INRVS  + GG+RF F+ LVVVGD + +VGF H  AREVPEA+ K
Sbjct: 102 KREEEDDGIIEKLVHINRVSKTVKGGKRFGFAALVVVGDGQGRVGFGHGKAREVPEAISK 161

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A+ AA+++MI V+L +GRTLHHDG GR GAGKV +R+A  GTG+IAGG +RAV E LG+ 
Sbjct: 162 ASAAARKHMIRVALKEGRTLHHDGKGRFGAGKVTVRTAPPGTGIIAGGPMRAVFESLGVA 221

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           DVV KS+G+SNP+N+IRATF+ L+ QS P+ VA RRG K + L +R 
Sbjct: 222 DVVTKSVGTSNPYNMIRATFDALQDQSSPKSVAQRRGKKVADLLSRG 268


>gi|299541949|ref|ZP_07052272.1| 30S ribosomal protein S5 [Lysinibacillus fusiformis ZC1]
 gi|298725687|gb|EFI66328.1| 30S ribosomal protein S5 [Lysinibacillus fusiformis ZC1]
          Length = 167

 Score =  179 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/158 (46%), Positives = 102/158 (64%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+RKA E AK+
Sbjct: 11  ELEERVVTINRVAKVVKGGRRFRFTALVVVGDRNGHVGFGTGKAQEVPDAIRKAVEDAKK 70

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V  + G T  H   GR GAG+++++ A  GTGVIAGG +RAV E+ G+ D+++KS+
Sbjct: 71  NLIEVPRV-GGTTPHLVQGRFGAGEILIKPAAPGTGVIAGGPVRAVLELAGITDILSKSL 129

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+ P N++RAT + L       DVA  RG     L  
Sbjct: 130 GSNTPINMVRATIQGLTELKRVEDVAKLRGKSVEELLG 167


>gi|312144230|ref|YP_003995676.1| ribosomal protein S5 [Halanaerobium sp. 'sapolanicus']
 gi|311904881|gb|ADQ15322.1| ribosomal protein S5 [Halanaerobium sp. 'sapolanicus']
          Length = 166

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 104/166 (62%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +    ++ +R+V INRVS  + GGRRF+FS LVVVGD    VG     A EVPEA+R
Sbjct: 2   KKIDASKLNLDERVVNINRVSKVVKGGRRFSFSALVVVGDEDGHVGAGIGKANEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  +AAK+ +I V ++D  T+ H+  G  GAG+V+++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KGIDAAKKEIIKVPIVD-TTIPHEITGVFGAGRVLLKPAAPGTGVIAGGPVRAVIELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+G+SNP N+I AT   L+      +VA  RG     L  
Sbjct: 121 SDILTKSLGTSNPINMINATMTGLKELKSAEEVAKLRGKSVEELIG 166


>gi|125544487|gb|EAY90626.1| hypothetical protein OsI_12226 [Oryza sativa Indica Group]
          Length = 316

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 61/166 (36%), Positives = 93/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +    +   +   +R+V +NRV+  + GGR+ +F  +VVVGD K  VG     A+EV EA
Sbjct: 149 DMDREQRPSDEFSERVVQVNRVTKVVKGGRQLSFRAIVVVGDMKGHVGVGVGKAKEVTEA 208

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           + KA    +RN+++V L    T  H     +GA +V++R A  G+GVIAGGA+R V E+ 
Sbjct: 209 ITKAAMNGRRNLVTVPLTKYSTFPHRADADYGAARVMLRPACPGSGVIAGGAVRVVLEMA 268

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K + S NP N  RAT +  +     +DVA  RG+    L
Sbjct: 269 GVENALGKQLRSKNPLNNARATIKATQMMRQFKDVAAERGLPMEQL 314


>gi|157690917|ref|YP_001485379.1| 30S ribosomal protein S5 [Bacillus pumilus SAFR-032]
 gi|194017570|ref|ZP_03056181.1| ribosomal protein S5 [Bacillus pumilus ATCC 7061]
 gi|172045996|sp|A8F9A2|RS5_BACP2 RecName: Full=30S ribosomal protein S5
 gi|157679675|gb|ABV60819.1| ribosomal protein S5 [Bacillus pumilus SAFR-032]
 gi|194010842|gb|EDW20413.1| ribosomal protein S5 [Bacillus pumilus ATCC 7061]
          Length = 166

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             ++    + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+RK
Sbjct: 3   RIDQSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I V ++ G T+ H+ +GR GAG V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  AVEDAKKNLIEVPMV-GTTIPHEIIGRFGAGNVLLKPASEGTGVIAGGPVRAVLELAGLA 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+ P N+IRAT + L       DVA  RG     L  
Sbjct: 122 DILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEDLLG 166


>gi|218135264|ref|ZP_03464068.1| hypothetical protein BACPEC_03169 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990649|gb|EEC56660.1| hypothetical protein BACPEC_03169 [Bacteroides pectinophilus ATCC
           43243]
          Length = 169

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 60/167 (35%), Positives = 98/167 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     + E+PEA
Sbjct: 2   KRTIVDASQLELTEKVVSIKRVTKVVKGGRNFRFAALVVVGDGNGHVGAGVGKSIEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +++++V+  +  ++ HD +G+ G+  V+++ +  GTG+IAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKHLVTVARDENNSVPHDFIGKFGSASVLLKKSPEGTGLIAGGPARAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           G+ ++  KS+GS+N  NV+ AT E L     P +VA  RG   + L 
Sbjct: 122 GVKNIRTKSLGSNNKQNVVLATIEGLSQLKTPEEVAKLRGKSVAELY 168


>gi|149184159|ref|ZP_01862481.1| 30S ribosomal protein S5 [Bacillus sp. SG-1]
 gi|148848131|gb|EDL62459.1| 30S ribosomal protein S5 [Bacillus sp. SG-1]
          Length = 166

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+R
Sbjct: 2   RRIDPNKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N++ V ++ G T  H  +GR GAG+++++ A AGTG+IAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLVEVPMV-GGTTPHQVIGRFGAGEILIKPASAGTGIIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT   L+      DVA  RG     L  
Sbjct: 121 QDILSKSLGSNTPINMIRATISGLKELKRAEDVAKLRGKSVEELLG 166


>gi|90417749|ref|ZP_01225661.1| ribosomal protein S5 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337421|gb|EAS51072.1| ribosomal protein S5 [Aurantimonas manganoxydans SI85-9A1]
          Length = 185

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 112/172 (65%), Positives = 137/172 (79%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
             VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAKR
Sbjct: 14  GFVDKLVHINRVAKVVKGGRRFGFAALVVVGDLKGRVGFGHGKAREVPEAIRKATEAAKR 73

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           ++I V L DGRTLHHD  GRHGAGKVI+R+A AGTG+IAGG +RAV E +GMHDVVAKS+
Sbjct: 74  DLIFVPLRDGRTLHHDVSGRHGAGKVILRAAEAGTGIIAGGPMRAVFEAVGMHDVVAKSL 133

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           GSSNP+N++RATF+ L+   HP+DVA+RRGIK+S LQARR     + + S D
Sbjct: 134 GSSNPYNMVRATFDGLKQAMHPKDVASRRGIKYSELQARRREVIGAQAASED 185


>gi|298291455|ref|YP_003693394.1| ribosomal protein S5 [Starkeya novella DSM 506]
 gi|296927966|gb|ADH88775.1| ribosomal protein S5 [Starkeya novella DSM 506]
          Length = 183

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/167 (64%), Positives = 129/167 (77%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAKR 
Sbjct: 16  FVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAKRA 75

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +I V L +GRTLHHD  G HGAGKVI+R+A AGTG+IAGG +RAV E LGM DVVAKS G
Sbjct: 76  LIRVPLREGRTLHHDVHGHHGAGKVILRAAPAGTGIIAGGPMRAVFETLGMQDVVAKSFG 135

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           SSNP+N++RATFE L++Q  PR VA RR +K S LQ+RR V    ++
Sbjct: 136 SSNPYNMVRATFEALKNQDSPRLVAARRSLKVSQLQSRRRVDDAEAT 182


>gi|167748447|ref|ZP_02420574.1| hypothetical protein ANACAC_03191 [Anaerostipes caccae DSM 14662]
 gi|317472020|ref|ZP_07931352.1| ribosomal protein S5 [Anaerostipes sp. 3_2_56FAA]
 gi|167652439|gb|EDR96568.1| hypothetical protein ANACAC_03191 [Anaerostipes caccae DSM 14662]
 gi|316900424|gb|EFV22406.1| ribosomal protein S5 [Anaerostipes sp. 3_2_56FAA]
          Length = 169

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KRTMIDPSQLELEEKVVSIKRVTKVVKGGRNFRFAALVVVGDKNGHVGAGLGKAMEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA + ++ V + +  +  HD  G+ G+  V+++++  GTG+IAGG  R V E+ 
Sbjct: 62  IRKGREAAAKKLVEVPIDEKGSTPHDFTGKFGSASVLLKTSPEGTGIIAGGPSRDVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G  ++ +KS+GS+N  NV+ AT E L++   P +VA  RG     L  
Sbjct: 122 GYKNIRSKSLGSNNKQNVVLATIEGLKNLKTPEEVAKLRGKSVEELLG 169


>gi|29374868|ref|NP_814021.1| ribosomal protein S5 [Enterococcus faecalis V583]
 gi|227520009|ref|ZP_03950058.1| ribosomal protein S5 [Enterococcus faecalis TX0104]
 gi|229546947|ref|ZP_04435672.1| ribosomal protein S5 [Enterococcus faecalis TX1322]
 gi|229550536|ref|ZP_04439261.1| ribosomal protein S5 [Enterococcus faecalis ATCC 29200]
 gi|255971726|ref|ZP_05422312.1| ribosomal protein S5 [Enterococcus faecalis T1]
 gi|255974726|ref|ZP_05425312.1| ribosomal protein S5 [Enterococcus faecalis T2]
 gi|256618363|ref|ZP_05475209.1| ribosomal protein S5 [Enterococcus faecalis ATCC 4200]
 gi|256762021|ref|ZP_05502601.1| ribosomal protein S5 [Enterococcus faecalis T3]
 gi|256855180|ref|ZP_05560541.1| ribosomal protein S5 [Enterococcus faecalis T8]
 gi|256956845|ref|ZP_05561016.1| ribosomal protein S5 [Enterococcus faecalis DS5]
 gi|256960652|ref|ZP_05564823.1| 30S ribosomal protein S5 [Enterococcus faecalis Merz96]
 gi|256964149|ref|ZP_05568320.1| 30S ribosomal protein S5 [Enterococcus faecalis HIP11704]
 gi|257078515|ref|ZP_05572876.1| 30S ribosomal protein S5 [Enterococcus faecalis JH1]
 gi|257081514|ref|ZP_05575875.1| ribosomal protein S5 [Enterococcus faecalis E1Sol]
 gi|257084162|ref|ZP_05578523.1| ribosomal protein S5 [Enterococcus faecalis Fly1]
 gi|257087989|ref|ZP_05582350.1| ribosomal protein S5 [Enterococcus faecalis D6]
 gi|257088666|ref|ZP_05583027.1| 30S ribosomal protein S5 [Enterococcus faecalis CH188]
 gi|257417593|ref|ZP_05594587.1| ribosomal protein S5 [Enterococcus faecalis AR01/DG]
 gi|257418682|ref|ZP_05595676.1| 30S ribosomal protein S5 [Enterococcus faecalis T11]
 gi|257421517|ref|ZP_05598507.1| 30S ribosomal protein S5 [Enterococcus faecalis X98]
 gi|293382741|ref|ZP_06628666.1| ribosomal protein S5 [Enterococcus faecalis R712]
 gi|293388076|ref|ZP_06632604.1| ribosomal protein S5 [Enterococcus faecalis S613]
 gi|294781068|ref|ZP_06746419.1| ribosomal protein S5 [Enterococcus faecalis PC1.1]
 gi|300862137|ref|ZP_07108217.1| ribosomal protein S5 [Enterococcus faecalis TUSoD Ef11]
 gi|307269104|ref|ZP_07550465.1| ribosomal protein S5 [Enterococcus faecalis TX4248]
 gi|307274188|ref|ZP_07555396.1| ribosomal protein S5 [Enterococcus faecalis TX0855]
 gi|307276413|ref|ZP_07557536.1| ribosomal protein S5 [Enterococcus faecalis TX2134]
 gi|307278623|ref|ZP_07559693.1| ribosomal protein S5 [Enterococcus faecalis TX0860]
 gi|307286997|ref|ZP_07567072.1| ribosomal protein S5 [Enterococcus faecalis TX0109]
 gi|307291662|ref|ZP_07571537.1| ribosomal protein S5 [Enterococcus faecalis TX0411]
 gi|312901105|ref|ZP_07760393.1| ribosomal protein S5 [Enterococcus faecalis TX0470]
 gi|312904667|ref|ZP_07763822.1| ribosomal protein S5 [Enterococcus faecalis TX0635]
 gi|312908636|ref|ZP_07767578.1| ribosomal protein S5 [Enterococcus faecalis DAPTO 512]
 gi|312909216|ref|ZP_07768073.1| ribosomal protein S5 [Enterococcus faecalis DAPTO 516]
 gi|312952624|ref|ZP_07771488.1| ribosomal protein S5 [Enterococcus faecalis TX0102]
 gi|73919052|sp|Q839E7|RS5_ENTFA RecName: Full=30S ribosomal protein S5
 gi|29342326|gb|AAO80092.1| ribosomal protein S5 [Enterococcus faecalis V583]
 gi|227072557|gb|EEI10520.1| ribosomal protein S5 [Enterococcus faecalis TX0104]
 gi|229304255|gb|EEN70251.1| ribosomal protein S5 [Enterococcus faecalis ATCC 29200]
 gi|229307875|gb|EEN73862.1| ribosomal protein S5 [Enterococcus faecalis TX1322]
 gi|255962744|gb|EET95220.1| ribosomal protein S5 [Enterococcus faecalis T1]
 gi|255967598|gb|EET98220.1| ribosomal protein S5 [Enterococcus faecalis T2]
 gi|256597890|gb|EEU17066.1| ribosomal protein S5 [Enterococcus faecalis ATCC 4200]
 gi|256683272|gb|EEU22967.1| ribosomal protein S5 [Enterococcus faecalis T3]
 gi|256709693|gb|EEU24740.1| ribosomal protein S5 [Enterococcus faecalis T8]
 gi|256947341|gb|EEU63973.1| ribosomal protein S5 [Enterococcus faecalis DS5]
 gi|256951148|gb|EEU67780.1| 30S ribosomal protein S5 [Enterococcus faecalis Merz96]
 gi|256954645|gb|EEU71277.1| 30S ribosomal protein S5 [Enterococcus faecalis HIP11704]
 gi|256986545|gb|EEU73847.1| 30S ribosomal protein S5 [Enterococcus faecalis JH1]
 gi|256989544|gb|EEU76846.1| ribosomal protein S5 [Enterococcus faecalis E1Sol]
 gi|256992192|gb|EEU79494.1| ribosomal protein S5 [Enterococcus faecalis Fly1]
 gi|256996019|gb|EEU83321.1| ribosomal protein S5 [Enterococcus faecalis D6]
 gi|256997478|gb|EEU83998.1| 30S ribosomal protein S5 [Enterococcus faecalis CH188]
 gi|257159421|gb|EEU89381.1| ribosomal protein S5 [Enterococcus faecalis ARO1/DG]
 gi|257160510|gb|EEU90470.1| 30S ribosomal protein S5 [Enterococcus faecalis T11]
 gi|257163341|gb|EEU93301.1| 30S ribosomal protein S5 [Enterococcus faecalis X98]
 gi|291079901|gb|EFE17265.1| ribosomal protein S5 [Enterococcus faecalis R712]
 gi|291082527|gb|EFE19490.1| ribosomal protein S5 [Enterococcus faecalis S613]
 gi|294451871|gb|EFG20322.1| ribosomal protein S5 [Enterococcus faecalis PC1.1]
 gi|295112517|emb|CBL31154.1| SSU ribosomal protein S5P [Enterococcus sp. 7L76]
 gi|300848662|gb|EFK76419.1| ribosomal protein S5 [Enterococcus faecalis TUSoD Ef11]
 gi|306497281|gb|EFM66823.1| ribosomal protein S5 [Enterococcus faecalis TX0411]
 gi|306501943|gb|EFM71232.1| ribosomal protein S5 [Enterococcus faecalis TX0109]
 gi|306504683|gb|EFM73883.1| ribosomal protein S5 [Enterococcus faecalis TX0860]
 gi|306506893|gb|EFM76040.1| ribosomal protein S5 [Enterococcus faecalis TX2134]
 gi|306509150|gb|EFM78212.1| ribosomal protein S5 [Enterococcus faecalis TX0855]
 gi|306514584|gb|EFM83138.1| ribosomal protein S5 [Enterococcus faecalis TX4248]
 gi|310625423|gb|EFQ08706.1| ribosomal protein S5 [Enterococcus faecalis DAPTO 512]
 gi|310629412|gb|EFQ12695.1| ribosomal protein S5 [Enterococcus faecalis TX0102]
 gi|310632019|gb|EFQ15302.1| ribosomal protein S5 [Enterococcus faecalis TX0635]
 gi|311290458|gb|EFQ69014.1| ribosomal protein S5 [Enterococcus faecalis DAPTO 516]
 gi|311291777|gb|EFQ70333.1| ribosomal protein S5 [Enterococcus faecalis TX0470]
 gi|315026818|gb|EFT38750.1| ribosomal protein S5 [Enterococcus faecalis TX2137]
 gi|315028858|gb|EFT40790.1| ribosomal protein S5 [Enterococcus faecalis TX4000]
 gi|315031156|gb|EFT43088.1| ribosomal protein S5 [Enterococcus faecalis TX0017]
 gi|315035998|gb|EFT47930.1| ribosomal protein S5 [Enterococcus faecalis TX0027]
 gi|315145353|gb|EFT89369.1| ribosomal protein S5 [Enterococcus faecalis TX2141]
 gi|315147154|gb|EFT91170.1| ribosomal protein S5 [Enterococcus faecalis TX4244]
 gi|315151088|gb|EFT95104.1| ribosomal protein S5 [Enterococcus faecalis TX0012]
 gi|315153592|gb|EFT97608.1| ribosomal protein S5 [Enterococcus faecalis TX0031]
 gi|315156228|gb|EFU00245.1| ribosomal protein S5 [Enterococcus faecalis TX0043]
 gi|315158627|gb|EFU02644.1| ribosomal protein S5 [Enterococcus faecalis TX0312]
 gi|315160745|gb|EFU04762.1| ribosomal protein S5 [Enterococcus faecalis TX0645]
 gi|315165884|gb|EFU09901.1| ribosomal protein S5 [Enterococcus faecalis TX1302]
 gi|315168117|gb|EFU12134.1| ribosomal protein S5 [Enterococcus faecalis TX1341]
 gi|315171443|gb|EFU15460.1| ribosomal protein S5 [Enterococcus faecalis TX1342]
 gi|315172677|gb|EFU16694.1| ribosomal protein S5 [Enterococcus faecalis TX1346]
 gi|315573531|gb|EFU85722.1| ribosomal protein S5 [Enterococcus faecalis TX0309B]
 gi|315579343|gb|EFU91534.1| ribosomal protein S5 [Enterococcus faecalis TX0630]
 gi|315582121|gb|EFU94312.1| ribosomal protein S5 [Enterococcus faecalis TX0309A]
 gi|323479439|gb|ADX78878.1| ribosomal protein S5 [Enterococcus faecalis 62]
 gi|327534021|gb|AEA92855.1| 30S ribosomal protein S5 [Enterococcus faecalis OG1RF]
 gi|329577732|gb|EGG59158.1| ribosomal protein S5 [Enterococcus faecalis TX1467]
          Length = 166

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           + +   + DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPKHLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIRKAI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N++ V ++ G T+ H+ +G  G G+++M+ A+ G+GV AGG +RAV E+ G+ D+
Sbjct: 65  EDAKKNLVEVPMV-GSTIPHEVIGVFGGGRILMKPAVEGSGVAAGGPVRAVLELAGVADI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GS+ P NV+RAT E L+      +VA  RG     +  
Sbjct: 124 TSKSLGSNTPINVVRATVEGLKQLKRAEEVAALRGKSVEEIIG 166


>gi|254486880|ref|ZP_05100085.1| ribosomal protein S5 [Roseobacter sp. GAI101]
 gi|214043749|gb|EEB84387.1| ribosomal protein S5 [Roseobacter sp. GAI101]
          Length = 193

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 107/192 (55%), Positives = 139/192 (72%), Gaps = 1/192 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA ++ ++  N +N+ E      DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MA-RDDNRGGNRRNQREETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAG
Sbjct: 60  KGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDMEGRHGAGKVVMRTAPEGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVV+KSIGS NP+N+IRAT + LR +S PR VA RRG K + +  +R
Sbjct: 120 GPMRAVFEMLGIKDVVSKSIGSQNPYNMIRATMDGLRKESSPRAVAQRRGKKVADILPKR 179

Query: 181 VVSSKSSSYSRD 192
             + +SS+   +
Sbjct: 180 EDNVESSAQVAE 191


>gi|51244994|ref|YP_064878.1| 30S ribosomal protein S5 [Desulfotalea psychrophila LSv54]
 gi|73919050|sp|Q6AP53|RS5_DESPS RecName: Full=30S ribosomal protein S5
 gi|50876031|emb|CAG35871.1| probable 30S ribosomal protein S5 [Desulfotalea psychrophila LSv54]
          Length = 171

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 74/178 (41%), Positives = 113/178 (63%), Gaps = 7/178 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           M+  +RS+ +N          ++++IV INRV+  + GGRRF+FS +VVVGD   KVG+ 
Sbjct: 1   MSDFKRSKANNN------TEELIEKIVFINRVAKVVKGGRRFSFSAIVVVGDGNGKVGYG 54

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A +VPEA+RK  E A+++M  VSL D  ++ H  +G +GAG+V +R A AGTG+IAG
Sbjct: 55  LGKANQVPEAIRKGVERARKDMALVSLTDV-SIPHQVIGHYGAGRVFLRPASAGTGLIAG 113

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G +RAV E  G+ +++ K +GS NPHN+++AT + L+     + +A  RG     + A
Sbjct: 114 GPVRAVLEAAGVSNILTKCLGSHNPHNMVKATIDGLKQLRSAQKIAELRGKNVEEITA 171


>gi|257866546|ref|ZP_05646199.1| ribosomal protein S5 [Enterococcus casseliflavus EC30]
 gi|257870534|ref|ZP_05650187.1| ribosomal protein S5 [Enterococcus gallinarum EG2]
 gi|257872939|ref|ZP_05652592.1| ribosomal protein S5 [Enterococcus casseliflavus EC10]
 gi|257876150|ref|ZP_05655803.1| ribosomal protein S5 [Enterococcus casseliflavus EC20]
 gi|325567359|ref|ZP_08144026.1| 30S ribosomal protein S5 [Enterococcus casseliflavus ATCC 12755]
 gi|257800504|gb|EEV29532.1| ribosomal protein S5 [Enterococcus casseliflavus EC30]
 gi|257804698|gb|EEV33520.1| ribosomal protein S5 [Enterococcus gallinarum EG2]
 gi|257807103|gb|EEV35925.1| ribosomal protein S5 [Enterococcus casseliflavus EC10]
 gi|257810316|gb|EEV39136.1| ribosomal protein S5 [Enterococcus casseliflavus EC20]
 gi|325158792|gb|EGC70938.1| 30S ribosomal protein S5 [Enterococcus casseliflavus ATCC 12755]
          Length = 166

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           + +   + DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPKHLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIRKAI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N++ V ++ G T+ H+ +G  G G+++M+ A+ G+GV AGG +RAV E+ G+ D+
Sbjct: 65  EDAKKNLVEVPMV-GSTIPHEVIGVFGGGRILMKPAVEGSGVAAGGPVRAVLELAGVADI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GS+ P NV+RAT E L+      +VA  RG     L  
Sbjct: 124 TSKSLGSNTPINVVRATVEGLKQLKRAEEVAALRGKSVEELIG 166


>gi|134298110|ref|YP_001111606.1| 30S ribosomal protein S5 [Desulfotomaculum reducens MI-1]
 gi|172044232|sp|A4J128|RS5_DESRM RecName: Full=30S ribosomal protein S5
 gi|134050810|gb|ABO48781.1| SSU ribosomal protein S5P [Desulfotomaculum reducens MI-1]
          Length = 166

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 104/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   RIDASKLELTEKVVYINRVAKVVKGGRRFSFSALVVVGDGNGHVGAGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NMI V L +G T+ H   GR GAGKV+M+ A  GTGVIAGG +RA+ E+ G+ 
Sbjct: 63  GIEDAKKNMIKVPL-NGTTITHQIQGRFGAGKVLMKPAAKGTGVIAGGPVRAILELAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+G++N +N++ AT E L+    P +VA  RG     L  
Sbjct: 122 DILTKSLGTNNANNMVNATMEGLKQLKTPEEVARLRGKTVEELLG 166


>gi|258513657|ref|YP_003189879.1| 30S ribosomal protein S5 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777362|gb|ACV61256.1| ribosomal protein S5 [Desulfotomaculum acetoxidans DSM 771]
          Length = 166

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + ++IV INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 5   DPNKLELSEKIVYINRVAKVVKGGRRFSFSALVVVGDGNGHVGAGLGKAGEVPEAIRKGI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+++I + L  G T+ H+ +GR GAG+V+++ A AGTGVIAGG +RA+ E+ G+ D+
Sbjct: 65  EDAKKHLIRIPLS-GTTIPHEVIGRFGAGRVLLKPASAGTGVIAGGPVRAILELGGVRDI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + KS+GS+N +N++ AT   + S   P +VA  RG     L +
Sbjct: 124 LTKSLGSNNANNMVHATMAAIESLKTPEEVARSRGKTLEELLS 166


>gi|320529813|ref|ZP_08030890.1| ribosomal protein S5 [Selenomonas artemidis F0399]
 gi|320137831|gb|EFW29736.1| ribosomal protein S5 [Selenomonas artemidis F0399]
          Length = 168

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/166 (46%), Positives = 107/166 (64%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           ++ E       +R+V INRVS  + GGRR +FS LVVVG+ K KVG     A EVPEA+R
Sbjct: 3   RHNENETPEFEERVVFINRVSKVVKGGRRSSFSALVVVGNKKGKVGVGLGKAAEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+++I V L + RT+ H+  G  GAG+V+++ A  GTGVIAGG  RAV E+ G+
Sbjct: 63  KGVEDAKKSLIEVPLREERTITHEITGIFGAGRVLLKPATKGTGVIAGGPARAVLELAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GSSNP+N++RAT E L     P +VA  RG   + +  
Sbjct: 123 RDILTKSLGSSNPNNMVRATMEGLLGLKSPAEVAALRGKSVAEIFG 168


>gi|292669841|ref|ZP_06603267.1| 30S ribosomal protein S5 [Selenomonas noxia ATCC 43541]
 gi|292648638|gb|EFF66610.1| 30S ribosomal protein S5 [Selenomonas noxia ATCC 43541]
          Length = 168

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 80/166 (48%), Positives = 108/166 (65%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           ++ E       +R+V INRVS  + GGRR +FS LVVVG+ K KVGF    A EVPEA+R
Sbjct: 3   RHNENETPEFEERVVFINRVSKVVKGGRRSSFSALVVVGNKKGKVGFGMGKAAEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+++I V L + RT+ H+  G  GAG+V+++ A  GTGVIAGG  RAV E+ G+
Sbjct: 63  KGVEDAKKSLIEVPLREERTIPHEITGIFGAGRVLLKPAAKGTGVIAGGPARAVLELAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GSSNP+N++RAT E L    +P DVA  RG     +  
Sbjct: 123 RDILTKSLGSSNPNNMVRATMEGLIGLKNPADVAALRGKTVREIFG 168


>gi|260893355|ref|YP_003239452.1| ribosomal protein S5 [Ammonifex degensii KC4]
 gi|260865496|gb|ACX52602.1| ribosomal protein S5 [Ammonifex degensii KC4]
          Length = 173

 Score =  179 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 78/163 (47%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            Q  +     + +R+V+I R +  + GGRRF FSVLV+VGD +  VG     A EVPEA+
Sbjct: 3   QQEIDASKLELTERVVSIRRCAKVVKGGRRFTFSVLVIVGDGQGHVGAGLGKAAEVPEAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  E AK+N+I V ++ G T+ H+ +G +GAGKV+++ A  GTGVIAGGA+RA+ E+ G
Sbjct: 63  RKGIEDAKKNLIKVPIV-GTTIPHEVIGHYGAGKVLLKPAAPGTGVIAGGAVRAILELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           + D++ KS+GS+NPHNV RATF+ L     P  VA  RG+K  
Sbjct: 122 IKDILTKSLGSNNPHNVTRATFDALMKLKDPAQVARLRGVKID 164


>gi|309777149|ref|ZP_07672112.1| ribosomal protein S5 [Erysipelotrichaceae bacterium 3_1_53]
 gi|313897294|ref|ZP_07830838.1| ribosomal protein S5 [Clostridium sp. HGF2]
 gi|308915019|gb|EFP60796.1| ribosomal protein S5 [Erysipelotrichaceae bacterium 3_1_53]
 gi|312958015|gb|EFR39639.1| ribosomal protein S5 [Clostridium sp. HGF2]
          Length = 170

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 75/171 (43%), Positives = 111/171 (64%), Gaps = 2/171 (1%)

Query: 8   QRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREV 67
           +R   +NR+       +R+V INRV+  + GGRRF F+ LVV+GD K +VGF    A EV
Sbjct: 2   ERRPRRNRDAEK-EFEERVVTINRVTKVVKGGRRFRFAALVVIGDKKGRVGFGTGKANEV 60

Query: 68  PEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVC 127
           P+A++KA E AK+N+ +V ++ G T+ H   GR+GAG+V +R A  GTGVIAGG +RAV 
Sbjct: 61  PDAIKKAIEDAKKNVFTVPVV-GTTIPHAITGRYGAGEVFLRPASEGTGVIAGGPVRAVL 119

Query: 128 EVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           E+ G++D+++K +GS  P N++RAT   L+      +VA  RG K   ++ 
Sbjct: 120 ELAGINDILSKCLGSRTPINMVRATISALKDLKTIEEVARLRGKKPEEIRG 170


>gi|254504171|ref|ZP_05116322.1| ribosomal protein S5 [Labrenzia alexandrii DFL-11]
 gi|222440242|gb|EEE46921.1| ribosomal protein S5 [Labrenzia alexandrii DFL-11]
          Length = 188

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 105/163 (64%), Positives = 129/163 (79%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
           D+  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAA
Sbjct: 13  DSEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAA 72

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           KR MI V L +GRTLHHD  GRHGAGKV++R+A AGTG+IAGG +RAV E LG+ DVVAK
Sbjct: 73  KRTMIRVPLREGRTLHHDVEGRHGAGKVLLRAAPAGTGIIAGGPMRAVFETLGVQDVVAK 132

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           S+G+SNP+N++RATF  L  +  PR VA RRG+K S+LQ+RR 
Sbjct: 133 SLGTSNPYNMVRATFNALTKEDSPRSVAARRGLKVSVLQSRRR 175


>gi|227499178|ref|ZP_03929313.1| 30S ribosomal protein S5 [Acidaminococcus sp. D21]
 gi|226904625|gb|EEH90543.1| 30S ribosomal protein S5 [Acidaminococcus sp. D21]
          Length = 166

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++D+   +R+V INRV+  + GGRRF+FS LVVVGD   KVG     A EVPEA+RK
Sbjct: 3   NFEKQDDGFKERVVFINRVAKVVKGGRRFSFSALVVVGDENGKVGMGMGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I+V +  G T+ H+ +G  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  GVEDAKKNLITVPM-KGSTIPHEIIGIFGAGRVLLKPAAPGTGVIAGGPVRAVLELAGVK 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS G+SNP+NV+RAT E L+   +  DVA  RG     L  
Sbjct: 122 DILTKSQGTSNPNNVVRATLEGLKLLKNAADVAALRGKTVEELLG 166


>gi|317496173|ref|ZP_07954533.1| ribosomal protein S5 [Gemella moribillum M424]
 gi|316913748|gb|EFV35234.1| ribosomal protein S5 [Gemella moribillum M424]
          Length = 165

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +EE      +R+VAI RV+  + GGRRF FS LVVVGD   +VG     A+EVP+A++K
Sbjct: 2   RQEEIKKEFEERVVAIRRVAKVVKGGRRFRFSALVVVGDKNGRVGVGTGKAQEVPDAIKK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A EAAK N+I+V +++  T+ H+ +G+ GAG V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AVEAAKHNLITVPVVN-GTIPHEIIGQFGAGSVLIKPAAPGTGVIAGGPVRAVLELAGIS 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           ++++KS+GS+ P N++RAT E L        VA  RG     L  
Sbjct: 121 NILSKSLGSNTPVNMVRATLEGLTRLQTVEHVAALRGKSVEELLG 165


>gi|83854956|ref|ZP_00948486.1| 30S ribosomal protein S5 [Sulfitobacter sp. NAS-14.1]
 gi|83941478|ref|ZP_00953940.1| 30S ribosomal protein S5 [Sulfitobacter sp. EE-36]
 gi|83842799|gb|EAP81966.1| 30S ribosomal protein S5 [Sulfitobacter sp. NAS-14.1]
 gi|83847298|gb|EAP85173.1| 30S ribosomal protein S5 [Sulfitobacter sp. EE-36]
          Length = 193

 Score =  179 bits (453), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 103/192 (53%), Positives = 139/192 (72%), Gaps = 1/192 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA ++ ++  N +N+ +      DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MA-RDDNRGGNRRNQRDETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAG+V+MR+A  GTG+IAG
Sbjct: 60  KGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDMEGRHGAGRVVMRTAPEGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVV+KSIG+ NP+N+IRAT + L+ +S PR VA RRG K + +  +R
Sbjct: 120 GPMRAVFEMLGVKDVVSKSIGTQNPYNMIRATMDGLKKESSPRAVAQRRGKKVADILPKR 179

Query: 181 VVSSKSSSYSRD 192
             + +SS+   +
Sbjct: 180 EDNVESSAQVAE 191


>gi|326388214|ref|ZP_08209817.1| 30S ribosomal protein S5 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207380|gb|EGD58194.1| 30S ribosomal protein S5 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 238

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 99/168 (58%), Positives = 125/168 (74%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N EE    +++++V INRVS  + GG+RF F+ LVVVGD K +VGF H  AREVPEA+ 
Sbjct: 55  NNDEEGGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRVGFGHGKAREVPEAIT 114

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KAT +AK+ MI V L +GRTLHHDG GR GAGKV +RSA  GTG+IAGG +RAV E LG+
Sbjct: 115 KATASAKKKMIRVPLKEGRTLHHDGKGRFGAGKVNVRSAPQGTGIIAGGPMRAVFESLGV 174

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           HDVV KS+G+SNP+N+IRATF+ L+ Q+ P+ VA RRG K + L  R 
Sbjct: 175 HDVVTKSVGTSNPYNMIRATFDALQEQTSPKSVAQRRGKKVADLLGRG 222


>gi|313895084|ref|ZP_07828641.1| ribosomal protein S5 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312975979|gb|EFR41437.1| ribosomal protein S5 [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 168

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 78/166 (46%), Positives = 107/166 (64%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           ++ E       +R+V INRVS  + GGRR +FS LVVVG+ K KVG     A EVPEA+R
Sbjct: 3   RHNENETPEFEERVVFINRVSKVVKGGRRSSFSALVVVGNKKGKVGVGLGKAAEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+++I V L + RT+ H+  G  GAG+V+++ A  GTGVIAGG  RAV E+ G+
Sbjct: 63  KGVEDAKKSLIEVPLREERTITHEITGIFGAGRVLLKPAAKGTGVIAGGPARAVLELAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GSSNP+N++RAT E L     P +VA  RG   + +  
Sbjct: 123 RDILTKSLGSSNPNNMVRATMEGLLGLKSPAEVAALRGKSVAEIFG 168


>gi|224028929|gb|ACN33540.1| unknown [Zea mays]
          Length = 320

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 94/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +    +  ++   +R+V +NRV+  + GGR+ ++  +VVVGD K  VG     A+EV EA
Sbjct: 153 DMDREQRPNDDFTERVVQVNRVTKVVKGGRQLSYRAIVVVGDMKGHVGVGVGKAKEVTEA 212

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           + KA    +RN+++V L    T  H     +GA KV++R A  G+GVIAGGA+R V E+ 
Sbjct: 213 ITKAAMNGRRNLVTVPLTKYSTFPHRADADYGAAKVMLRPACPGSGVIAGGAVRVVLEMA 272

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K + S NP N  RAT +  +     +DVA  RGI    L
Sbjct: 273 GVENALGKQLRSKNPLNNARATIKATQMMKQFKDVAEERGIPMEEL 318


>gi|15606749|ref|NP_214129.1| ribosomal protein S05 [Aquifex aeolicus VF5]
 gi|7388190|sp|O67563|RS5_AQUAE RecName: Full=30S ribosomal protein S5
 gi|2983990|gb|AAC07536.1| ribosomal protein S05 [Aquifex aeolicus VF5]
          Length = 208

 Score =  178 bits (452), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 77/180 (42%), Positives = 105/180 (58%), Gaps = 3/180 (1%)

Query: 7   SQRDNWQNREERDNSI--VDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTA 64
            +R   QN EE    +   +R++  NR +    GGRRF+FS LVVVGD K  VGF H  A
Sbjct: 11  EERRKQQNIEEILPELQLEERLIYANRTARVTKGGRRFSFSTLVVVGDRKGHVGFGHGKA 70

Query: 65  REVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIR 124
           +EV  A+ K  E AK+N+I V ++D  T+ HD +G  GA K+I+  A  GTGV+AGGA +
Sbjct: 71  KEVTLAIAKGIEKAKKNVIRVPIVD-GTVPHDVIGTFGATKIIVLPARRGTGVVAGGAAK 129

Query: 125 AVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSS 184
            V E+ G  DV+ K IGS+NP NV+RA F+ L     P  +A  RG+    +  R    +
Sbjct: 130 PVFELAGYTDVLTKIIGSTNPDNVVRAVFDALLQLKTPEQIAEERGLPVEEILRRYRRYA 189


>gi|254451294|ref|ZP_05064731.1| ribosomal protein S5 [Octadecabacter antarcticus 238]
 gi|198265700|gb|EDY89970.1| ribosomal protein S5 [Octadecabacter antarcticus 238]
          Length = 192

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 104/175 (59%), Positives = 128/175 (73%)

Query: 6   RSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAR 65
           R       NR + +    DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+
Sbjct: 3   REPNQRGGNRRDENPEFQDRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAK 62

Query: 66  EVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRA 125
           EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MRSA  G+G+IAGG +RA
Sbjct: 63  EVPEAIRKATEQAKRQMIRVQLREGRTLHHDMEGRHGAGKVVMRSAPQGSGIIAGGPMRA 122

Query: 126 VCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           V E+LG+ DVVAKSIGSSNP+N+IRAT + L+ +S PR VA RRG K + +  +R
Sbjct: 123 VFEMLGIQDVVAKSIGSSNPYNMIRATMDGLKKESSPRSVAQRRGKKVADILPKR 177


>gi|126654310|ref|ZP_01726080.1| 30S ribosomal protein S5 [Bacillus sp. B14905]
 gi|169830013|ref|YP_001700171.1| 30S ribosomal protein S5 [Lysinibacillus sphaericus C3-41]
 gi|226703356|sp|B1HMW3|RS5_LYSSC RecName: Full=30S ribosomal protein S5
 gi|126589239|gb|EAZ83402.1| 30S ribosomal protein S5 [Bacillus sp. B14905]
 gi|168994501|gb|ACA42041.1| 30S ribosomal protein S5 [Lysinibacillus sphaericus C3-41]
          Length = 167

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 72/158 (45%), Positives = 103/158 (65%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+V INRV+  + GGRRF F+ LVVVGD    VGF    A+EVP+A+RKA E AK+
Sbjct: 11  ELEERVVTINRVAKVVKGGRRFRFTALVVVGDRNGHVGFGTGKAQEVPDAIRKAVEDAKK 70

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N++ V  + G T  H  +GR GAG+++++ A  GTGVIAGG +RAV E+ G+ D+++KS+
Sbjct: 71  NLVEVPRV-GGTTPHLVLGRFGAGEILIKPAAPGTGVIAGGPVRAVLELAGITDILSKSL 129

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+ P N++RAT + L       DVA  RG     +  
Sbjct: 130 GSNTPINMVRATVQGLTELKRVEDVAKLRGKSVEEILG 167


>gi|115453747|ref|NP_001050474.1| Os03g0452300 [Oryza sativa Japonica Group]
 gi|28209467|gb|AAO37485.1| putative ribosomal protein [Oryza sativa Japonica Group]
 gi|108709198|gb|ABF96993.1| ribosomal protein S5 containing protein, expressed [Oryza sativa
           Japonica Group]
 gi|113548945|dbj|BAF12388.1| Os03g0452300 [Oryza sativa Japonica Group]
 gi|215686362|dbj|BAG87623.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215686840|dbj|BAG89690.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215767336|dbj|BAG99564.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222625206|gb|EEE59338.1| hypothetical protein OsJ_11420 [Oryza sativa Japonica Group]
          Length = 326

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 61/166 (36%), Positives = 93/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +    +   +   +R+V +NRV+  + GGR+ +F  +VVVGD K  VG     A+EV EA
Sbjct: 159 DMDREQRPSDEFSERVVQVNRVTKVVKGGRQLSFRAIVVVGDMKGHVGVGVGKAKEVTEA 218

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           + KA    +RN+++V L    T  H     +GA +V++R A  G+GVIAGGA+R V E+ 
Sbjct: 219 ITKAAMNGRRNLVTVPLTKYSTFPHRADADYGAARVMLRPACPGSGVIAGGAVRVVLEMA 278

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K + S NP N  RAT +  +     +DVA  RG+    L
Sbjct: 279 GVENALGKQLRSKNPLNNARATIKATQMMRQFKDVAAERGLPMEQL 324


>gi|313891528|ref|ZP_07825138.1| ribosomal protein S5 [Dialister microaerophilus UPII 345-E]
 gi|329121845|ref|ZP_08250460.1| 30S ribosomal protein S5 [Dialister micraerophilus DSM 19965]
 gi|313119987|gb|EFR43169.1| ribosomal protein S5 [Dialister microaerophilus UPII 345-E]
 gi|327467783|gb|EGF13275.1| 30S ribosomal protein S5 [Dialister micraerophilus DSM 19965]
          Length = 166

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 108/164 (65%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E++++ + + +V INRV+  + GGRRF+F+ +VVVGD K +VG     A EVPEA+RK
Sbjct: 3   RFEKQESDLKENVVFINRVAKVVKGGRRFSFAAVVVVGDGKGRVGLGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I+V+L +  T+ H+ +G +GAG+V M+ A  G GVIAGG IRAV  + G+ 
Sbjct: 63  GVEDAKKNLITVTLKN-GTIPHEMIGEYGAGRVFMKPAAEGCGVIAGGPIRAVLTLAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D++ KS+GSSNP N++RAT + L      R VA  RG     + 
Sbjct: 122 DILTKSLGSSNPINMVRATLDGLSKLEDARKVAALRGKSVEEIY 165


>gi|302344339|ref|YP_003808868.1| ribosomal protein S5 [Desulfarculus baarsii DSM 2075]
 gi|301640952|gb|ADK86274.1| ribosomal protein S5 [Desulfarculus baarsii DSM 2075]
          Length = 175

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 84/173 (48%), Positives = 114/173 (65%), Gaps = 1/173 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
             R   +   E ++ ++D++V INRV+  + GGRRF+FS +VVVGD +  VGF    A E
Sbjct: 3   DSRRKKKEVFEEESQLIDKVVHINRVAKVVKGGRRFSFSAVVVVGDGQGSVGFGLGKANE 62

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VPEA+RK  E AKR+M SV+L  G T+ H  VGR GAG+V++R A  GTGVIAGGA+RAV
Sbjct: 63  VPEAIRKGVEKAKRDMTSVALS-GGTIPHPIVGRFGAGQVMLRPARPGTGVIAGGAVRAV 121

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
            E  G+ D++ K++G++NPHNVI+AT E LR      +VA  RG     L+  
Sbjct: 122 LEAAGVTDILTKTLGTNNPHNVIKATLEGLRGLKSADEVARLRGKNVVELEPE 174


>gi|323703531|ref|ZP_08115177.1| ribosomal protein S5 [Desulfotomaculum nigrificans DSM 574]
 gi|323531522|gb|EGB21415.1| ribosomal protein S5 [Desulfotomaculum nigrificans DSM 574]
          Length = 166

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 106/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   RIDASKLELSEKVVFINRVAKVVKGGRRFSFSALVVVGDGNGHVGAGLGKASEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V L +G T+ H+ VGR GAGKV+M+ A  GTGVIAGG +RA+ E+ G+ 
Sbjct: 63  GIEDAKKNLIKVPL-NGTTITHEVVGRFGAGKVLMKPAAKGTGVIAGGPVRAILELAGVK 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+N +N++ AT E L+    P +VA  RG     L  
Sbjct: 122 DILTKSLGSNNANNMVNATMEGLKMLKTPEEVAKLRGKTVEELLG 166


>gi|238916282|ref|YP_002929799.1| small subunit ribosomal protein S5 [Eubacterium eligens ATCC 27750]
 gi|238871642|gb|ACR71352.1| small subunit ribosomal protein S5 [Eubacterium eligens ATCC 27750]
          Length = 179

 Score =  178 bits (451), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 61/177 (34%), Positives = 100/177 (56%)

Query: 2   AQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAH 61
           ++++          +     + D +V+I RV+  + GGR   F+ LVVVGD    VG   
Sbjct: 3   SKRKGDYSMKRTIIDASQLELNDNVVSIKRVTKVVKGGRNMRFAALVVVGDGNGHVGAGV 62

Query: 62  STAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGG 121
             A E+PEA+RK  E A ++++ V + +  ++ HD +G+ G   V+++ A  GTG+IAGG
Sbjct: 63  GKAAEIPEAIRKGKEDAIKHLVEVPIDENGSVPHDFLGKFGGATVLLKRAPEGTGIIAGG 122

Query: 122 AIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
             R++ E+ G+ ++  KS+GS+N  NV+ AT E L+S   P +VA  RG   S +  
Sbjct: 123 PARSILELAGIKNIRTKSLGSNNKQNVVLATIEGLKSMKTPEEVARLRGKSVSEILG 179


>gi|168334335|ref|ZP_02692522.1| ribosomal protein S5-like protein [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 170

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 95/168 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             Q  + +   + +++V I RV+  + GGR F FS LVVVGD    VG     A E+P+A
Sbjct: 3   RRQLFDYKSMELEEKVVTIKRVTKVVKGGRTFRFSALVVVGDRNGHVGVGLGKAMEIPDA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++K  E AK+N+I +   D  +++H  VG  G   V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 63  IKKGIEDAKKNLIFIERNDVDSIYHPLVGDFGGASVLLKPAFEGTGVIAGGPARAVLELA 122

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E L +   P  VA  RG     +  
Sbjct: 123 GIRNIRTKSLGSNNKKNVVHATIEGLAALKTPNQVAKLRGKTVEEILG 170


>gi|221133733|ref|ZP_03560038.1| 30S ribosomal protein S5 [Glaciecola sp. HTCC2999]
          Length = 168

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +   ++   +++++VA+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A+
Sbjct: 3   NKQENQQQGDLLEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA E A+RN+++V L +G TL H   GRH   KV M+ A  GTG+IAGGA+RAV EV G
Sbjct: 63  QKAMEKARRNLVTVDL-NGNTLQHPIKGRHSGSKVYMQPASEGTGIIAGGAMRAVLEVAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + +V++K  GS+NP NVIRAT   L   + P  VA +RG+    +  
Sbjct: 122 VQNVLSKCYGSTNPMNVIRATINALVDMNSPESVAAKRGLPVDEILG 168


>gi|317123080|ref|YP_004103083.1| 30S ribosomal protein S5P [Thermaerobacter marianensis DSM 12885]
 gi|315593060|gb|ADU52356.1| SSU ribosomal protein S5P [Thermaerobacter marianensis DSM 12885]
          Length = 169

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 80/168 (47%), Positives = 109/168 (64%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             + R++  + + +R+VAINRV+  + GGRRF FS LVVVGD   +VG     A E+P+A
Sbjct: 3   RHRRRQQEGDELQERLVAINRVAKVVKGGRRFNFSALVVVGDGNGRVGVGMGKAAEIPDA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA + AK+ MI V  + G T+ H  +G  GAG+V+M+ A  GTGVIAGGA+RAV E+ 
Sbjct: 63  IRKAVQKAKKGMIEVPRV-GTTIPHPVIGEFGAGRVLMKPAAPGTGVIAGGAVRAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ DV+ KS+GSSNP NV+ AT E L+S     +VA  RG     L  
Sbjct: 122 GIRDVLTKSLGSSNPANVVYATMEGLKSLRSAEEVARLRGKPVEQLIG 169


>gi|184200278|ref|YP_001854485.1| 30S ribosomal protein S5 [Kocuria rhizophila DC2201]
 gi|183580508|dbj|BAG28979.1| 30S ribosomal protein S5 [Kocuria rhizophila DC2201]
          Length = 230

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 75/168 (44%), Positives = 104/168 (61%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +E  +  ++R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  
Sbjct: 56  DEEKDKFLERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAAISKGV 115

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N   V  ++ RT+ H   G   AG V++R A  GTGVIAGG +RAV E  G+HDV
Sbjct: 116 EEAKKNFFRVPRVEDRTIPHRVQGEAAAGVVMLRPATPGTGVIAGGPVRAVLECAGIHDV 175

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
           ++KS+GSSN  N++ AT + LR    P  VA RRG+    +    ++ 
Sbjct: 176 LSKSLGSSNQINIVHATIQALRELEEPASVAARRGLPMDEVVPAPLLR 223


>gi|160881768|ref|YP_001560736.1| ribosomal protein S5 [Clostridium phytofermentans ISDg]
 gi|160430434|gb|ABX43997.1| ribosomal protein S5 [Clostridium phytofermentans ISDg]
          Length = 168

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 66/166 (39%), Positives = 96/166 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++V I RV+  + GGR F F+ LVVVGD    +G     A E+PEA
Sbjct: 2   KRTIVDATQLELEDKVVNIKRVTKVVKGGRNFRFTALVVVGDKNGHIGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + MIS+ + +  ++ HD +G+ G+  V+++ + AGTGVIAGG  R V E+ 
Sbjct: 62  IRKGKEDAIKKMISLPIDENGSVPHDFIGKFGSATVLLKRSPAGTGVIAGGPARNVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G  ++  KS+GS+N  NV+ AT E LR    P +VA  RGI    L
Sbjct: 122 GFKNIRTKSLGSNNKQNVVLATIEGLRQLKTPEEVAALRGISVDQL 167


>gi|210623205|ref|ZP_03293644.1| hypothetical protein CLOHIR_01594 [Clostridium hiranonis DSM 13275]
 gi|210153742|gb|EEA84748.1| hypothetical protein CLOHIR_01594 [Clostridium hiranonis DSM 13275]
          Length = 168

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 73/167 (43%), Positives = 102/167 (61%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  +     + +R+V + RV+  + GGR F F+ LVVVGD    VG     A EVP+A+
Sbjct: 3   RKPIDASALDLQERVVEVRRVTKVVKGGRNFRFAALVVVGDENGHVGIGSGKAMEVPDAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA E AK+N+I+V ++ G T+ H+  G  GAGK+++  A  GTGVIAGG  RAV E+ G
Sbjct: 63  KKAVEDAKKNLITVPMV-GTTIPHEVNGHFGAGKILIMPAAEGTGVIAGGPARAVLELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + DV AKS+GS+NP N++ AT E L S     D+A  RG K   L  
Sbjct: 122 LKDVRAKSLGSNNPRNMVNATIEGLNSLKTAEDIARLRGKKVEELLG 168


>gi|309389916|gb|ADO77796.1| SSU ribosomal protein S5P [Halanaerobium praevalens DSM 2228]
          Length = 166

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                  ++ +R+V INRVS  + GGRRF+FS LVVVGD +  VG     A EVPEA+RK
Sbjct: 3   KINADKLNLDERVVNINRVSKVVKGGRRFSFSALVVVGDGEGHVGAGIGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             +AAK+ +I V ++D  T+ H+  G  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  GIDAAKKEIIEVPIVD-TTIPHEKTGVFGAGRVLLKPAAPGTGVIAGGPVRAVIELAGIS 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+G+SNP N+I AT   L+      +VA  RG     L  
Sbjct: 122 DILTKSLGTSNPINMINATITGLKELKSAEEVAKLRGKSVEELIG 166


>gi|296116715|ref|ZP_06835325.1| 30S ribosomal protein S5 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976927|gb|EFG83695.1| 30S ribosomal protein S5 [Gluconacetobacter hansenii ATCC 23769]
          Length = 192

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 103/190 (54%), Positives = 138/190 (72%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R      ++R+   + +VD++V INRV+  + GGRRFAF+ LVVVGD K +VGF 
Sbjct: 1   MAREPREGGRGGRDRDREGDDLVDKLVTINRVAKVVKGGRRFAFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVPEA+RKAT+ AKR MI V + +GRTLHHD  G  GAGKV++RSA AGTG+IAG
Sbjct: 61  AGKAREVPEAIRKATDRAKRAMIRVPMKEGRTLHHDVAGHFGAGKVVLRSADAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG++DVVAKS+G+ NPHN+++ATF  L   + PR VANRRG K S +  RR
Sbjct: 121 GPMRAVFESLGINDVVAKSLGTRNPHNMVKATFAALERCASPRSVANRRGKKVSDILGRR 180

Query: 181 VVSSKSSSYS 190
            V++ + + +
Sbjct: 181 EVTASAEAGA 190


>gi|315640144|ref|ZP_07895266.1| 30S ribosomal protein S5 [Enterococcus italicus DSM 15952]
 gi|315484121|gb|EFU74595.1| 30S ribosomal protein S5 [Enterococcus italicus DSM 15952]
          Length = 166

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 70/163 (42%), Positives = 106/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           + +   + DR+V INRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPKHLELEDRVVGINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIRKAV 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N++ V ++ G T+ H+ +G  G G+++M+ A+ G+GV AGG +RAV E+ G+ D+
Sbjct: 65  EDAKKNLVEVPMV-GSTIPHEVIGVFGGGRILMKPAVEGSGVAAGGPVRAVLELAGVADI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GS+ P NV+RAT + L+      +VA+ RG     +  
Sbjct: 124 TSKSLGSNTPINVVRATVDGLKQLKRAEEVASLRGKSVEEIIG 166


>gi|239997207|ref|ZP_04717731.1| 30S ribosomal protein S5 [Alteromonas macleodii ATCC 27126]
 gi|332142189|ref|YP_004427927.1| 30S ribosomal protein S5 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|226703325|sp|B4RT45|RS5_ALTMD RecName: Full=30S ribosomal protein S5
 gi|327552211|gb|AEA98929.1| 30S ribosomal protein S5 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 166

 Score =  177 bits (450), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            ++ ++   +++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   KQDVQNGEFLEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM+ V L +G TL H   GRH   KV M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMVDVDL-NGHTLQHPIKGRHSGSKVYMQPASEGTGIIAGGAMRAVLEVAGVQ 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K  GS+NP NV+RAT   L   + P  VA +RG+    +  
Sbjct: 122 NVLSKCYGSTNPINVVRATINALTEMNSPAKVAAKRGLSVEEILG 166


>gi|182418831|ref|ZP_02950096.1| ribosomal protein S5 [Clostridium butyricum 5521]
 gi|237666613|ref|ZP_04526598.1| ribosomal protein S5 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377328|gb|EDT74889.1| ribosomal protein S5 [Clostridium butyricum 5521]
 gi|237657812|gb|EEP55367.1| ribosomal protein S5 [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 165

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 69/165 (41%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGR F FS LVVVGD    VG     + E+PEA++K
Sbjct: 2   RIDPSTLDLKEKVVFINRVTKVVKGGRNFRFSALVVVGDENGHVGVGMGKSIEIPEAIKK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++SVS++ G T+ H+  G+ G   V++  A  GTGVIAGG  RAV E+ G+ 
Sbjct: 62  GIEDAKKNLVSVSMV-GTTVPHEIHGKFGTADVLIMPAKEGTGVIAGGPARAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N+++AT   L S     D+A  RG     +  
Sbjct: 121 DVRAKSLGSNNPSNMVKATINGLASLRTAEDIAKLRGKSVEEILG 165


>gi|13470568|ref|NP_102137.1| 30S ribosomal protein S5 [Mesorhizobium loti MAFF303099]
 gi|14021310|dbj|BAB47923.1| mlr0315 [Mesorhizobium loti MAFF303099]
          Length = 197

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 115/188 (61%), Positives = 145/188 (77%), Gaps = 1/188 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ+   +    + REERD+ +VD++V INRV+  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 11  MAQER-REGGRGREREERDDGMVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFG 69

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR+MI V L  GRTLHHD  GR GAG+V++R+A  GTG+IAG
Sbjct: 70  HGKAREVPEAIRKATESAKRDMIFVPLRSGRTLHHDVEGRWGAGRVLLRAAKQGTGIIAG 129

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LGMHDVVAKS+GSSNP+N++RATF+ L+SQ HP+DVA  RGIK+S LQARR
Sbjct: 130 GPMRAVFETLGMHDVVAKSMGSSNPYNMVRATFDALKSQMHPKDVAAARGIKYSTLQARR 189

Query: 181 VVSSKSSS 188
             +  +  
Sbjct: 190 GTAVAAEE 197


>gi|84685404|ref|ZP_01013302.1| 30S ribosomal protein S5 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666561|gb|EAQ13033.1| 30S ribosomal protein S5 [Rhodobacterales bacterium HTCC2654]
          Length = 193

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 102/175 (58%), Positives = 128/175 (73%), Gaps = 1/175 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE+AK
Sbjct: 19  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATESAK 78

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RNMI V L +GRTLHHD  GRHGAG+V+MR+A  GTG+IAGG +RAV E+LG+ DVVAKS
Sbjct: 79  RNMIRVPLREGRTLHHDIDGRHGAGRVVMRTAPTGTGIIAGGPMRAVFEMLGVQDVVAKS 138

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA-RRVVSSKSSSYSRDS 193
           IGS NP+N+IRAT   L  Q+ PR VA RRG K + +   R    ++SS  + ++
Sbjct: 139 IGSQNPYNMIRATLNGLTKQASPRSVAQRRGKKVADILPGRDEAPAESSQVAEEA 193


>gi|198282654|ref|YP_002218975.1| 30S ribosomal protein S5 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218665369|ref|YP_002424847.1| ribosomal protein S5 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226703322|sp|B7J484|RS5_ACIF2 RecName: Full=30S ribosomal protein S5
 gi|226703323|sp|B5ELZ6|RS5_ACIF5 RecName: Full=30S ribosomal protein S5
 gi|198247175|gb|ACH82768.1| ribosomal protein S5 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517582|gb|ACK78168.1| ribosomal protein S5 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 176

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 78/180 (43%), Positives = 118/180 (65%), Gaps = 8/180 (4%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R  + N        + + ++++ INRVS  + GGR+F F+ L+VVGD   KVGF 
Sbjct: 1   MARENRDTQPN--------DGMQEKLIHINRVSKVVKGGRQFGFAALMVVGDGDGKVGFG 52

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVP  ++KAT+ A+R M S+ L+ G T+ +   GRHGA +V++R A  G+GVIAG
Sbjct: 53  RGKAKEVPAGIQKATDQARRWMTSIPLMRGGTIPYPVEGRHGAARVMLRPAPEGSGVIAG 112

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GA+RAVCE +G+ +VVAKS+GS+NP NV+RATF+       P+ +A +RG     ++ + 
Sbjct: 113 GAMRAVCEAVGLRNVVAKSLGSNNPINVVRATFDAFDKLISPQAIAMKRGKSLKEIRGQG 172


>gi|225175657|ref|ZP_03729651.1| ribosomal protein S5 [Dethiobacter alkaliphilus AHT 1]
 gi|225168986|gb|EEG77786.1| ribosomal protein S5 [Dethiobacter alkaliphilus AHT 1]
          Length = 166

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 102/163 (62%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + +++V INRV+  + GGRRF+FS LV VGD    VG     A EVPEA+RKA 
Sbjct: 5   DPNKVELTEKVVKINRVAKVVKGGRRFSFSALVAVGDGNGHVGTGMGKAGEVPEAIRKAI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+NMI V L+ G T+ H   G +GAG+V+++ A  GTGVIAGG +RAV E+ G+ D+
Sbjct: 65  EDAKKNMIEVPLV-GTTIPHTVTGVYGAGRVLLKPASEGTGVIAGGPVRAVLELAGVRDI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + KS+GS+N  NV+ AT E L S     +VA  RG     L  
Sbjct: 124 LTKSLGSANAINVVNATMEGLTSLKRAEEVAKLRGKTVEELLG 166


>gi|167629484|ref|YP_001679983.1| 30S ribosomal protein s5 [Heliobacterium modesticaldum Ice1]
 gi|226703351|sp|B0TC73|RS5_HELMI RecName: Full=30S ribosomal protein S5
 gi|167592224|gb|ABZ83972.1| 30S ribosomal protein s5 [Heliobacterium modesticaldum Ice1]
          Length = 166

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGRRF+FS LVVVGD K  VGF    A EVPEA+RK
Sbjct: 3   RIDASGLELQEKVVYINRVAKVVKGGRRFSFSALVVVGDGKGHVGFGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V ++ G T+ H  +G  GAG+V+++ A  GTGVIAGG +RAV E+ G+H
Sbjct: 63  GVEDAKKNLIVVPVV-GTTIPHPALGVFGAGRVLLKPASKGTGVIAGGPVRAVLELAGIH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+N +N++RAT E LRS     +VA  RG     +  
Sbjct: 122 DILTKSLGSNNANNMVRATMEGLRSLKRAEEVAKLRGKTVEEITG 166


>gi|84499828|ref|ZP_00998116.1| 30S ribosomal protein S5 [Oceanicola batsensis HTCC2597]
 gi|84392972|gb|EAQ05183.1| 30S ribosomal protein S5 [Oceanicola batsensis HTCC2597]
          Length = 190

 Score =  177 bits (450), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 101/177 (57%), Positives = 128/177 (72%), Gaps = 1/177 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
                 DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE 
Sbjct: 14  EAPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQ 73

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           AKR MI V L +GRTLHHD  GRHGAG+V+MR+A  GTG+IAGG +RAV E+LG+ DVVA
Sbjct: 74  AKRKMIRVPLREGRTLHHDMEGRHGAGRVVMRTAPTGTGIIAGGPMRAVFEMLGIQDVVA 133

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR-VVSSKSSSYSRDS 193
           KS+GS NP+N+IRAT   L+ +S PR VA RRG K + +  +R    ++SS  S ++
Sbjct: 134 KSVGSQNPYNMIRATLNGLQKESSPRQVAQRRGKKVADILPKRDEAPAESSQVSEEA 190


>gi|224477203|ref|YP_002634809.1| 30S ribosomal protein S5 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254765206|sp|B9DM30|RS5_STACT RecName: Full=30S ribosomal protein S5
 gi|222421810|emb|CAL28624.1| 30S ribosomal protein S5 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 166

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            R+E      +R+V INRV+  + GGRRF F+ LVVVGD K +VGF    A+EVPEA++K
Sbjct: 3   RRDEEAKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKKGRVGFGTGKAQEVPEAIKK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A EAAK+++++V+ ++  T  H   GR G+G V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  AVEAAKKDLVTVNRVE-GTTPHTITGRFGSGSVLLKPAAPGTGVIAGGPVRAVLELAGIT 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D+++KS+GS+ P N++RAT   L +  +  +VA  RG     L 
Sbjct: 122 DILSKSLGSNTPINMVRATLNGLENLKNAEEVAKLRGKSVEELY 165


>gi|17987057|ref|NP_539691.1| 30S ribosomal protein S5 [Brucella melitensis bv. 1 str. 16M]
 gi|23502093|ref|NP_698220.1| 30S ribosomal protein S5 [Brucella suis 1330]
 gi|62290127|ref|YP_221920.1| 30S ribosomal protein S5 [Brucella abortus bv. 1 str. 9-941]
 gi|82700050|ref|YP_414624.1| 30S ribosomal protein S5 [Brucella melitensis biovar Abortus 2308]
 gi|161619172|ref|YP_001593059.1| 30S ribosomal protein S5 [Brucella canis ATCC 23365]
 gi|163843482|ref|YP_001627886.1| 30S ribosomal protein S5 [Brucella suis ATCC 23445]
 gi|189024365|ref|YP_001935133.1| 30S ribosomal protein S5 [Brucella abortus S19]
 gi|225627687|ref|ZP_03785724.1| ribosomal protein S5 [Brucella ceti str. Cudo]
 gi|225852713|ref|YP_002732946.1| 30S ribosomal protein S5 [Brucella melitensis ATCC 23457]
 gi|237815635|ref|ZP_04594632.1| ribosomal protein S5 [Brucella abortus str. 2308 A]
 gi|254689436|ref|ZP_05152690.1| 30S ribosomal protein S5 [Brucella abortus bv. 6 str. 870]
 gi|254693921|ref|ZP_05155749.1| 30S ribosomal protein S5 [Brucella abortus bv. 3 str. Tulya]
 gi|254697571|ref|ZP_05159399.1| 30S ribosomal protein S5 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701957|ref|ZP_05163785.1| 30S ribosomal protein S5 [Brucella suis bv. 5 str. 513]
 gi|254704501|ref|ZP_05166329.1| 30S ribosomal protein S5 [Brucella suis bv. 3 str. 686]
 gi|254706603|ref|ZP_05168431.1| 30S ribosomal protein S5 [Brucella pinnipedialis M163/99/10]
 gi|254710287|ref|ZP_05172098.1| 30S ribosomal protein S5 [Brucella pinnipedialis B2/94]
 gi|254714284|ref|ZP_05176095.1| 30S ribosomal protein S5 [Brucella ceti M644/93/1]
 gi|254717721|ref|ZP_05179532.1| 30S ribosomal protein S5 [Brucella ceti M13/05/1]
 gi|254719274|ref|ZP_05181085.1| 30S ribosomal protein S5 [Brucella sp. 83/13]
 gi|254730465|ref|ZP_05189043.1| 30S ribosomal protein S5 [Brucella abortus bv. 4 str. 292]
 gi|256031781|ref|ZP_05445395.1| 30S ribosomal protein S5 [Brucella pinnipedialis M292/94/1]
 gi|256044866|ref|ZP_05447770.1| 30S ribosomal protein S5 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061296|ref|ZP_05451446.1| 30S ribosomal protein S5 [Brucella neotomae 5K33]
 gi|256113770|ref|ZP_05454574.1| 30S ribosomal protein S5 [Brucella melitensis bv. 3 str. Ether]
 gi|256257682|ref|ZP_05463218.1| 30S ribosomal protein S5 [Brucella abortus bv. 9 str. C68]
 gi|256263797|ref|ZP_05466329.1| ribosomal protein S5 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369640|ref|YP_003107150.1| 30S ribosomal protein S5 [Brucella microti CCM 4915]
 gi|260168915|ref|ZP_05755726.1| 30S ribosomal protein S5 [Brucella sp. F5/99]
 gi|260546675|ref|ZP_05822414.1| 30S ribosomal protein S5 [Brucella abortus NCTC 8038]
 gi|260565532|ref|ZP_05836016.1| 30S ribosomal protein S5 [Brucella melitensis bv. 1 str. 16M]
 gi|260566255|ref|ZP_05836725.1| ribosomal protein S5 [Brucella suis bv. 4 str. 40]
 gi|260754959|ref|ZP_05867307.1| ribosomal protein S5 [Brucella abortus bv. 6 str. 870]
 gi|260758175|ref|ZP_05870523.1| ribosomal protein S5 [Brucella abortus bv. 4 str. 292]
 gi|260762001|ref|ZP_05874344.1| ribosomal protein S5 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883968|ref|ZP_05895582.1| 30S ribosomal protein S5 [Brucella abortus bv. 9 str. C68]
 gi|261214213|ref|ZP_05928494.1| ribosomal protein S5 [Brucella abortus bv. 3 str. Tulya]
 gi|261219564|ref|ZP_05933845.1| ribosomal protein S5 [Brucella ceti M13/05/1]
 gi|261314062|ref|ZP_05953259.1| 30S ribosomal protein S5 [Brucella pinnipedialis M163/99/10]
 gi|261317850|ref|ZP_05957047.1| ribosomal protein S5 [Brucella pinnipedialis B2/94]
 gi|261322059|ref|ZP_05961256.1| ribosomal protein S5 [Brucella ceti M644/93/1]
 gi|261325303|ref|ZP_05964500.1| 30S ribosomal protein S5 [Brucella neotomae 5K33]
 gi|261752525|ref|ZP_05996234.1| ribosomal protein S5 [Brucella suis bv. 5 str. 513]
 gi|261755184|ref|ZP_05998893.1| ribosomal protein S5 [Brucella suis bv. 3 str. 686]
 gi|261758408|ref|ZP_06002117.1| ribosomal protein S5 [Brucella sp. F5/99]
 gi|265984274|ref|ZP_06097009.1| ribosomal protein S5 [Brucella sp. 83/13]
 gi|265988879|ref|ZP_06101436.1| ribosomal protein S5 [Brucella pinnipedialis M292/94/1]
 gi|265991293|ref|ZP_06103850.1| 30S ribosomal protein S5 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995130|ref|ZP_06107687.1| ribosomal protein S5 [Brucella melitensis bv. 3 str. Ether]
 gi|294852553|ref|ZP_06793226.1| 30S ribosomal protein S5 [Brucella sp. NVSL 07-0026]
 gi|297248522|ref|ZP_06932240.1| 30S ribosomal protein S5 [Brucella abortus bv. 5 str. B3196]
 gi|306838026|ref|ZP_07470884.1| ribosomal protein S5 [Brucella sp. NF 2653]
 gi|306840318|ref|ZP_07473090.1| ribosomal protein S5 [Brucella sp. BO2]
 gi|306844120|ref|ZP_07476714.1| ribosomal protein S5 [Brucella sp. BO1]
 gi|54039515|sp|P66571|RS5_BRUSU RecName: Full=30S ribosomal protein S5
 gi|54041966|sp|P66570|RS5_BRUME RecName: Full=30S ribosomal protein S5
 gi|73919040|sp|Q57CS5|RS5_BRUAB RecName: Full=30S ribosomal protein S5
 gi|91207853|sp|Q2YRT3|RS5_BRUA2 RecName: Full=30S ribosomal protein S5
 gi|189045405|sp|A9M5N3|RS5_BRUC2 RecName: Full=30S ribosomal protein S5
 gi|189045406|sp|B0CH15|RS5_BRUSI RecName: Full=30S ribosomal protein S5
 gi|226703330|sp|B2S662|RS5_BRUA1 RecName: Full=30S ribosomal protein S5
 gi|254764630|sp|C0RJI4|RS5_BRUMB RecName: Full=30S ribosomal protein S5
 gi|17982713|gb|AAL51955.1| ssu ribosomal protein s5p [Brucella melitensis bv. 1 str. 16M]
 gi|23348053|gb|AAN30135.1| ribosomal protein S5 [Brucella suis 1330]
 gi|62196259|gb|AAX74559.1| RpsE, ribosomal protein S5 [Brucella abortus bv. 1 str. 9-941]
 gi|82616151|emb|CAJ11194.1| Ribosomal protein S5:Ribosomal protein S5, C-terminal
           domain:Ribosomal protein S5, bacterial and organelle
           form [Brucella melitensis biovar Abortus 2308]
 gi|161335983|gb|ABX62288.1| ribosomal protein S5 [Brucella canis ATCC 23365]
 gi|163674205|gb|ABY38316.1| ribosomal protein S5 [Brucella suis ATCC 23445]
 gi|189019937|gb|ACD72659.1| 30S ribosomal protein S5 [Brucella abortus S19]
 gi|225617692|gb|EEH14737.1| ribosomal protein S5 [Brucella ceti str. Cudo]
 gi|225641078|gb|ACO00992.1| ribosomal protein S5 [Brucella melitensis ATCC 23457]
 gi|237788933|gb|EEP63144.1| ribosomal protein S5 [Brucella abortus str. 2308 A]
 gi|255999802|gb|ACU48201.1| 30S ribosomal protein S5 [Brucella microti CCM 4915]
 gi|260095725|gb|EEW79602.1| 30S ribosomal protein S5 [Brucella abortus NCTC 8038]
 gi|260151600|gb|EEW86694.1| 30S ribosomal protein S5 [Brucella melitensis bv. 1 str. 16M]
 gi|260155773|gb|EEW90853.1| ribosomal protein S5 [Brucella suis bv. 4 str. 40]
 gi|260668493|gb|EEX55433.1| ribosomal protein S5 [Brucella abortus bv. 4 str. 292]
 gi|260672433|gb|EEX59254.1| ribosomal protein S5 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675067|gb|EEX61888.1| ribosomal protein S5 [Brucella abortus bv. 6 str. 870]
 gi|260873496|gb|EEX80565.1| 30S ribosomal protein S5 [Brucella abortus bv. 9 str. C68]
 gi|260915820|gb|EEX82681.1| ribosomal protein S5 [Brucella abortus bv. 3 str. Tulya]
 gi|260924653|gb|EEX91221.1| ribosomal protein S5 [Brucella ceti M13/05/1]
 gi|261294749|gb|EEX98245.1| ribosomal protein S5 [Brucella ceti M644/93/1]
 gi|261297073|gb|EEY00570.1| ribosomal protein S5 [Brucella pinnipedialis B2/94]
 gi|261301283|gb|EEY04780.1| 30S ribosomal protein S5 [Brucella neotomae 5K33]
 gi|261303088|gb|EEY06585.1| 30S ribosomal protein S5 [Brucella pinnipedialis M163/99/10]
 gi|261738392|gb|EEY26388.1| ribosomal protein S5 [Brucella sp. F5/99]
 gi|261742278|gb|EEY30204.1| ribosomal protein S5 [Brucella suis bv. 5 str. 513]
 gi|261744937|gb|EEY32863.1| ribosomal protein S5 [Brucella suis bv. 3 str. 686]
 gi|262766243|gb|EEZ12032.1| ribosomal protein S5 [Brucella melitensis bv. 3 str. Ether]
 gi|263002077|gb|EEZ14652.1| 30S ribosomal protein S5 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093925|gb|EEZ17859.1| ribosomal protein S5 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661076|gb|EEZ31337.1| ribosomal protein S5 [Brucella pinnipedialis M292/94/1]
 gi|264662866|gb|EEZ33127.1| ribosomal protein S5 [Brucella sp. 83/13]
 gi|294821142|gb|EFG38141.1| 30S ribosomal protein S5 [Brucella sp. NVSL 07-0026]
 gi|297175691|gb|EFH35038.1| 30S ribosomal protein S5 [Brucella abortus bv. 5 str. B3196]
 gi|306275563|gb|EFM57295.1| ribosomal protein S5 [Brucella sp. BO1]
 gi|306289717|gb|EFM60906.1| ribosomal protein S5 [Brucella sp. BO2]
 gi|306406950|gb|EFM63171.1| ribosomal protein S5 [Brucella sp. NF 2653]
 gi|326409238|gb|ADZ66303.1| 30S ribosomal protein S5 [Brucella melitensis M28]
 gi|326538946|gb|ADZ87161.1| ribosomal protein S5 [Brucella melitensis M5-90]
          Length = 186

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 106/159 (66%), Positives = 130/159 (81%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAKR+
Sbjct: 20  FVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAKRD 79

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           MI V L  GRTLHHD  GRHGAGKV++R+A AG G+IAGG +RAV E LG+ DVVAKS+G
Sbjct: 80  MIFVPLRSGRTLHHDVEGRHGAGKVLLRAAPAGKGIIAGGPMRAVFETLGVQDVVAKSLG 139

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           SSNP+N++RATF+ L+ Q HP+D+A +RGIK+S LQARR
Sbjct: 140 SSNPYNMVRATFDALKHQMHPKDIAAQRGIKYSTLQARR 178


>gi|302669978|ref|YP_003829938.1| ribosomal protein S5 RpsE [Butyrivibrio proteoclasticus B316]
 gi|302394451|gb|ADL33356.1| ribosomal protein S5 RpsE [Butyrivibrio proteoclasticus B316]
          Length = 169

 Score =  177 bits (449), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 62/168 (36%), Positives = 99/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++V I RV+  + GGR   F+ LVVVGD    VG     + E+P+A
Sbjct: 2   KRNIVDASQLELTDKVVTIKRVTKVVKGGRNMKFTALVVVGDNNGHVGVGLGKSTEIPDA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+I+V L +  ++ HD VG+ G+ +V+++ +  GTG+IAGG  R+VCE+ 
Sbjct: 62  IRKGKEDATKNLITVPLDENNSITHDFVGKFGSAEVLLKKSPEGTGIIAGGPARSVCELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L     P +VA +RG   + + A
Sbjct: 122 GIRNIRTKSLGSNNKQNVVYATINGLAQLKTPEEVAAKRGKSVAEVTA 169


>gi|313903134|ref|ZP_07836528.1| SSU ribosomal protein S5P [Thermaerobacter subterraneus DSM 13965]
 gi|313466636|gb|EFR62156.1| SSU ribosomal protein S5P [Thermaerobacter subterraneus DSM 13965]
          Length = 169

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 81/168 (48%), Positives = 110/168 (65%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             + R++  + + +R+VAINRV+  + GGRRF FS LVVVGD   +VG     A E+P+A
Sbjct: 3   RHRRRQQDGDELQERLVAINRVAKVVKGGRRFNFSALVVVGDGNGRVGVGMGKAAEIPDA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA + AK++MI V  + G T+ H  VG  GAG+V+M+ A  GTGVIAGGA+RAV E+ 
Sbjct: 63  IRKAVQKAKKSMIEVPRV-GTTIPHPVVGEFGAGRVLMKPAAPGTGVIAGGAVRAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ DV+ KS+GSSNP NV+ AT E L+S     +VA  RG     L  
Sbjct: 122 GIRDVLTKSLGSSNPANVVYATMEGLKSLRSAEEVARLRGKPVEQLIG 169


>gi|256827397|ref|YP_003151356.1| 30S ribosomal protein S5P [Cryptobacterium curtum DSM 15641]
 gi|256583540|gb|ACU94674.1| SSU ribosomal protein S5P [Cryptobacterium curtum DSM 15641]
          Length = 173

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 82/181 (45%), Positives = 111/181 (61%), Gaps = 8/181 (4%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+K+  Q D           + +R+V INRVS  + GGRRF  + LVVVGD    VG  
Sbjct: 1   MARKQEHQSDV--------PELQERVVYINRVSKVVKGGRRFGLTALVVVGDGNGNVGIG 52

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              ++EVP A+RK  E AK+NM  V L    TL H+ +G +GAG+V+++ A  GTGVIAG
Sbjct: 53  MGKSQEVPVAIRKGIEDAKKNMFKVPLTAEGTLPHEIIGTYGAGRVLIKPATPGTGVIAG 112

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GA RAV E+ G+ DV AKS+G+ N  NV++AT E L++   P DVA RRG+  S +   +
Sbjct: 113 GAARAVMELAGVKDVFAKSLGTDNVMNVVKATAEGLKAMESPEDVAARRGLSVSKIYGWK 172

Query: 181 V 181
            
Sbjct: 173 E 173


>gi|328953141|ref|YP_004370475.1| ribosomal protein S5 [Desulfobacca acetoxidans DSM 11109]
 gi|328453465|gb|AEB09294.1| ribosomal protein S5 [Desulfobacca acetoxidans DSM 11109]
          Length = 166

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 113/165 (68%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E  +   +D++V I+RV+  + GGRRF+F+ LVVVGD + +VG     A EVPEA+RK
Sbjct: 3   ESEASEIQFLDKVVHISRVAKVVKGGRRFSFNALVVVGDGQGQVGAGLGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+++I V +L+  T+ +  VGR G+GKV+++ A  GTGVIAGG +RAV EV G+ 
Sbjct: 63  AMERAKKSLIKVPILNS-TIPYTVVGRFGSGKVLLKPASEGTGVIAGGPVRAVVEVAGIQ 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +++ K +GS+NPHN ++ATF+ L+  + P ++A +R      ++A
Sbjct: 122 NILTKCLGSNNPHNAVKATFDALKQLASPEEIAQKRNRALEEIRA 166


>gi|15896366|ref|NP_349715.1| 30S ribosomal protein S5 [Clostridium acetobutylicum ATCC 824]
 gi|26399454|sp|Q97EJ5|RS5_CLOAB RecName: Full=30S ribosomal protein S5
 gi|15026182|gb|AAK81055.1|AE007808_8 Ribosomal protein S5 [Clostridium acetobutylicum ATCC 824]
 gi|325510522|gb|ADZ22158.1| 30S ribosomal protein S5 [Clostridium acetobutylicum EA 2018]
          Length = 165

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGR F F+ LVVVGD    VG     + E+PEA+RK
Sbjct: 2   RIDPSTLDLKEKVVFINRVAKVVKGGRNFRFTALVVVGDENGHVGVGTGKSAEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ V+++ G T+ H+  G  G G+V++  A  GTGVIAGG +RAV E+ G++
Sbjct: 62  GIEDAKKNLVEVAIV-GTTVPHEIYGEFGTGRVLIMPASEGTGVIAGGPVRAVLELAGLN 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT   L        +A  RG     +  
Sbjct: 121 DVRAKSLGSNNPRNMVNATINGLSRLRTVEQIAALRGKTVEEILG 165


>gi|296534004|ref|ZP_06896520.1| 30S ribosomal protein S5 [Roseomonas cervicalis ATCC 49957]
 gi|296265670|gb|EFH11779.1| 30S ribosomal protein S5 [Roseomonas cervicalis ATCC 49957]
          Length = 202

 Score =  177 bits (449), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 94/176 (53%), Positives = 124/176 (70%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
             E  + + D++V INRV+  + GGRRF+F+ LVVVGD K +VG+    AREVPEA+RKA
Sbjct: 25  EREPGDELKDKLVTINRVAKVVKGGRRFSFAALVVVGDEKGRVGWGAGKAREVPEAIRKA 84

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
           TE AKR M+ V + +GRTLHHD +G  GAG+VI+R+A AGTG+IAGG +RAV E LGM D
Sbjct: 85  TERAKRTMVRVPMREGRTLHHDVIGEFGAGRVILRAAPAGTGIIAGGPMRAVFETLGMGD 144

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           VVAK  G++NPHN+++ATF  L   + PR VA+RRG K S L   R  +  +   +
Sbjct: 145 VVAKCTGTTNPHNMVKATFAALTRCTSPRAVASRRGKKVSDLLGPRKDAEPAQEAA 200


>gi|69247186|ref|ZP_00604248.1| Ribosomal protein S5, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|227550737|ref|ZP_03980786.1| ribosomal protein S5 [Enterococcus faecium TX1330]
 gi|257878742|ref|ZP_05658395.1| ribosomal protein S5 [Enterococcus faecium 1,230,933]
 gi|257881383|ref|ZP_05661036.1| ribosomal protein S5 [Enterococcus faecium 1,231,502]
 gi|257885651|ref|ZP_05665304.1| ribosomal protein S5 [Enterococcus faecium 1,231,501]
 gi|257888004|ref|ZP_05667657.1| ribosomal protein S5 [Enterococcus faecium 1,141,733]
 gi|257890601|ref|ZP_05670254.1| ribosomal protein S5 [Enterococcus faecium 1,231,410]
 gi|257893191|ref|ZP_05672844.1| ribosomal protein S5 [Enterococcus faecium 1,231,408]
 gi|257896377|ref|ZP_05676030.1| ribosomal protein S5 [Enterococcus faecium Com12]
 gi|257899351|ref|ZP_05679004.1| ribosomal protein S5 [Enterococcus faecium Com15]
 gi|258615194|ref|ZP_05712964.1| ribosomal protein S5 [Enterococcus faecium DO]
 gi|260558304|ref|ZP_05830500.1| ribosomal protein S5 [Enterococcus faecium C68]
 gi|261207010|ref|ZP_05921699.1| ribosomal protein S5 [Enterococcus faecium TC 6]
 gi|289565355|ref|ZP_06445805.1| 30S ribosomal protein S5 [Enterococcus faecium D344SRF]
 gi|293379463|ref|ZP_06625607.1| ribosomal protein S5 [Enterococcus faecium PC4.1]
 gi|293553896|ref|ZP_06674502.1| ribosomal protein S5 [Enterococcus faecium E1039]
 gi|293562963|ref|ZP_06677430.1| ribosomal protein S5 [Enterococcus faecium E1162]
 gi|293567914|ref|ZP_06679255.1| ribosomal protein S5 [Enterococcus faecium E1071]
 gi|293570701|ref|ZP_06681751.1| ribosomal protein S5 [Enterococcus faecium E980]
 gi|294615376|ref|ZP_06695249.1| ribosomal protein S5 [Enterococcus faecium E1636]
 gi|294618303|ref|ZP_06697884.1| ribosomal protein S5 [Enterococcus faecium E1679]
 gi|294621096|ref|ZP_06700287.1| ribosomal protein S5 [Enterococcus faecium U0317]
 gi|314937625|ref|ZP_07844951.1| ribosomal protein S5 [Enterococcus faecium TX0133a04]
 gi|314942876|ref|ZP_07849689.1| ribosomal protein S5 [Enterococcus faecium TX0133C]
 gi|314947988|ref|ZP_07851392.1| ribosomal protein S5 [Enterococcus faecium TX0082]
 gi|314950905|ref|ZP_07853974.1| ribosomal protein S5 [Enterococcus faecium TX0133A]
 gi|314991447|ref|ZP_07856924.1| ribosomal protein S5 [Enterococcus faecium TX0133B]
 gi|314995032|ref|ZP_07860152.1| ribosomal protein S5 [Enterococcus faecium TX0133a01]
 gi|68194951|gb|EAN09419.1| Ribosomal protein S5, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|227180198|gb|EEI61170.1| ribosomal protein S5 [Enterococcus faecium TX1330]
 gi|257812970|gb|EEV41728.1| ribosomal protein S5 [Enterococcus faecium 1,230,933]
 gi|257817041|gb|EEV44369.1| ribosomal protein S5 [Enterococcus faecium 1,231,502]
 gi|257821507|gb|EEV48637.1| ribosomal protein S5 [Enterococcus faecium 1,231,501]
 gi|257824058|gb|EEV50990.1| ribosomal protein S5 [Enterococcus faecium 1,141,733]
 gi|257826961|gb|EEV53587.1| ribosomal protein S5 [Enterococcus faecium 1,231,410]
 gi|257829570|gb|EEV56177.1| ribosomal protein S5 [Enterococcus faecium 1,231,408]
 gi|257832942|gb|EEV59363.1| ribosomal protein S5 [Enterococcus faecium Com12]
 gi|257837263|gb|EEV62337.1| ribosomal protein S5 [Enterococcus faecium Com15]
 gi|260075478|gb|EEW63784.1| ribosomal protein S5 [Enterococcus faecium C68]
 gi|260078638|gb|EEW66340.1| ribosomal protein S5 [Enterococcus faecium TC 6]
 gi|289162845|gb|EFD10695.1| 30S ribosomal protein S5 [Enterococcus faecium D344SRF]
 gi|291589499|gb|EFF21306.1| ribosomal protein S5 [Enterococcus faecium E1071]
 gi|291591750|gb|EFF23386.1| ribosomal protein S5 [Enterococcus faecium E1636]
 gi|291595397|gb|EFF26709.1| ribosomal protein S5 [Enterococcus faecium E1679]
 gi|291599332|gb|EFF30358.1| ribosomal protein S5 [Enterococcus faecium U0317]
 gi|291601948|gb|EFF32194.1| ribosomal protein S5 [Enterococcus faecium E1039]
 gi|291605089|gb|EFF34556.1| ribosomal protein S5 [Enterococcus faecium E1162]
 gi|291609173|gb|EFF38445.1| ribosomal protein S5 [Enterococcus faecium E980]
 gi|292641986|gb|EFF60152.1| ribosomal protein S5 [Enterococcus faecium PC4.1]
 gi|313590758|gb|EFR69603.1| ribosomal protein S5 [Enterococcus faecium TX0133a01]
 gi|313593927|gb|EFR72772.1| ribosomal protein S5 [Enterococcus faecium TX0133B]
 gi|313596914|gb|EFR75759.1| ribosomal protein S5 [Enterococcus faecium TX0133A]
 gi|313598348|gb|EFR77193.1| ribosomal protein S5 [Enterococcus faecium TX0133C]
 gi|313643002|gb|EFS07582.1| ribosomal protein S5 [Enterococcus faecium TX0133a04]
 gi|313645586|gb|EFS10166.1| ribosomal protein S5 [Enterococcus faecium TX0082]
          Length = 166

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 105/163 (64%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           + +   + DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPKHLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIRKAI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N++ V ++ G T+ H+ +G    G+++M+ A+ G+GV AGG +RAV E+ G+ D+
Sbjct: 65  EDAKKNLVEVPMV-GSTIPHEVIGAFSGGRILMKPAVEGSGVAAGGPVRAVLELAGVADI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GS+ P NV+RAT E L+      +VA  RG     L  
Sbjct: 124 TSKSLGSNTPINVVRATVEGLKQLKRAEEVAELRGKSVEELIG 166


>gi|315649682|ref|ZP_07902766.1| ribosomal protein S5 [Paenibacillus vortex V453]
 gi|315274870|gb|EFU38246.1| ribosomal protein S5 [Paenibacillus vortex V453]
          Length = 165

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD K  VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTERVVNINRVAKVVKGGRRFSFSALVVVGDGKGWVGAGIGKAGEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I + L+ G T+ H   G  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLIHIPLV-GTTIPHLVTGHFGAGRVLLKPASEGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L       DVA  RG     L  
Sbjct: 121 DILTKSLGSSNSMNMVNATLEGLSRLKRAEDVAKLRGKSVEELLG 165


>gi|295099221|emb|CBK88310.1| SSU ribosomal protein S5P [Eubacterium cylindroides T2-87]
          Length = 169

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 79/178 (44%), Positives = 112/178 (62%), Gaps = 9/178 (5%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA + + +RD             +++VAINRV+  + GGRRF F+ LVVVGD K +VG  
Sbjct: 1   MAMERKPRRDQK--------EFEEQVVAINRVTKVVKGGRRFRFAALVVVGDRKGRVGIG 52

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A EVP+A++KA E AK+N+ +V ++ G T+ HD VG +GAG V MR A  GTGVIAG
Sbjct: 53  TGKANEVPDAIKKAIEDAKKNVFTVPIV-GTTIPHDIVGNYGAGSVFMRPATEGTGVIAG 111

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GA RAV E+ G++D++ K +GS    NV+RAT + L++     +VA  RG K   ++ 
Sbjct: 112 GAARAVLELAGINDILTKCLGSRTKINVVRATVDALQNLRTLDEVAALRGKKPEEIRG 169


>gi|188581399|ref|YP_001924844.1| 30S ribosomal protein S5 [Methylobacterium populi BJ001]
 gi|240138775|ref|YP_002963247.1| 30S ribosomal subunit protein S5 [Methylobacterium extorquens AM1]
 gi|226703359|sp|B1Z776|RS5_METPB RecName: Full=30S ribosomal protein S5
 gi|179344897|gb|ACB80309.1| ribosomal protein S5 [Methylobacterium populi BJ001]
 gi|240008744|gb|ACS39970.1| 30S ribosomal subunit protein S5 [Methylobacterium extorquens AM1]
          Length = 192

 Score =  177 bits (448), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 107/173 (61%), Positives = 133/173 (76%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAK
Sbjct: 18  SEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R +I VSL +GRTLHHD  GRHGAGKVI+R+A  GTG+IAGG +RAV E LGM DVVAKS
Sbjct: 78  RGLIRVSLREGRTLHHDVNGRHGAGKVILRAAPQGTGIIAGGPMRAVFETLGMQDVVAKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           +GSSNP+N++RATF+ L+++  PR VA RRG+K S LQARR  +  + +    
Sbjct: 138 LGSSNPYNLVRATFDALKNEDSPRSVAARRGLKVSALQARRRDADPADTSDAA 190


>gi|18311370|ref|NP_563304.1| 30S ribosomal protein S5 [Clostridium perfringens str. 13]
 gi|110800455|ref|YP_697077.1| 30S ribosomal protein S5 [Clostridium perfringens ATCC 13124]
 gi|110801998|ref|YP_699646.1| 30S ribosomal protein S5 [Clostridium perfringens SM101]
 gi|168205217|ref|ZP_02631222.1| ribosomal protein S5 [Clostridium perfringens E str. JGS1987]
 gi|168211888|ref|ZP_02637513.1| ribosomal protein S5 [Clostridium perfringens B str. ATCC 3626]
 gi|168215193|ref|ZP_02640818.1| ribosomal protein S5 [Clostridium perfringens CPE str. F4969]
 gi|168216648|ref|ZP_02642273.1| ribosomal protein S5 [Clostridium perfringens NCTC 8239]
 gi|169347048|ref|ZP_02865990.1| ribosomal protein S5 [Clostridium perfringens C str. JGS1495]
 gi|182626933|ref|ZP_02954666.1| ribosomal protein S5 [Clostridium perfringens D str. JGS1721]
 gi|26399425|sp|Q8XHU0|RS5_CLOPE RecName: Full=30S ribosomal protein S5
 gi|123047163|sp|Q0SQG1|RS5_CLOPS RecName: Full=30S ribosomal protein S5
 gi|123344491|sp|Q0TMR3|RS5_CLOP1 RecName: Full=30S ribosomal protein S5
 gi|18146054|dbj|BAB82094.1| 30S ribosomal protein S5 [Clostridium perfringens str. 13]
 gi|110675102|gb|ABG84089.1| 30S ribosomal protein S5 [Clostridium perfringens ATCC 13124]
 gi|110682499|gb|ABG85869.1| 30S ribosomal protein S5 [Clostridium perfringens SM101]
 gi|169296731|gb|EDS78860.1| ribosomal protein S5 [Clostridium perfringens C str. JGS1495]
 gi|170663268|gb|EDT15951.1| ribosomal protein S5 [Clostridium perfringens E str. JGS1987]
 gi|170710161|gb|EDT22343.1| ribosomal protein S5 [Clostridium perfringens B str. ATCC 3626]
 gi|170713410|gb|EDT25592.1| ribosomal protein S5 [Clostridium perfringens CPE str. F4969]
 gi|177907723|gb|EDT70338.1| ribosomal protein S5 [Clostridium perfringens D str. JGS1721]
 gi|182381154|gb|EDT78633.1| ribosomal protein S5 [Clostridium perfringens NCTC 8239]
          Length = 165

 Score =  177 bits (448), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 100/165 (60%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V+I+RV+  + GGR F FS LVVVGD    VG     + E+PEA+RK
Sbjct: 2   RIDPSTLDLKEKVVSISRVTKVVKGGRNFRFSALVVVGDENGHVGVGTGKSIEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ VS++ G T+ H+  G+ G G V++  A  GTGVIAGG  R+V E+ G+ 
Sbjct: 62  GIEDAKKNLVEVSIV-GTTVPHEIHGKFGTGDVLIMPATEGTGVIAGGPARSVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N+++AT   L +     D+A  RG     +  
Sbjct: 121 DVRAKSLGSNNPRNMVKATINGLANLRTAEDIAKLRGKSVEEIIG 165


>gi|210611142|ref|ZP_03288756.1| hypothetical protein CLONEX_00946 [Clostridium nexile DSM 1787]
 gi|210152129|gb|EEA83136.1| hypothetical protein CLONEX_00946 [Clostridium nexile DSM 1787]
          Length = 169

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KQNRIDASQLELTEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +ISVSL +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKLISVSLDENESITHDLIGKFGSASVLLKKAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L     P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATINGLSQIKTPEEVAKLRGKSVEEILG 169


>gi|78221863|ref|YP_383610.1| 30S ribosomal protein S5 [Geobacter metallireducens GS-15]
 gi|91207865|sp|Q39XY9|RS5_GEOMG RecName: Full=30S ribosomal protein S5
 gi|78193118|gb|ABB30885.1| SSU ribosomal protein S5P [Geobacter metallireducens GS-15]
          Length = 162

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 75/159 (47%), Positives = 113/159 (71%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q     + ++ D++V I+RV+  + GGRRF+FS LVVVGD    VG+    A EVPEA+R
Sbjct: 2   QKINPNELNLTDKVVHISRVAKVVKGGRRFSFSALVVVGDGSGFVGYGLGKANEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+N+I V +++G+T+ ++ +G  GAG+V+++ A AGTGVIAGGA RAV E  G+
Sbjct: 62  KGVEQAKKNLIKVPIVEGQTIPYEVLGHFGAGRVLIKPASAGTGVIAGGAARAVFESAGL 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGI 171
           H+V++K +GS+NPHNV++A F+ L+    P ++  RRG+
Sbjct: 122 HNVLSKCLGSNNPHNVVKAAFDGLKQLRSPDEIMARRGM 160


>gi|261409504|ref|YP_003245745.1| 30S ribosomal protein S5 [Paenibacillus sp. Y412MC10]
 gi|329922036|ref|ZP_08277829.1| ribosomal protein S5 [Paenibacillus sp. HGF5]
 gi|261285967|gb|ACX67938.1| ribosomal protein S5 [Paenibacillus sp. Y412MC10]
 gi|328942419|gb|EGG38683.1| ribosomal protein S5 [Paenibacillus sp. HGF5]
          Length = 165

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD K  VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTERVVNINRVAKVVKGGRRFSFSALVVVGDGKGWVGAGIGKAGEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I + L+ G T+ H   G  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLIHIPLV-GTTIPHLVTGHFGAGRVLLKPASEGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L       DVA  RG     L  
Sbjct: 121 DILTKSLGSSNSMNMVNATLEGLSRLKRVEDVAKLRGKSVEELLG 165


>gi|31077162|sp|Q98N40|RS5_RHILO RecName: Full=30S ribosomal protein S5
          Length = 187

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 108/170 (63%), Positives = 135/170 (79%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
           D+ +VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATE+A
Sbjct: 18  DDGMVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATESA 77

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           KR+MI V L  GRTLHHD  GR GAG+V++R+A  GTG+IAGG +RAV E LGMHDVVAK
Sbjct: 78  KRDMIFVPLRSGRTLHHDVEGRWGAGRVLLRAAKQGTGIIAGGPMRAVFETLGMHDVVAK 137

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           S+GSSNP+N++RATF+ L+SQ HP+DVA  RGIK+S LQARR  +  +  
Sbjct: 138 SMGSSNPYNMVRATFDALKSQMHPKDVAAARGIKYSTLQARRGTAVAAEE 187


>gi|303240955|ref|ZP_07327466.1| ribosomal protein S5 [Acetivibrio cellulolyticus CD2]
 gi|302591541|gb|EFL61278.1| ribosomal protein S5 [Acetivibrio cellulolyticus CD2]
          Length = 166

 Score =  177 bits (448), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 69/166 (41%), Positives = 99/166 (59%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q  +     + +++V I RV+  + GGR F FS LVVVGD    VG     A E+P+A+R
Sbjct: 2   QRIDASVLELKEKVVNIGRVTKVVKGGRNFRFSALVVVGDENGHVGAGMGKAAEIPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+N+I V L++  T+ H+  G +GAGKV+++ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KGIEDAKKNLIKVPLVES-TIPHEVTGEYGAGKVLIKPAGEGTGVIAGGPVRAVLELTGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+  KS+GS+NP N++ AT E L       +VA  R      +  
Sbjct: 121 RDIRTKSLGSNNPINMVHATIEGLSRLKTVEEVAKLRNKTVEEVLG 166


>gi|167465570|ref|ZP_02330659.1| 30S ribosomal protein S5 [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381111|ref|ZP_08055114.1| 30S ribosomal protein S5-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154687|gb|EFX46958.1| 30S ribosomal protein S5-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 165

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 72/165 (43%), Positives = 102/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGRRF+FS LVVVGD    VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTEKVVNINRVAKVVKGGRRFSFSALVVVGDGNGWVGAGIGKASEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I + ++ G T+ H   GR GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLIHIPIV-GTTIPHQVTGRFGAGRVLLKPASEGTGVIAGGPVRAVLELAGIG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L+      +VA  RG     L  
Sbjct: 121 DILTKSLGSSNSMNMVNATLEGLQRLKRAEEVAKLRGKTVEELLG 165


>gi|73661989|ref|YP_300770.1| 30S ribosomal protein S5 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|91207891|sp|Q49ZF1|RS5_STAS1 RecName: Full=30S ribosomal protein S5
 gi|72494504|dbj|BAE17825.1| 30S ribosomal protein S5 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 165

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/163 (45%), Positives = 104/163 (63%), Gaps = 1/163 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           R E      +R+V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA
Sbjct: 3   RREEAKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKA 62

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            EAAK++++ V  ++  T  H   GR  +G V M+ A  GTGVIAGG +RAV E+ G+ D
Sbjct: 63  VEAAKKDLVVVPRVE-GTTPHTITGRFSSGSVFMKPAAPGTGVIAGGPVRAVLELAGITD 121

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +++KS+GS+ P N++RAT   L++  +  DVA  RG     L 
Sbjct: 122 ILSKSLGSNTPINMVRATINGLKNLKNAEDVAKLRGKSVEELY 164


>gi|71891992|ref|YP_277722.1| 30S ribosomal subunit protein S5 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|91207852|sp|Q493J1|RS5_BLOPB RecName: Full=30S ribosomal protein S5
 gi|71796098|gb|AAZ40849.1| 30S ribosomal subunit protein S5 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 174

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 67/166 (40%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +++   + ++++ +NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++
Sbjct: 2   KYTDKQPGELQEKLITVNRVSKTVKGGRVFSFTALTVVGDANGRVGFGYGKAREVPSAIQ 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K+ E A+RNM+ +SL    TL H   G +   ++ M+ A  GTG+IAG  +RA+ EV+G+
Sbjct: 62  KSMEKARRNMVIISLYK-GTLQHAVKGVYTGSRIYMQPASEGTGIIAGTTMRAILEVVGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V+AK+ GS+NP N++RAT   L+S   P  +A +RG   S +  
Sbjct: 121 HNVLAKAYGSTNPINIVRATINALQSMKSPEMIAEKRGKSISEILG 166


>gi|114799166|ref|YP_761512.1| 30S ribosomal protein S5 [Hyphomonas neptunium ATCC 15444]
 gi|123322951|sp|Q0BYD1|RS5_HYPNA RecName: Full=30S ribosomal protein S5
 gi|114739340|gb|ABI77465.1| ribosomal protein S5 [Hyphomonas neptunium ATCC 15444]
          Length = 200

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 98/182 (53%), Positives = 136/182 (74%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           N ++R++  + +VD++V INRV+  + GG+ F F+ LVVVGD K + GF    AREVPEA
Sbjct: 17  NPRDRDDESSELVDKLVGINRVAKTVKGGKNFGFAALVVVGDQKGRAGFGKGKAREVPEA 76

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKATE AKRN++ + L +GRTLHHDG GRHGAGKV++R+A  GTGVIAGG +RAV EVL
Sbjct: 77  IRKATEEAKRNLVRIPLREGRTLHHDGNGRHGAGKVVLRAAPPGTGVIAGGPMRAVMEVL 136

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           G+ DVV KS+GSSNP+N++RATF+ L+ Q++PR VA++RG+K   +  RR   +  +  +
Sbjct: 137 GVQDVVGKSLGSSNPYNMVRATFDALKGQANPRTVASKRGLKVQDIVGRRTDGASEAGMA 196

Query: 191 RD 192
             
Sbjct: 197 DS 198


>gi|148560032|ref|YP_001259136.1| 30S ribosomal protein S5 [Brucella ovis ATCC 25840]
 gi|172048263|sp|A5VQY9|RS5_BRUO2 RecName: Full=30S ribosomal protein S5
 gi|148371289|gb|ABQ61268.1| ribosomal protein S5 [Brucella ovis ATCC 25840]
          Length = 186

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 105/159 (66%), Positives = 130/159 (81%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GGRRF F+ L+VVGD K +VGF H  AREVPEA+RKATEAAKR+
Sbjct: 20  FVDKLVHINRVAKVVKGGRRFGFAALIVVGDQKGRVGFGHGKAREVPEAIRKATEAAKRD 79

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           MI V L  GRTLHHD  GRHGAGKV++R+A AG G+IAGG +RAV E LG+ DVVAKS+G
Sbjct: 80  MIFVPLRSGRTLHHDVEGRHGAGKVLLRAAPAGKGIIAGGPMRAVFETLGVQDVVAKSLG 139

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           SSNP+N++RATF+ L+ Q HP+D+A +RGIK+S LQARR
Sbjct: 140 SSNPYNMVRATFDALKHQMHPKDIAAQRGIKYSTLQARR 178


>gi|163851607|ref|YP_001639650.1| ribosomal protein S5 [Methylobacterium extorquens PA1]
 gi|218530416|ref|YP_002421232.1| 30S ribosomal protein S5 [Methylobacterium chloromethanicum CM4]
 gi|254561375|ref|YP_003068470.1| 30S ribosomal subunit protein S5 [Methylobacterium extorquens DM4]
 gi|226703357|sp|A9W4S3|RS5_METEP RecName: Full=30S ribosomal protein S5
 gi|254765693|sp|B7L0T3|RS5_METC4 RecName: Full=30S ribosomal protein S5
 gi|163663212|gb|ABY30579.1| ribosomal protein S5 [Methylobacterium extorquens PA1]
 gi|218522719|gb|ACK83304.1| ribosomal protein S5 [Methylobacterium chloromethanicum CM4]
 gi|254268653|emb|CAX24612.1| 30S ribosomal subunit protein S5 [Methylobacterium extorquens DM4]
          Length = 192

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 107/173 (61%), Positives = 133/173 (76%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAK
Sbjct: 18  SEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R +I VSL +GRTLHHD  GRHGAGKVI+R+A  GTG+IAGG +RAV E LGM DVVAKS
Sbjct: 78  RGLIRVSLREGRTLHHDVNGRHGAGKVILRAAPQGTGIIAGGPMRAVFETLGMQDVVAKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           +GSSNP+N++RATF+ L+++  PR VA RRG+K S LQARR  +  + +    
Sbjct: 138 LGSSNPYNLVRATFDALKNEDSPRSVAARRGLKVSALQARRRDADPADTSEAA 190


>gi|89070539|ref|ZP_01157828.1| 30S ribosomal protein S5 [Oceanicola granulosus HTCC2516]
 gi|89043846|gb|EAR50044.1| 30S ribosomal protein S5 [Oceanicola granulosus HTCC2516]
          Length = 195

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 102/195 (52%), Positives = 137/195 (70%), Gaps = 2/195 (1%)

Query: 1   MAQK-ERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGF 59
           MA++  R      +   + +    DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF
Sbjct: 1   MAREPNRRDGGRGRRDRDENPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGF 60

Query: 60  AHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIA 119
               A+EVPEA+RKATE AKR MI V+L +GRTLHHD  GRHGAG+V+MR+A  GTG+IA
Sbjct: 61  GKGKAKEVPEAIRKATEQAKRQMIRVALREGRTLHHDIEGRHGAGRVVMRTAPQGTGIIA 120

Query: 120 GGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           GG +RAV E+LG+ DVVAKSIGS NP+N+IRAT + L+++  PR+VA RRG K + +  +
Sbjct: 121 GGPMRAVFEMLGVQDVVAKSIGSQNPYNMIRATLDGLKAEQSPRNVAQRRGKKVADILPK 180

Query: 180 R-VVSSKSSSYSRDS 193
           R      S+  + ++
Sbjct: 181 RDEAPEASAQVAEEA 195


>gi|114567824|ref|YP_754978.1| 30S ribosomal protein S5 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122317299|sp|Q0AUJ7|RS5_SYNWW RecName: Full=30S ribosomal protein S5
 gi|114338759|gb|ABI69607.1| SSU ribosomal protein S5P [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 167

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 80/164 (48%), Positives = 112/164 (68%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           ++E+    +++++V I RV+  + GGRRF+FS LVVVGD + KVG     A EVPEA+RK
Sbjct: 3   DKEQAAPEMIEKVVTIRRVAKVVKGGRRFSFSALVVVGDGEGKVGTGKGKATEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+NM+SV L+DGRT+ H+ +G  GAG+V+++ A  GTGVIAGG +RAV E  G+ 
Sbjct: 63  AIENAKKNMLSVPLIDGRTIPHEILGIFGAGQVLLKPASEGTGVIAGGPVRAVLEAAGIK 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D++ KS+GS N  N++ AT E LRS     DVA +RG     + 
Sbjct: 123 DILTKSLGSDNATNIVHATMEGLRSLKRVEDVARQRGKTIDEIM 166


>gi|114327235|ref|YP_744392.1| 30S ribosomal protein S5 [Granulibacter bethesdensis CGDNIH1]
 gi|122327786|sp|Q0BUN3|RS5_GRABC RecName: Full=30S ribosomal protein S5
 gi|114315409|gb|ABI61469.1| SSU ribosomal protein S5P [Granulibacter bethesdensis CGDNIH1]
          Length = 190

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 99/174 (56%), Positives = 125/174 (71%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           + I+D++V INRV+  + GGRRFAF+ LVVVGD K +VG+    AREVPEA+RKATE AK
Sbjct: 17  DDIIDKLVTINRVAKVVKGGRRFAFAALVVVGDQKGRVGYGAGKAREVPEAIRKATERAK 76

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R+MI V + +GRTLHHD  G  GAGKV++RSA AGTG+IAGG +RAV E LG+ DVVAKS
Sbjct: 77  RSMIRVPMKEGRTLHHDVYGHFGAGKVVLRSATAGTGIIAGGPMRAVFESLGIGDVVAKS 136

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           +GS NPHN+++ATF  L   S PR VA+RRG K S +  RR   +        +
Sbjct: 137 LGSRNPHNMVKATFAALERCSSPRSVASRRGKKVSDILGRREPVAGQEGEEAHA 190


>gi|162149157|ref|YP_001603618.1| 30S ribosomal protein S5 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545099|ref|YP_002277328.1| 30S ribosomal protein S5 [Gluconacetobacter diazotrophicus PAl 5]
 gi|226703350|sp|A9H3L2|RS5_GLUDA RecName: Full=30S ribosomal protein S5
 gi|161787734|emb|CAP57330.1| 30S ribosomal protein S5 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532776|gb|ACI52713.1| ribosomal protein S5 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 192

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 103/190 (54%), Positives = 136/190 (71%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R      ++RE   + +VD++V INRV+  + GGRRFAF+ LVVVGD K +VG+ 
Sbjct: 1   MAREPREGGRGGRDREREGDDLVDKLVTINRVAKVVKGGRRFAFAALVVVGDQKGRVGYG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVPEA+RKAT+ AKR MI V + +GRTLHHD  G  GAGKV++RSA AGTG+IAG
Sbjct: 61  AGKAREVPEAIRKATDRAKRAMIRVPMKEGRTLHHDVAGHFGAGKVVLRSADAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG++DVVAKS+G+ NPHN+++ATF  L   + PR VANRRG K S +  RR
Sbjct: 121 GPMRAVFESLGINDVVAKSLGTRNPHNMVKATFAALERCASPRTVANRRGKKVSDILGRR 180

Query: 181 VVSSKSSSYS 190
            V+    + +
Sbjct: 181 DVAGTGEAAA 190


>gi|294010630|ref|YP_003544090.1| ribosomal protein S5 [Sphingobium japonicum UT26S]
 gi|292673960|dbj|BAI95478.1| ribosomal protein S5 [Sphingobium japonicum UT26S]
          Length = 235

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 96/178 (53%), Positives = 127/178 (71%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           EE+   +++++V INRVS  + GG+RF F+ LVVVGD K + GF H  AREVPEA+ KAT
Sbjct: 55  EEQGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAREVPEAISKAT 114

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            +AK+ M+ V L +GRTLHHDG+G  GAGKV +RSA AGTG+IAGG +RAV E LG+ DV
Sbjct: 115 ASAKKAMVRVPLKEGRTLHHDGLGHFGAGKVTVRSAPAGTGIIAGGPMRAVFESLGVADV 174

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           V KS G+SNP+N+IRATF  L  Q+ P+ VA RRG K + L  R   S++ +    ++
Sbjct: 175 VTKSNGTSNPYNMIRATFAALGEQTSPKSVAQRRGKKVADLLRRGGASAEVAQADAEA 232


>gi|88854666|ref|ZP_01129332.1| 30S ribosomal protein S5 [marine actinobacterium PHSC20C1]
 gi|88815827|gb|EAR25683.1| 30S ribosomal protein S5 [marine actinobacterium PHSC20C1]
          Length = 241

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/179 (43%), Positives = 110/179 (61%), Gaps = 1/179 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
             +R+   N  ++R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  AREVP A+
Sbjct: 62  NNSRDNDKNQFLERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAREVPLAI 121

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
            K  E AK+N   V  +   ++ H   G   AG V++R A AGTGVIAGG +RAV E  G
Sbjct: 122 SKGVEEAKKNFFRVPRV-AASIPHSVQGEAAAGVVLLRPASAGTGVIAGGPVRAVLECAG 180

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +HDV++KS+GSSN  N++ AT   L+    PR VA RRG+    +   R++ +++ + +
Sbjct: 181 IHDVLSKSLGSSNTINIVHATVAALKQLEEPRAVAARRGLDAEHVIPARLLRAEAEAKA 239


>gi|114766879|ref|ZP_01445801.1| 30S ribosomal protein S5 [Pelagibaca bermudensis HTCC2601]
 gi|114540925|gb|EAU43985.1| 30S ribosomal protein S5 [Roseovarius sp. HTCC2601]
          Length = 192

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 104/194 (53%), Positives = 136/194 (70%), Gaps = 3/194 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++  + +     E       DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MAERDNRRNNRRDRDET--PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAG+V+MR+A  GTG+IAG
Sbjct: 59  KGKAKEVPEAIRKATEQAKRKMIRVPLREGRTLHHDVEGRHGAGRVVMRTAPQGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+HDVVAKSIGS NP+N+IRAT   L  +  PR+VA RRG K + +  +R
Sbjct: 119 GPMRAVFEMLGVHDVVAKSIGSQNPYNMIRATLAGLEREQSPRNVAQRRGKKVADILPKR 178

Query: 181 -VVSSKSSSYSRDS 193
               ++SS  + ++
Sbjct: 179 DEAPAESSQVAEEA 192


>gi|255020782|ref|ZP_05292840.1| SSU ribosomal protein S5p (S2e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254969778|gb|EET27282.1| SSU ribosomal protein S5p (S2e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 176

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 80/177 (45%), Positives = 116/177 (65%), Gaps = 7/177 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R       + ++  + + ++++ INRVS  + GGR+F F+ L+VVGD   KVGF 
Sbjct: 1   MARENR-------DNQQSADGMQEKLIHINRVSKVVKGGRQFGFAALMVVGDGDGKVGFG 53

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVP  ++KATE A+R +  + L+ G T+ H   GRHGA +VI+R A  G+GVIAG
Sbjct: 54  RGKAKEVPAGIQKATEQARRFLTQIPLMRGGTIPHPVEGRHGAARVILRPAPEGSGVIAG 113

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GA+RAVCE  G+ +VVAKS+GS+NP NV+RATF      S P+ VA +RG     ++
Sbjct: 114 GAMRAVCEAAGLRNVVAKSLGSNNPINVVRATFNAFGKLSSPQAVAMKRGKSLKDIR 170


>gi|256159951|ref|ZP_05457669.1| 30S ribosomal protein S5 [Brucella ceti M490/95/1]
 gi|256255182|ref|ZP_05460718.1| 30S ribosomal protein S5 [Brucella ceti B1/94]
 gi|261222378|ref|ZP_05936659.1| ribosomal protein S5 [Brucella ceti B1/94]
 gi|265998343|ref|ZP_06110900.1| ribosomal protein S5 [Brucella ceti M490/95/1]
 gi|260920962|gb|EEX87615.1| ribosomal protein S5 [Brucella ceti B1/94]
 gi|262552811|gb|EEZ08801.1| ribosomal protein S5 [Brucella ceti M490/95/1]
          Length = 179

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 100/154 (64%), Positives = 123/154 (79%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAKR+
Sbjct: 20  FVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAKRD 79

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           MI V L  GRTLHHD  GRHGAGKV++R+A AG G+IAGG +RAV E LG+ DVVAKS+G
Sbjct: 80  MIFVPLRSGRTLHHDVEGRHGAGKVLLRAAPAGKGIIAGGPMRAVFETLGVQDVVAKSLG 139

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSL 175
           SSNP+N++RATF+ L+ Q HP+D+A +RGIK   
Sbjct: 140 SSNPYNMVRATFDALKHQMHPKDIAAQRGIKVLD 173


>gi|302390975|ref|YP_003826795.1| 30S ribosomal protein S5P [Acetohalobium arabaticum DSM 5501]
 gi|302203052|gb|ADL11730.1| SSU ribosomal protein S5P [Acetohalobium arabaticum DSM 5501]
          Length = 170

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 97/166 (58%), Gaps = 1/166 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +  +  + +R+V INRVS  + GGRRF+FS LV+VGD    VG     A EVP A
Sbjct: 4   KKNMIDPDELELDERVVNINRVSKVVKGGRRFSFSSLVIVGDGNGHVGAGIGKANEVPGA 63

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++K   AAK+ +I V L D  T+ H+  G  GAG+V+ + A  GTG+IAGG IRAV E+ 
Sbjct: 64  IQKGIAAAKKELIEVPLDD-TTIPHEVTGVFGAGRVLFKPASEGTGIIAGGPIRAVVELA 122

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ D++ KS+GS NP N++ A  + L+       VA  RG     L
Sbjct: 123 GIKDILTKSLGSDNPLNMVNAAIQGLKEIKDVEKVAELRGKSVEEL 168


>gi|170748619|ref|YP_001754879.1| ribosomal protein S5 [Methylobacterium radiotolerans JCM 2831]
 gi|226703360|sp|B1LWQ9|RS5_METRJ RecName: Full=30S ribosomal protein S5
 gi|170655141|gb|ACB24196.1| ribosomal protein S5 [Methylobacterium radiotolerans JCM 2831]
          Length = 195

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 108/173 (62%), Positives = 132/173 (76%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAK
Sbjct: 21  SEFVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAK 80

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R +I VSL +GRTLHHD  GRHGAGKVI+R+A  GTG+IAGG +RAV E LGM DVVAKS
Sbjct: 81  RGLIRVSLREGRTLHHDVNGRHGAGKVILRAAPQGTGIIAGGPMRAVFETLGMQDVVAKS 140

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           +GSSNP+N++RATFE L+++  PR VA RRGIK S LQ+RR  +  +      
Sbjct: 141 LGSSNPYNLVRATFEALKNEDSPRSVAARRGIKVSTLQSRRRDADPADQSEAA 193


>gi|254517487|ref|ZP_05129543.1| ribosomal protein S5 [Clostridium sp. 7_2_43FAA]
 gi|226911236|gb|EEH96437.1| ribosomal protein S5 [Clostridium sp. 7_2_43FAA]
          Length = 165

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGR F FS LVVVGD    VG     + E+PEA++K
Sbjct: 2   RIDPSTLDLKEKVVNINRVTKVVKGGRNFRFSALVVVGDENGHVGVGMGKSIEIPEAIKK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++++SV+++ G T+ H   G+ G GKV++  A  GTGVIAGG  R+V E+ G+ 
Sbjct: 62  GIEDAKKHLVSVAIV-GTTVPHQIYGKFGTGKVLIMPAKEGTGVIAGGPARSVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT   L S     D+A  RG     +  
Sbjct: 121 DVRAKSLGSNNPKNMVNATINGLASLRTAEDIAKLRGKTVEEILG 165


>gi|307294991|ref|ZP_07574833.1| ribosomal protein S5 [Sphingobium chlorophenolicum L-1]
 gi|306879465|gb|EFN10683.1| ribosomal protein S5 [Sphingobium chlorophenolicum L-1]
          Length = 236

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 96/178 (53%), Positives = 127/178 (71%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           EE+   +++++V INRVS  + GG+RF F+ LVVVGD K + GF H  AREVPEA+ KAT
Sbjct: 56  EEQGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAREVPEAISKAT 115

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            +AK+ M+ V L +GRTLHHDG+G  GAGKV +RSA AGTG+IAGG +RAV E LG+ DV
Sbjct: 116 ASAKKAMVRVPLKEGRTLHHDGLGHFGAGKVTVRSAPAGTGIIAGGPMRAVFESLGVADV 175

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           V KS G+SNP+N+IRATF  L  Q+ P+ VA RRG K + L  R   S++ +    ++
Sbjct: 176 VTKSNGTSNPYNMIRATFAALGEQTSPKSVAQRRGKKVADLLRRGGASAEVAQADAEA 233


>gi|115376068|ref|ZP_01463313.1| ribosomal protein S5 [Stigmatella aurantiaca DW4/3-1]
 gi|310821011|ref|YP_003953369.1| 30S ribosomal protein S5 [Stigmatella aurantiaca DW4/3-1]
 gi|115366883|gb|EAU65873.1| ribosomal protein S5 [Stigmatella aurantiaca DW4/3-1]
 gi|309394083|gb|ADO71542.1| 30S ribosomal protein S5 [Stigmatella aurantiaca DW4/3-1]
          Length = 173

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/159 (46%), Positives = 99/159 (62%), Gaps = 1/159 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
              D  + DR+V INRV+  + GGRRF+F+ LVVVGD    VG     A EVPEA+RK  
Sbjct: 6   NPNDLDLTDRVVNINRVAKVVKGGRRFSFAALVVVGDGNGHVGIGLGKANEVPEAIRKGG 65

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N+  V L+ G T+ H+ +G  GAG V+++ A  GTGVIAGGA+RAV E  G+ ++
Sbjct: 66  ENAKKNLFRVPLM-GHTIPHEVLGHFGAGWVLLKPATEGTGVIAGGAVRAVLEAAGIRNI 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           + KS GS NPHNV++AT   L+       V+  RG    
Sbjct: 125 LTKSQGSRNPHNVLKATMAGLKRLRSAEQVSRLRGKDVE 163


>gi|126697657|ref|YP_001086554.1| 30S ribosomal protein S5 [Clostridium difficile 630]
 gi|254973748|ref|ZP_05270220.1| 30S ribosomal protein S5 [Clostridium difficile QCD-66c26]
 gi|255091138|ref|ZP_05320616.1| 30S ribosomal protein S5 [Clostridium difficile CIP 107932]
 gi|255099249|ref|ZP_05328226.1| 30S ribosomal protein S5 [Clostridium difficile QCD-63q42]
 gi|255305032|ref|ZP_05349204.1| 30S ribosomal protein S5 [Clostridium difficile ATCC 43255]
 gi|255312792|ref|ZP_05354375.1| 30S ribosomal protein S5 [Clostridium difficile QCD-76w55]
 gi|255515551|ref|ZP_05383227.1| 30S ribosomal protein S5 [Clostridium difficile QCD-97b34]
 gi|255648646|ref|ZP_05395548.1| 30S ribosomal protein S5 [Clostridium difficile QCD-37x79]
 gi|255654179|ref|ZP_05399588.1| 30S ribosomal protein S5 [Clostridium difficile QCD-23m63]
 gi|260681863|ref|YP_003213148.1| 30S ribosomal protein S5 [Clostridium difficile CD196]
 gi|260685461|ref|YP_003216594.1| 30S ribosomal protein S5 [Clostridium difficile R20291]
 gi|296449782|ref|ZP_06891551.1| 30S ribosomal protein S5 [Clostridium difficile NAP08]
 gi|296877846|ref|ZP_06901868.1| 30S ribosomal protein S5 [Clostridium difficile NAP07]
 gi|306518768|ref|ZP_07405115.1| 30S ribosomal protein S5 [Clostridium difficile QCD-32g58]
 gi|123363697|sp|Q18CH3|RS5_CLOD6 RecName: Full=30S ribosomal protein S5
 gi|115249094|emb|CAJ66905.1| 30S ribosomal protein S5 [Clostridium difficile]
 gi|260208026|emb|CBA60217.1| 30S ribosomal protein S5 [Clostridium difficile CD196]
 gi|260211477|emb|CBE01609.1| 30S ribosomal protein S5 [Clostridium difficile R20291]
 gi|296261380|gb|EFH08206.1| 30S ribosomal protein S5 [Clostridium difficile NAP08]
 gi|296431146|gb|EFH16971.1| 30S ribosomal protein S5 [Clostridium difficile NAP07]
          Length = 169

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V + RV+  + GGR F F+ LVVVGD    VG     A EVP+A
Sbjct: 3   RRKPIDAGQLDLQEKVVEVRRVTKVVKGGRNFRFAALVVVGDENGHVGIGAGKAMEVPDA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA E AK+N+I V ++ G T+ H+  G  GAG +++  A+ GTGVIAGG  RAV E+ 
Sbjct: 63  IKKAVEDAKKNLIVVPIV-GTTIPHEVRGHFGAGNILIMPAVEGTGVIAGGPARAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ DV AKS+GS+NP N++ AT E L S     D+A  RG K   L  
Sbjct: 122 GLKDVRAKSLGSNNPRNMVNATIEGLNSLKTVEDIAKLRGKKVEELLG 169


>gi|259047538|ref|ZP_05737939.1| 30S ribosomal protein S5 [Granulicatella adiacens ATCC 49175]
 gi|259035729|gb|EEW36984.1| 30S ribosomal protein S5 [Granulicatella adiacens ATCC 49175]
          Length = 166

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N + R+  + DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RK
Sbjct: 3   NVDARNLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDHNGHVGFGTGKAQEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I V    G T+ H+ +GR   G V+++ A AG+G+ AGG +RAV E+ G+ 
Sbjct: 63  AIEDAKKNLIEVP-TSGSTIPHEVIGRFCGGNVLLKPAQAGSGIAAGGPVRAVVELAGIS 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV +KS+GS+ P N++RAT E L+      DVA  RG     L  
Sbjct: 122 DVTSKSLGSNTPVNMVRATIEGLKQLKRVEDVAALRGKSVEELLG 166


>gi|254438851|ref|ZP_05052345.1| ribosomal protein S5 [Octadecabacter antarcticus 307]
 gi|198254297|gb|EDY78611.1| ribosomal protein S5 [Octadecabacter antarcticus 307]
          Length = 192

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 103/175 (58%), Positives = 129/175 (73%)

Query: 6   RSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAR 65
           R Q     NR + +    DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+
Sbjct: 3   RDQNQRGGNRRDENPEFQDRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAK 62

Query: 66  EVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRA 125
           EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MRSA  G+G+IAGG +RA
Sbjct: 63  EVPEAIRKATEQAKRQMIRVQLREGRTLHHDMEGRHGAGKVVMRSAPQGSGIIAGGPMRA 122

Query: 126 VCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           V E+LG+ D+VAKSIGSSNP+N+IRAT + L+ ++ PR VA RRG K + +  +R
Sbjct: 123 VFEMLGIQDIVAKSIGSSNPYNMIRATMDGLKKEASPRSVAQRRGKKVADILPKR 177


>gi|326203879|ref|ZP_08193741.1| ribosomal protein S5 [Clostridium papyrosolvens DSM 2782]
 gi|325985977|gb|EGD46811.1| ribosomal protein S5 [Clostridium papyrosolvens DSM 2782]
          Length = 167

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 70/158 (44%), Positives = 98/158 (62%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +++V I RV+  + GGR F FS LVVVGD    VG     A E+PEA+RK  E AK+
Sbjct: 11  ELKEKVVNIGRVTKVVKGGRNFRFSALVVVGDENGYVGTGMGKAAEIPEAIRKGIEDAKK 70

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V L++  T+ H+ +G  GAGKV+++ A  GTGVIAGG +RAV E+ G+ D+  KS+
Sbjct: 71  NLIKVPLVE-TTIPHEAIGVFGAGKVLLKPAGQGTGVIAGGPVRAVLELAGIRDIRTKSL 129

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+NP N++ AT E L       +VA  RG     +  
Sbjct: 130 GSNNPINMVNATIEGLAQLKTAEEVARLRGKTAEEILG 167


>gi|109897331|ref|YP_660586.1| 30S ribosomal protein S5 [Pseudoalteromonas atlantica T6c]
 gi|122972201|sp|Q15X56|RS5_PSEA6 RecName: Full=30S ribosomal protein S5
 gi|109699612|gb|ABG39532.1| SSU ribosomal protein S5P [Pseudoalteromonas atlantica T6c]
 gi|332175082|gb|AEE24336.1| ribosomal protein S5 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 167

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/162 (45%), Positives = 108/162 (66%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           ++   ++++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA E
Sbjct: 7   QQQGDLLEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAME 66

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+RN++ V L +G TL H   GRH   KV M+ A  GTG+IAGGA+RAV EV G+ +V+
Sbjct: 67  KARRNLVDVDL-NGNTLQHPIKGRHSGSKVYMQPASEGTGIIAGGAMRAVLEVAGVQNVL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +K  GS+NP NV+RAT   L   + P  VA +RG+  + +  
Sbjct: 126 SKCYGSTNPINVVRATINALTEMTSPDQVAAKRGLSVTQILG 167


>gi|229823519|ref|ZP_04449588.1| hypothetical protein GCWU000282_00817 [Catonella morbi ATCC 51271]
 gi|229786963|gb|EEP23077.1| hypothetical protein GCWU000282_00817 [Catonella morbi ATCC 51271]
          Length = 167

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/159 (46%), Positives = 102/159 (64%), Gaps = 1/159 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
            +I +R+V INRV+  + GGRR  FS LVVVGD    VGF    A+EVPEA+RKA E AK
Sbjct: 10  ENIEERVVTINRVTKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAK 69

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           +N+I V L  G T+ H+ +G    G+V+++ A AG+GV AGG +RAV E+ G+ DV +KS
Sbjct: 70  KNLIEVPLT-GTTIPHEAIGEFCGGRVLIKPAPAGSGVAAGGPVRAVMELAGVADVTSKS 128

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +GS+ P N++RAT E L+      +VA  RG     +  
Sbjct: 129 LGSNTPINMVRATVEGLKQLKVAEEVAALRGKSVEEILG 167


>gi|253577196|ref|ZP_04854516.1| 30S ribosomal protein S5 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843440|gb|EES71468.1| 30S ribosomal protein S5 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 165

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 102/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD K  VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTERVVNINRVAKVVKGGRRFSFSALVVVGDGKGWVGAGIGKAGEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ V L+ G T+ H  +G  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLVHVPLV-GTTIPHQVIGHFGAGRVLLKPASEGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L       DVA  RG     L  
Sbjct: 121 DILTKSLGSSNSINMVNATLEGLSRLKRAEDVAKLRGKTVEELLG 165


>gi|222150462|ref|YP_002559615.1| 30S ribosomal protein S5 [Macrococcus caseolyticus JCSC5402]
 gi|222119584|dbj|BAH16919.1| 30S ribosomal protein S5 [Macrococcus caseolyticus JCSC5402]
          Length = 165

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 77/164 (46%), Positives = 105/164 (64%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            RE+      +R+V INRVS  + GGRR  F+ LVVVGD   +VGF    A+EVPEA++K
Sbjct: 2   RREKEVKEFEERVVTINRVSKVVKGGRRMRFTALVVVGDKNGRVGFGTGKAQEVPEAIKK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I+V  +   T  H+  GR GAG V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AIEDAKKNLITVPRVK-GTTPHEVTGRFGAGSVLIKPAAPGTGVIAGGPVRAVLELAGIT 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D+++KS+GS+ P N++RAT E L+      DVA  RG     L 
Sbjct: 121 DILSKSLGSNTPINMVRATVEGLKELKVAEDVAKLRGKSVEELY 164


>gi|331091650|ref|ZP_08340484.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330403407|gb|EGG82966.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 169

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KQNRIDASQLELTEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + M+SV+L +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKMVSVALDEHNSVTHDLIGKFGSASVLLKKAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L     P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATINGLSQIKTPEEVAKLRGKSVEEILG 169


>gi|251799625|ref|YP_003014356.1| ribosomal protein S5 [Paenibacillus sp. JDR-2]
 gi|247547251|gb|ACT04270.1| ribosomal protein S5 [Paenibacillus sp. JDR-2]
          Length = 165

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 102/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGRRF+FS LVVVGD K  VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTEKVVHINRVAKVVKGGRRFSFSALVVVGDGKGYVGAGIGKAGEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V L+ G T+ H  VG  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLIHVPLV-GTTIPHLVVGHFGAGEVLLKPASKGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L       DVA  RG     L  
Sbjct: 121 DILTKSLGSSNSMNMVNATLEGLSRLKRAEDVAKLRGKTVEELLG 165


>gi|50955550|ref|YP_062838.1| 30S ribosomal protein S5 [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|73919068|sp|Q6AD11|RS5_LEIXX RecName: Full=30S ribosomal protein S5
 gi|50952032|gb|AAT89733.1| 30S ribosomal protein S5 [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 232

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 78/176 (44%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
           +   +  NR+   +  ++R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  ARE
Sbjct: 35  NPNRDRGNRDADKSQFLERVVTINRVSKVVKGGRRFSFTALVVVGDGNGLVGVGYGKARE 94

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP A+ K  E AK+N   V  +   T+ H   G   AG V++R A AGTGVIAGG +RAV
Sbjct: 95  VPLAISKGVEEAKKNFFRVPRV-ANTIPHPVQGEAAAGVVLLRPAAAGTGVIAGGPVRAV 153

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVV 182
            E  G+HDV++KS+GSSN  N++ AT E L+    PR VA RRG+ +  +   +++
Sbjct: 154 LECAGIHDVLSKSLGSSNTINIVHATVEALQQLEEPRAVAARRGLDYDRVAPEKLL 209


>gi|240145861|ref|ZP_04744462.1| ribosomal protein S5 [Roseburia intestinalis L1-82]
 gi|257202009|gb|EEV00294.1| ribosomal protein S5 [Roseburia intestinalis L1-82]
 gi|291535444|emb|CBL08556.1| SSU ribosomal protein S5P [Roseburia intestinalis M50/1]
          Length = 169

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 94/168 (55%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KREIIDASQLELNEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKASEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +I+V L +  ++ HD  G+H    V+++ +  GTG+IAGG  R VCE+ 
Sbjct: 62  IRKGKEDAMKKLITVKLDEVGSVTHDVTGKHTGASVLLKKSPEGTGIIAGGPARNVCELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L     P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATINALSQLKSPEEVAKLRGKSVEEIVG 169


>gi|254516928|ref|ZP_05128986.1| ribosomal protein S5 [gamma proteobacterium NOR5-3]
 gi|219674433|gb|EED30801.1| ribosomal protein S5 [gamma proteobacterium NOR5-3]
          Length = 168

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 81/166 (48%), Positives = 111/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            +++++D  + +++V +NRV+  + GGR F F+ L VVGD K +VGF    AREVP A++
Sbjct: 4   NDQKQQDGDLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGKGRVGFGRGKAREVPVAIQ 63

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +  T+ +    RHGA KV M+ A  GTGVIAGGA+RAV E+ G+
Sbjct: 64  KAMEAARRNMIQVDLDN-GTIQYPIKARHGASKVYMQPASEGTGVIAGGAMRAVLEIAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V+AK  GS+NP NV+RATF  LR  S P  VA +RG     +  
Sbjct: 123 HNVLAKCYGSTNPVNVVRATFNGLRDMSSPESVAAKRGKSVEEIYG 168


>gi|304321457|ref|YP_003855100.1| 30S ribosomal protein S5 [Parvularcula bermudensis HTCC2503]
 gi|303300359|gb|ADM09958.1| 30S ribosomal protein S5 [Parvularcula bermudensis HTCC2503]
          Length = 197

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 101/185 (54%), Positives = 133/185 (71%), Gaps = 3/185 (1%)

Query: 1   MAQKERSQRDNWQNR---EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKV 57
           MA++ +            +E  +   DR+VAINRVS  + GG+ F F+ LVVVGD K +V
Sbjct: 1   MAKEPQQGGRGRGRGKGRDEERDEFTDRLVAINRVSKTVKGGKNFGFAALVVVGDQKGRV 60

Query: 58  GFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGV 117
           GF    AREVPEA+RKAT+ AKR+++ V L DGRTLHHD  GRHGAGKV++R+A  GTGV
Sbjct: 61  GFGKGKAREVPEAIRKATQEAKRSLVRVPLRDGRTLHHDAYGRHGAGKVVLRTAPPGTGV 120

Query: 118 IAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           IAGG +RAV E+LG+ DVVAKS+G+SNP+N++RAT + L++Q +PR VA +RG+K S L 
Sbjct: 121 IAGGPMRAVFEMLGVQDVVAKSLGTSNPYNMVRATVDALKNQHNPRSVAAKRGMKVSELV 180

Query: 178 ARRVV 182
            RR  
Sbjct: 181 NRRAA 185


>gi|160894738|ref|ZP_02075513.1| hypothetical protein CLOL250_02289 [Clostridium sp. L2-50]
 gi|156863672|gb|EDO57103.1| hypothetical protein CLOL250_02289 [Clostridium sp. L2-50]
          Length = 169

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 93/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + D++V I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KREIIDASKLELEDKVVDIKRVTKVVKGGRNSRFACLVVVGDKNGHVGVGVGKAVEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +++++V + +  ++ +D  G  G+  V+++SA  GTG+IAGG  R V E+ 
Sbjct: 62  IRKGKEDAAKHLVTVPVNENGSIPYDWNGEFGSATVLLKSAPEGTGIIAGGPARNVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G  ++  KS+GS+N  NV+ AT + L     P ++A  RG     +
Sbjct: 122 GYKNIRTKSLGSNNKQNVVLATIKGLSEIKTPEEIARLRGKSVDEI 167


>gi|284042821|ref|YP_003393161.1| ribosomal protein S5 [Conexibacter woesei DSM 14684]
 gi|283947042|gb|ADB49786.1| ribosomal protein S5 [Conexibacter woesei DSM 14684]
          Length = 197

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 70/176 (39%), Positives = 112/176 (63%), Gaps = 1/176 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+V INRV+  + GGRRF+F+ LVVVGD +  VG  +  A EVP A++K  E AK+
Sbjct: 13  DLQERVVEINRVAKVVKGGRRFSFTALVVVGDEREIVGVGYGKANEVPVAIQKGVERAKK 72

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V    G T+ H  +G  G+G+V+++ A  GTGVIAGG +RAV E+ G+HD+++KS+
Sbjct: 73  NLIRVP-KHGSTITHPTLGIFGSGRVLLKPASPGTGVIAGGGVRAVLELAGIHDILSKSL 131

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           G+ NP N+++AT   L S   P +VA  RG+  + +   +     +   + ++ ++
Sbjct: 132 GTQNPINLVKATMAGLESLRRPEEVAELRGLSVNAVLGLQPAGEGAEDLTEENTDE 187


>gi|226309825|ref|YP_002769719.1| 30S ribosomal protein S5 [Brevibacillus brevis NBRC 100599]
 gi|226092773|dbj|BAH41215.1| 30S ribosomal protein S5 [Brevibacillus brevis NBRC 100599]
          Length = 165

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++VA+NRV+  + GGRR +FS LVVVGD    VG     A+EVP+A+RK
Sbjct: 2   RIDPSKLELEEKVVAVNRVAKTVKGGRRMSFSALVVVGDRNGHVGAGMGKAQEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A + AK+ +I V +  G T+ H  + + GAGKV+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AIDDAKKKLIRVPMR-GTTVPHQVLCQFGAGKVLIKPAAPGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+++KS+GS+NP N++ AT E L       DVA  RG     L  
Sbjct: 121 DILSKSLGSNNPINMVNATLEGLGRLKTAEDVAKLRGKTVDELLG 165


>gi|325663045|ref|ZP_08151495.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086652|ref|ZP_08335729.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470499|gb|EGC73729.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330409818|gb|EGG89253.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 169

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/168 (39%), Positives = 97/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KQNRIDASQLELTEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +ISVSL +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAAKKLISVSLDENGSITHDLIGKFGSASVLLKKAPDGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E L     P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIEGLSQIKTPEEVAKLRGKSVEEILG 169


>gi|260881645|ref|ZP_05404929.2| ribosomal protein S5 [Mitsuokella multacida DSM 20544]
 gi|260848072|gb|EEX68079.1| ribosomal protein S5 [Mitsuokella multacida DSM 20544]
          Length = 168

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 79/166 (47%), Positives = 109/166 (65%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +N +       +++V INRV+  + GGRRF+FS LVVVG+ K KVG     A EVPEA+R
Sbjct: 3   RNMDNETPEFEEKVVYINRVAKVVKGGRRFSFSALVVVGNKKGKVGVGLGKAAEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK+N++ V+L D RT+ H+ +G  GAGKV+M+ A  GTGVIAGG  RAV E+ G+
Sbjct: 63  KGVEDAKKNLVEVALYDNRTIPHEMIGIFGAGKVMMKPAAKGTGVIAGGPARAVLELAGI 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GS+NP+N++RAT E L+S      VA  RG     +  
Sbjct: 123 RDILTKSLGSANPNNMVRATMEGLKSLKRAEAVAELRGKTVQEILG 168


>gi|220928224|ref|YP_002505133.1| 30S ribosomal protein S5 [Clostridium cellulolyticum H10]
 gi|219998552|gb|ACL75153.1| ribosomal protein S5 [Clostridium cellulolyticum H10]
          Length = 167

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 71/158 (44%), Positives = 98/158 (62%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +++V I RV+  + GGR F FS LVVVGD    VG     A E+PEA+RK  E AK+
Sbjct: 11  ELKEKVVNIGRVTKVVKGGRNFRFSALVVVGDENGYVGSGMGKAAEIPEAIRKGIEDAKK 70

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V L+D  T+ H+ +G  GAGKV+++ A  GTGVIAGG +RAV E+ G+ D+  KS+
Sbjct: 71  NLIKVPLVD-TTIPHEALGVFGAGKVLIKPAAQGTGVIAGGPVRAVLELAGIRDIRTKSL 129

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+NP N++ AT E L       +VA  RG     +  
Sbjct: 130 GSNNPINMVNATIEGLAQLKTAEEVARLRGKTAEEILG 167


>gi|310644184|ref|YP_003948943.1| ribosomal RNA adenine methylase transferase [Paenibacillus polymyxa
           SC2]
 gi|309249135|gb|ADO58702.1| Ribosomal RNA adenine methylase transferase [Paenibacillus polymyxa
           SC2]
          Length = 165

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD    VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTERVVNINRVAKVVKGGRRFSFSALVVVGDGNGWVGAGIGKAGEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ V L+ G T+ H   G+ GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLVHVPLV-GTTIPHLVTGKFGAGRVLLKPASEGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L       DVA  RG     L  
Sbjct: 121 DILTKSLGSSNSMNMVNATLEGLSRLKRAEDVAKLRGKSIEELLG 165


>gi|260432463|ref|ZP_05786434.1| ribosomal protein S5 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416291|gb|EEX09550.1| ribosomal protein S5 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 192

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 99/175 (56%), Positives = 128/175 (73%), Gaps = 1/175 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RNMI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RNMIRVQLREGRTLHHDIEGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV-VSSKSSSYSRDS 193
           +GS NP+N+IRAT + L+ +  PR VA RRG K + +  +R    + S+  + ++
Sbjct: 138 LGSQNPYNMIRATIDGLKKEQSPRSVAARRGKKVADILPKREDAPAASAQVAEEA 192


>gi|294085975|ref|YP_003552735.1| 30S ribosomal protein S5 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665550|gb|ADE40651.1| ribosomal protein S5 [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 189

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 98/192 (51%), Positives = 128/192 (66%), Gaps = 3/192 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+    Q  N       +  +++++V INRV+  + GGRRF F+ LVVVGD K + GF 
Sbjct: 1   MARNNDRQDRNAAR---EEPEMLEKLVGINRVAKVVKGGRRFGFAALVVVGDGKGRAGFG 57

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVPEA+RKATE AKRNM+ + L DGRTLHHD  G +GAGKV++R+A AGTG+IAG
Sbjct: 58  TGKAREVPEAIRKATEGAKRNMVRIPLRDGRTLHHDIKGGYGAGKVLLRAAQAGTGIIAG 117

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV EVLG+ D+VAKSIGSSNPHN+I+ATF  L+    PR VA +RG +   +  +R
Sbjct: 118 GPMRAVFEVLGIQDIVAKSIGSSNPHNMIKATFSALKHIQAPRAVAQKRGKRVGDVLGKR 177

Query: 181 VVSSKSSSYSRD 192
                    +  
Sbjct: 178 ADKGAGDEAAAS 189


>gi|99080112|ref|YP_612266.1| 30S ribosomal protein S5 [Ruegeria sp. TM1040]
 gi|259416516|ref|ZP_05740436.1| ribosomal protein S5 [Silicibacter sp. TrichCH4B]
 gi|123379125|sp|Q1GK12|RS5_SILST RecName: Full=30S ribosomal protein S5
 gi|99036392|gb|ABF63004.1| SSU ribosomal protein S5P [Ruegeria sp. TM1040]
 gi|259347955|gb|EEW59732.1| ribosomal protein S5 [Silicibacter sp. TrichCH4B]
          Length = 187

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 97/170 (57%), Positives = 123/170 (72%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RQMIRVPLKEGRTLHHDMYGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGIKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
           +GS NP+N+IRAT + L+ +  PR VA RRG K + +  +R  +   +  
Sbjct: 138 VGSQNPYNMIRATIDGLKKEQSPRSVAQRRGKKVADILPKRDEAPAEAEA 187


>gi|329114201|ref|ZP_08242963.1| 30S ribosomal protein S5 [Acetobacter pomorum DM001]
 gi|326696277|gb|EGE47956.1| 30S ribosomal protein S5 [Acetobacter pomorum DM001]
          Length = 191

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 100/190 (52%), Positives = 135/190 (71%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R      + RE   + +VD++V INRV+  + GGRRFAF+ LVVVGD K +VG+ 
Sbjct: 1   MAREPREGGRGGREREREGDELVDKLVTINRVAKVVKGGRRFAFAALVVVGDQKGRVGYG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVPEA+RKATE AKR MI V + +GRTLHHD  G  GAGKV++RSA AGTG+IAG
Sbjct: 61  AGKAREVPEAIRKATERAKRGMIRVPMKEGRTLHHDVAGHFGAGKVVLRSAEAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG++DVVAKS+G+ NPHN+++ATF+ L   + PR VA+RRG K + +  +R
Sbjct: 121 GPMRAVFESLGINDVVAKSLGTRNPHNMVKATFDALARCASPRSVASRRGKKVAEIFGKR 180

Query: 181 VVSSKSSSYS 190
             +  + +  
Sbjct: 181 EQAVAAEAAD 190


>gi|148263156|ref|YP_001229862.1| 30S ribosomal protein S5 [Geobacter uraniireducens Rf4]
 gi|146396656|gb|ABQ25289.1| SSU ribosomal protein S5P [Geobacter uraniireducens Rf4]
          Length = 162

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 79/158 (50%), Positives = 109/158 (68%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                D ++ DR+V I+RV+  + GGRRF+FS LVVVGD    VG+    A EVPEA+RK
Sbjct: 3   KINPNDINLTDRVVHISRVAKVVKGGRRFSFSALVVVGDGNGYVGYGLGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V +++G+T+  +  GR GAGKV+M  A AGTGVIAGGA RAV E  G+H
Sbjct: 63  GVEQAKKNLIKVPIVEGQTIPFEIEGRFGAGKVLMMPASAGTGVIAGGAARAVFESAGVH 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGI 171
           +++AK +GS+NPHNV++A F  L     P +++ RRG+
Sbjct: 123 NILAKCLGSNNPHNVVKAAFAGLMRLKTPEELSARRGL 160


>gi|308070958|ref|YP_003872563.1| 30S ribosomal protein S5 [Paenibacillus polymyxa E681]
 gi|305860237|gb|ADM72025.1| 30S ribosomal protein S5 [Paenibacillus polymyxa E681]
          Length = 165

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 101/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD    VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTERVVNINRVAKVVKGGRRFSFSALVVVGDGNGWVGAGIGKAGEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ V L+ G T+ H   G+ GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLVHVPLV-GTTIPHLVTGKFGAGRVLLKPASEGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L       +VA  RG     L  
Sbjct: 121 DILTKSLGSSNSMNMVNATLEGLSRLKRAEEVAKLRGKSIEELLG 165


>gi|258542044|ref|YP_003187477.1| 30S ribosomal protein S5 [Acetobacter pasteurianus IFO 3283-01]
 gi|256633122|dbj|BAH99097.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636179|dbj|BAI02148.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639234|dbj|BAI05196.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642288|dbj|BAI08243.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645343|dbj|BAI11291.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648398|dbj|BAI14339.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651451|dbj|BAI17385.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654442|dbj|BAI20369.1| SSU ribosomal protein S5P [Acetobacter pasteurianus IFO 3283-12]
          Length = 191

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 100/181 (55%), Positives = 132/181 (72%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R      + RE   + +VD++V INRV+  + GGRRFAF+ LVVVGD K +VG+ 
Sbjct: 1   MAREPREGGRGGREREREGDELVDKLVTINRVAKVVKGGRRFAFAALVVVGDQKGRVGYG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVPEA+RKATE AKR MI V + +GRTLHHD  G  GAGKV++RSA AGTG+IAG
Sbjct: 61  AGKAREVPEAIRKATERAKRGMIRVPMKEGRTLHHDVAGHFGAGKVVLRSAEAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG++DVVAKS+G+ NPHN+++ATF+ L   + PR VA+RRG K + +  +R
Sbjct: 121 GPMRAVFESLGINDVVAKSLGTRNPHNMVKATFDALTRCASPRSVASRRGKKVAEIFGKR 180

Query: 181 V 181
            
Sbjct: 181 E 181


>gi|237806892|ref|YP_002891332.1| 30S ribosomal protein S5 [Tolumonas auensis DSM 9187]
 gi|259495317|sp|C4L7U7|RS5_TOLAT RecName: Full=30S ribosomal protein S5
 gi|237499153|gb|ACQ91746.1| ribosomal protein S5 [Tolumonas auensis DSM 9187]
          Length = 166

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E +   + +++VA+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   KIESQAGELQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGSGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM+ V L++G   HH   G H    V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEQARRNMVKVELIEGTLHHH-VKGTHAGSTVFMQPASQGTGIIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK+ GS+NP NV+RAT E L     P  VA +RG++   +  
Sbjct: 122 NVLAKTYGSTNPMNVVRATIEALADIKSPEQVAAKRGLRVEEILG 166


>gi|296395271|ref|YP_003660155.1| 30S ribosomal protein S5 [Segniliparus rotundus DSM 44985]
 gi|296182418|gb|ADG99324.1| ribosomal protein S5 [Segniliparus rotundus DSM 44985]
          Length = 217

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 75/182 (41%), Positives = 111/182 (60%), Gaps = 1/182 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +E+     ++R+VA+NRV+  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A+ K
Sbjct: 37  PQEKEKKDHIERLVAVNRVAKVVKGGRRFSFTALVIVGDGKGHVGAGYGKAKEVPAAIAK 96

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+H
Sbjct: 97  GVEEARKNFFRVPLI-GATIPHPTQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGVH 155

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           DV+AKS+G+ N  NV+ AT   L+S   P +VA RRG+    +    ++ ++  +    +
Sbjct: 156 DVLAKSMGTDNAINVVHATIAALKSLKRPEEVAARRGLPLEDVAPAGLLRARERALQEAA 215

Query: 194 KN 195
            +
Sbjct: 216 HS 217


>gi|314969892|gb|EFT13990.1| ribosomal protein S5 [Propionibacterium acnes HL037PA1]
          Length = 215

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/177 (45%), Positives = 111/177 (62%), Gaps = 1/177 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
             R +  +R    N  ++R+VAINRV+  + GGRRF+F+ LVVVGD +  VG  +  A+E
Sbjct: 19  DNRRDQNDRNRNQNEYLERVVAINRVAKVVQGGRRFSFTALVVVGDGEGSVGVGYGKAKE 78

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP A+ KA E AK++   V L+ GRT+ H  +G   AG V++R A  GTGVIAGG+ RAV
Sbjct: 79  VPAAIAKAVEEAKKHFFKVPLV-GRTITHPVIGEKAAGVVMLRPASPGTGVIAGGSARAV 137

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
            E  G+HDV+AKS+GSSN  NV+ AT + L+    P +VA RRG     +    ++ 
Sbjct: 138 LECAGVHDVLAKSLGSSNAINVVHATVDALQQLEEPEEVARRRGKSVEDIAPAAMLR 194


>gi|296268567|ref|YP_003651199.1| 30S ribosomal protein S5 [Thermobispora bispora DSM 43833]
 gi|296091354|gb|ADG87306.1| ribosomal protein S5 [Thermobispora bispora DSM 43833]
          Length = 210

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/163 (43%), Positives = 104/163 (63%), Gaps = 1/163 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
           S ++R+V INRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E AK+
Sbjct: 32  SYIERVVKINRVAKVVKGGRRFSFTALVVVGDGNGLVGVGYGKAKEVPAAIAKGVEEAKK 91

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           +   V  +   T+ H  +G   AG V++R A  GTGVIAGG +RAV E  G+HDV++KS+
Sbjct: 92  HFFRVPRI-QGTIPHAVIGEEAAGVVLLRPASPGTGVIAGGPVRAVLECAGIHDVLSKSL 150

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
           GS NP N++ AT + L+S + P ++A RRG+    +    ++ 
Sbjct: 151 GSDNPINIVHATVKALKSLNRPEEIAARRGLPLEEVAPAAMLR 193


>gi|33519675|ref|NP_878507.1| 30S ribosomal subunit protein S5 [Candidatus Blochmannia
           floridanus]
 gi|73919044|sp|Q7VQD1|RS5_BLOFL RecName: Full=30S ribosomal protein S5
 gi|33517338|emb|CAD83723.1| 30S ribosomal subunit protein S5 [Candidatus Blochmannia
           floridanus]
          Length = 177

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 69/165 (41%), Positives = 107/165 (64%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + ++++ +NRVS  + GGR F+F+ L VVG+   +VGF +  AREVP A++KA E A+ 
Sbjct: 13  ELQEKLITVNRVSKTVKGGRVFSFAALTVVGNVNGRVGFGYGKAREVPSAIQKAMEKARH 72

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           NMI + L  GRTL H  +G +   ++ M+ A  GTG+IAGGA+RA+ EV+G+H+V+AK+ 
Sbjct: 73  NMIDIPLNPGRTLQHSIIGIYTGARIYMKPASEGTGIIAGGAMRAILEVVGIHNVLAKAY 132

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSK 185
           GS+NP N++RAT   L++   P  VA +RG     +      + +
Sbjct: 133 GSTNPINIVRATVNALKNMKSPEMVAEKRGKSLEYILNNYTYNGR 177


>gi|308048008|ref|YP_003911574.1| 30S ribosomal protein S5P [Ferrimonas balearica DSM 9799]
 gi|307630198|gb|ADN74500.1| SSU ribosomal protein S5P [Ferrimonas balearica DSM 9799]
          Length = 166

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E +   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIENQAGDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM +VSL +  TLHH   GRH   KV M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEKARRNMYTVSLKN-GTLHHPVKGRHSGSKVYMQPASEGTGIIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK+ GS+NP N++R+T + L +   P  +A +RG+    ++ 
Sbjct: 122 NVLAKAYGSTNPINIVRSTVDALVNMKSPEQIAAKRGLPVDEIRG 166


>gi|126728188|ref|ZP_01744004.1| 30S ribosomal protein S5 [Sagittula stellata E-37]
 gi|126711153|gb|EBA10203.1| 30S ribosomal protein S5 [Sagittula stellata E-37]
          Length = 192

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 103/194 (53%), Positives = 134/194 (69%), Gaps = 3/194 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++  + +     E       DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MAERDNRRGNRRDRDET--PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR M+ V L +GRTLHHD  GRHGAG+V+MR+A  GTG+IAG
Sbjct: 59  KGKAKEVPEAIRKATEQAKRKMMRVPLKEGRTLHHDITGRHGAGRVVMRTAPQGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+HDVVAKS GS NP+N+IRAT E L  +  PR+VA RRG K + +  +R
Sbjct: 119 GPMRAVFEMLGVHDVVAKSTGSQNPYNMIRATLEGLSKEQSPRNVAQRRGKKVADILPKR 178

Query: 181 -VVSSKSSSYSRDS 193
                 SS  + ++
Sbjct: 179 DEAPQDSSQVAEEA 192


>gi|187933948|ref|YP_001884490.1| 30S ribosomal protein S5 [Clostridium botulinum B str. Eklund 17B]
 gi|188590652|ref|YP_001919689.1| 30S ribosomal protein S5 [Clostridium botulinum E3 str. Alaska E43]
 gi|251779908|ref|ZP_04822828.1| 30S ribosomal protein S5 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|187722101|gb|ACD23322.1| 30S ribosomal protein S5 [Clostridium botulinum B str. Eklund 17B]
 gi|188500933|gb|ACD54069.1| 30S ribosomal protein S5 [Clostridium botulinum E3 str. Alaska E43]
 gi|243084223|gb|EES50113.1| 30S ribosomal protein S5 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 165

 Score =  175 bits (444), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 98/165 (59%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGR F FS LVVVGD    VG     + E+PEA++K
Sbjct: 2   RIDPSTLDLKEKVVDINRVTKVVKGGRNFRFSALVVVGDENGHVGVGMGKSIEIPEAIKK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ V++L G T+ H   G+ G G V++  A  GTGVIAGG  R+V E+ G+ 
Sbjct: 62  GIEDAKKNLVEVAML-GTTVPHQINGKFGTGNVLIMPAKQGTGVIAGGPARSVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N+++AT   L S     D+A  RG     +  
Sbjct: 121 DVRAKSLGSNNPKNMVKATINGLASLRTAEDIAKLRGKSVEEILG 165


>gi|307244764|ref|ZP_07526865.1| ribosomal protein S5 [Peptostreptococcus stomatis DSM 17678]
 gi|306491862|gb|EFM63914.1| ribosomal protein S5 [Peptostreptococcus stomatis DSM 17678]
          Length = 169

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 101/166 (60%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R++ I RV+  + GGR F F+ LVVVGD+   VG     A EVP+A+R
Sbjct: 5   KPIDASQFDLEERVIEIRRVAKVVKGGRNFRFAALVVVGDSNGHVGIGTGKAMEVPDAIR 64

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA + AK+N+I+V  + G T+ H+ VG  GAGK+++  A  GTGV+AGG +RAV E+ G+
Sbjct: 65  KAVDDAKKNLITVPRV-GTTIPHEVVGHFGAGKILIMPAQEGTGVLAGGPVRAVLELAGI 123

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV AKS GS+NP N++ AT   L+       +A  RG K   L  
Sbjct: 124 SDVRAKSTGSNNPRNMVNATMAGLKDIKTAESIARLRGKKVEDLLG 169


>gi|86739312|ref|YP_479712.1| 30S ribosomal protein S5 [Frankia sp. CcI3]
 gi|123724245|sp|Q2JFF9|RS5_FRASC RecName: Full=30S ribosomal protein S5
 gi|86566174|gb|ABD09983.1| SSU ribosomal protein S5P [Frankia sp. CcI3]
          Length = 202

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 75/174 (43%), Positives = 110/174 (63%), Gaps = 1/174 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           +  N+ V+R+VAINRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E
Sbjct: 29  QEKNAYVERVVAINRVAKVVKGGRRFSFTALVVVGDADGTVGVGYGKAKEVPAAIAKGVE 88

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++   V  + G T+ H   G   AG V+++ A  GTGVIAGG +RAV E  G+HDV+
Sbjct: 89  EAKKHFFKVPRI-GSTIPHPVQGEEAAGVVLLKPASPGTGVIAGGPVRAVLECAGVHDVL 147

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +KS+GSSNP N++ AT   LR    P ++A RRG+    +    ++ ++++  S
Sbjct: 148 SKSLGSSNPINIVHATVAALRGLMRPEEIAARRGLPLEDVAPPAMLRARAAGAS 201


>gi|85374448|ref|YP_458510.1| 30S ribosomal protein S5 [Erythrobacter litoralis HTCC2594]
 gi|122544181|sp|Q2N9C8|RS5_ERYLH RecName: Full=30S ribosomal protein S5
 gi|84787531|gb|ABC63713.1| ribosomal protein S5 [Erythrobacter litoralis HTCC2594]
          Length = 284

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 96/165 (58%), Positives = 126/165 (76%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           EE D+ I++++V INRVS  + GG+RF F+ LVVVGD + +VGF    AREVPEA++KAT
Sbjct: 104 EEEDDGIIEKLVHINRVSKTVKGGKRFGFAALVVVGDGQGRVGFGKGKAREVPEAIQKAT 163

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AA++ MI V+L +GRTLHHDG GR GAGKV +R+A  GTG+IAGG +RAV E LG+ DV
Sbjct: 164 AAARKKMIRVALKEGRTLHHDGNGRFGAGKVTVRTAPPGTGIIAGGPMRAVFESLGVADV 223

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           V KS+G+SNP+N+IRATF+ L+ Q+ P+ VA RRG K + L  R 
Sbjct: 224 VTKSVGTSNPYNMIRATFDALQDQTSPKSVAQRRGKKVADLLGRG 268


>gi|326332208|ref|ZP_08198488.1| ribosomal protein S5 [Nocardioidaceae bacterium Broad-1]
 gi|325949914|gb|EGD41974.1| ribosomal protein S5 [Nocardioidaceae bacterium Broad-1]
          Length = 204

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/185 (38%), Positives = 107/185 (57%), Gaps = 1/185 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N+     + ++++VAINRV+  + GGRRF+F+ LV+VGD +  VG  +  A+EVP A+ K
Sbjct: 21  NQSADKTAYIEKVVAINRVAKVVKGGRRFSFTALVIVGDGEGLVGVGYGKAKEVPAAIAK 80

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++   V  +   T+ H   G   AG V++R A  GTGVIAGG +RAV E  G+H
Sbjct: 81  GVEEAKKHFFRVPRI-QGTIPHPVQGEKAAGVVLLRPAAPGTGVIAGGPVRAVLECAGIH 139

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           DV++KS+GSSN  N++ AT E L+    P  VA RRG+    +    ++ +++       
Sbjct: 140 DVLSKSLGSSNQINIVHATVEALKMLEQPEAVAARRGLPVEDVAPEALLKAQAEVAESPK 199

Query: 194 KNKGG 198
                
Sbjct: 200 VEVSA 204


>gi|162456229|ref|YP_001618596.1| 30S ribosomal protein S5 [Sorangium cellulosum 'So ce 56']
 gi|161166811|emb|CAN98116.1| 30S ribosomal protein S5 [Sorangium cellulosum 'So ce 56']
          Length = 204

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 82/176 (46%), Positives = 114/176 (64%), Gaps = 1/176 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
            +  + +R++ INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  + 
Sbjct: 7   DEEKLKERVIHINRVAKVVKGGRRFSFSALVVVGDEAGHVGIGLGKANEVPEAIRKGNDQ 66

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++N+  + L DG T+ HD  G  GAGKV+++ A  GTGVIAGGA+RAV E  G+HDV++
Sbjct: 67  ARKNLFRIPL-DGVTIPHDSFGHVGAGKVLLKPASPGTGVIAGGAVRAVVESAGIHDVLS 125

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           KS+G+SNPHNV+ AT   LR    P  VA +R ++   L  +R  S+ ++   R S
Sbjct: 126 KSLGTSNPHNVVHATVAALRGLKSPESVAGKRSMQLDSLDYQRRGSTNTAGRRRAS 181


>gi|229917341|ref|YP_002885987.1| ribosomal protein S5 [Exiguobacterium sp. AT1b]
 gi|229468770|gb|ACQ70542.1| ribosomal protein S5 [Exiguobacterium sp. AT1b]
          Length = 166

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 106/164 (64%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+  + GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 2   RQLDVNMEQLEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAAK+NM+ V ++ G T+ H+  G  GAG+V M+ A  GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEAAKKNMVQVPMV-GTTIPHEITGVFGAGRVFMKPASEGTGVIAGGPVRAVLELAGV 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            D+++KS+GS+ P N++RAT + L       +VA  RG     L
Sbjct: 121 GDILSKSLGSNTPINIVRATVQGLTELKKAEEVAKLRGKSVEEL 164


>gi|326506396|dbj|BAJ86516.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 326

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 60/166 (36%), Positives = 92/166 (55%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +    +  ++   +R+V ++RV+  + GGR+ ++  LVVVGD K  VG     A+EV EA
Sbjct: 159 DMDRDQRPNDEFSERVVQVSRVTKVVKGGRQLSYRALVVVGDMKGHVGVGVGKAKEVSEA 218

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           + KA    +RN+++V L    T  H     +GA KV++R A  G+GV AGGA+R V E+ 
Sbjct: 219 ITKAAMNGRRNLVTVPLTKYCTFPHRAEANYGAAKVMLRPACPGSGVTAGGAVRVVLEMA 278

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K + S NP N  RAT +  +      DVA  RG+    L
Sbjct: 279 GVENALGKQLRSKNPLNNARATVKATQMMRQFSDVAAERGLPMEEL 324


>gi|163783351|ref|ZP_02178344.1| ribosomal protein S05 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881459|gb|EDP74970.1| ribosomal protein S05 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 206

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 74/186 (39%), Positives = 105/186 (56%), Gaps = 1/186 (0%)

Query: 2   AQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAH 61
           A  E  ++    +    +  + +R++  NR +    GGRRF+FS LVVVGD +  VGF H
Sbjct: 8   AMIEERRKRYGVSDMIEELQLEERLIYANRTARVTKGGRRFSFSTLVVVGDKRGFVGFGH 67

Query: 62  STAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGG 121
             A+EVP A+ KA E AK+ +I V +++  T+ HD VG  G  K+I+  A  GTGV+AGG
Sbjct: 68  GKAKEVPLAIAKAIEQAKKKIIRVPIIE-GTVPHDVVGHFGPTKIIIMPARRGTGVVAGG 126

Query: 122 AIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           A + V E+ G  DV+ K IGS+ P NV+RA F+       P  VA  RG+    +Q R  
Sbjct: 127 AAKPVFELAGYTDVLTKIIGSTTPDNVVRAVFDAFLQLKTPEQVAEERGLPLEEVQKRFS 186

Query: 182 VSSKSS 187
           V +   
Sbjct: 187 VYANPK 192


>gi|299143177|ref|ZP_07036257.1| ribosomal protein S5 [Peptoniphilus sp. oral taxon 386 str. F0131]
 gi|298517662|gb|EFI41401.1| ribosomal protein S5 [Peptoniphilus sp. oral taxon 386 str. F0131]
          Length = 168

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 74/168 (44%), Positives = 100/168 (59%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                   +  + +R+VAINRV+  + GGR F FS LVVVGD    VG     A EVPEA
Sbjct: 2   ERSLINAAELDLEERVVAINRVAKVVKGGRNFRFSALVVVGDHNGHVGVGTGKALEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA + AK+++I V+LLD  ++ H   G  GAG+V ++ A AGTGVIAGGA+RAVCE+ 
Sbjct: 62  IRKAVQDAKKHLIEVNLLD-TSIPHQVTGVVGAGRVFLKPAHAGTGVIAGGAVRAVCELA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ D+  K++GS+NP N + AT E L        VA  R      +  
Sbjct: 121 GISDIRTKNLGSNNPRNTVNATIEALSQLKTAEKVARLRNKSVDEILG 168


>gi|297618367|ref|YP_003703526.1| ribosomal protein S5 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146204|gb|ADI02961.1| ribosomal protein S5 [Syntrophothermus lipocalidus DSM 12680]
          Length = 167

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 80/164 (48%), Positives = 111/164 (67%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +E+    I +R+VAI RV+  + GGRRF+FS +VVVGD K  VG     A EVPEA+RK
Sbjct: 3   EKEQEGREISERVVAIRRVAKVVKGGRRFSFSAVVVVGDGKGNVGAGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NMI+V L+D RT+ H  +GR GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  GIEDAKKNMIAVPLIDERTIPHPIIGRFGAGEVLLKPAAPGTGVIAGGPVRAVLELAGIK 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D++ KS+GSSN +N++RAT E L++     +VA  RG     + 
Sbjct: 123 DILTKSLGSSNANNMVRATIEALKNLKKAEEVARLRGKAVEEII 166


>gi|323136103|ref|ZP_08071186.1| ribosomal protein S5 [Methylocystis sp. ATCC 49242]
 gi|322399194|gb|EFY01713.1| ribosomal protein S5 [Methylocystis sp. ATCC 49242]
          Length = 190

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 112/181 (61%), Positives = 139/181 (76%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++    R   ++R+ERD+  VDR+V INRV+  + GGRRF F+ LVVVGD K +VG+ 
Sbjct: 1   MARETEGGRGRDRDRDERDSEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGYG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATEAAKR +I V L +GRTLHHD  GRHGAG+V++R+A AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATEAAKRALIRVPLREGRTLHHDVYGRHGAGRVVLRAAPAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LGMHDVVAKS GSSNP+N+IRATF+ L  +  PR VA RR +K S LQ+RR
Sbjct: 121 GPMRAVFETLGMHDVVAKSQGSSNPYNMIRATFDALGREDSPRSVAARRSLKVSALQSRR 180

Query: 181 V 181
            
Sbjct: 181 Q 181


>gi|88704358|ref|ZP_01102072.1| 30S ribosomal protein S5 [Congregibacter litoralis KT71]
 gi|88701409|gb|EAQ98514.1| 30S ribosomal protein S5 [Congregibacter litoralis KT71]
          Length = 168

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 80/166 (48%), Positives = 111/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            +++++D  + +++V +NRV+  + GGR F F+ L VVGD K +VGF    AREVP A++
Sbjct: 4   NDQKQQDGDLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGKGRVGFGRGKAREVPVAIQ 63

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +  T+ +    RHGA KV M+ A  GTGVIAGGA+RAV E+ G+
Sbjct: 64  KAMEAARRNMIQVDLDN-GTIQYPIKARHGASKVYMQPASEGTGVIAGGAMRAVLEIAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V+AK  GS+NP NV+RATF  LR  + P  VA +RG     +  
Sbjct: 123 HNVLAKCYGSTNPVNVVRATFNGLRDMASPESVAAKRGKSVEEIYG 168


>gi|291521884|emb|CBK80177.1| SSU ribosomal protein S5P [Coprococcus catus GD/7]
          Length = 169

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 93/168 (55%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KRTIIDASQLELTEKVVSIKRVTKVVKGGRNMRFAALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +I V L +  ++ HD +G+ G   V+++ A  GTG+IAGG  R V E+ 
Sbjct: 62  IRKGKEDAIKKLIEVPLDENLSITHDNLGKFGGASVLLKRAPQGTGIIAGGPARNVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G  ++  KS+GS+N  NV+ AT E L +   P +VA +RG     +  
Sbjct: 122 GYKNIRTKSLGSNNKQNVVLATIEGLSNLVTPEEVAKKRGKSIEEILG 169


>gi|288917247|ref|ZP_06411616.1| ribosomal protein S5 [Frankia sp. EUN1f]
 gi|288351438|gb|EFC85646.1| ribosomal protein S5 [Frankia sp. EUN1f]
          Length = 202

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 73/174 (41%), Positives = 108/174 (62%), Gaps = 1/174 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           +   + V+R+VAINRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E
Sbjct: 29  QEKTAYVERVVAINRVAKVVKGGRRFSFTALVVVGDADGTVGVGYGKAKEVPAAIAKGVE 88

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++   V  + G T+ H   G   AG V+++ A  GTGVIAGG +RAV E  G+HDV+
Sbjct: 89  EAKKHFFKVPRI-GSTIPHPVQGEDAAGVVLLKPASPGTGVIAGGPVRAVLECAGVHDVL 147

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +KS+GSSNP N++ AT   LR    P ++A RRG+    +    ++ ++++   
Sbjct: 148 SKSLGSSNPINIVHATVAALRGLMRPEEIAARRGLPLEDVAPPAMLRARAAGVG 201


>gi|238810280|dbj|BAH70070.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 239

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 62/175 (35%), Positives = 108/175 (61%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           ++ ++RD   + +  DN   +++V I+RV+  + GGRRF+F+  VVVGD K +VGF H  
Sbjct: 65  EKGNRRDRRNHFDASDNEFSEKVVNISRVTKVVKGGRRFSFAAFVVVGDKKGRVGFGHGK 124

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EVP++++KA + AK ++I+V + +  T+ H+   +  A +V+++    G G++A G +
Sbjct: 125 ANEVPDSIKKAVKDAKNHLITVPIQNKITVPHEVHAKFLASRVMLKPDTKGKGIVASGTV 184

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           RAV E+ G  D+  K+ GS +  N++RAT + L++   P  +A+ RG     L A
Sbjct: 185 RAVVELAGYTDIYTKTYGSRSKANIVRATLKALQALRTPEQIADIRGKDVKDLLA 239


>gi|220921916|ref|YP_002497217.1| 30S ribosomal protein S5 [Methylobacterium nodulans ORS 2060]
 gi|254765694|sp|B8ISA2|RS5_METNO RecName: Full=30S ribosomal protein S5
 gi|219946522|gb|ACL56914.1| ribosomal protein S5 [Methylobacterium nodulans ORS 2060]
          Length = 191

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 107/174 (61%), Positives = 133/174 (76%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VDR+V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAK
Sbjct: 18  SEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R ++ V+L +GRTLHHD  GRHGAGKVI+R+A  GTG+IAGG +RAV E LGM DVVAKS
Sbjct: 78  RGLVRVALREGRTLHHDVAGRHGAGKVILRAAPQGTGIIAGGPMRAVFESLGMQDVVAKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           +GSSNP+N+IRATF+ L+ +  PR VA RRG+K S LQARR  +   +  +  +
Sbjct: 138 LGSSNPYNLIRATFDALKREDSPRAVAARRGLKVSTLQARRRDAEPGADAADAA 191


>gi|238898910|ref|YP_002924592.1| 30S ribosomal subunit protein S5 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229466670|gb|ACQ68444.1| 30S ribosomal subunit protein S5 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 169

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +E+    + ++++ +NRVS  + GGR F+F+ L VVGD K +VGF ++ AREVP A++K
Sbjct: 5   EKEKHAGELQEKLIDVNRVSKTVKGGRIFSFTALTVVGDGKGRVGFGYAKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI++SL +  TL +     H   +V M+ A  GTG+IAGGA+R++ EV G+H
Sbjct: 65  AIEKARRNMITISL-NADTLQYSIKASHTGSQVFMQPASEGTGIIAGGAMRSLLEVAGIH 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           DV+AK  GS+NP NV+RAT + L+    P  +A +RG     +  +
Sbjct: 124 DVLAKIYGSTNPINVVRATIKALKDMKSPEMIAAKRGKSLEEILGK 169


>gi|295106934|emb|CBL04477.1| SSU ribosomal protein S5P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 176

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 71/172 (41%), Positives = 108/172 (62%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N Q  +     + +R+V INRVS  + GGRRFA + LVVVGD   +VG     ++EVP 
Sbjct: 3   RNKQQNDAGVPELQERVVYINRVSKVVKGGRRFALTALVVVGDGNGRVGVGMGKSQEVPI 62

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++K  E AK+NM +V L   +TL H+ +G +GAG+V+++ A  GTGVIAGG +RA+ E+
Sbjct: 63  AIKKGVEDAKKNMFTVPLTPEKTLPHEIMGIYGAGRVLIKPATPGTGVIAGGPVRAIMEL 122

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
            G+ DV+ KS+G++N  N+++A  E L++   P  VA RR    + +   + 
Sbjct: 123 AGVTDVLTKSLGTNNAMNIVKAAAEGLKNMESPEQVAARRDTSVAKIYGWKE 174


>gi|92117115|ref|YP_576844.1| 30S ribosomal protein S5 [Nitrobacter hamburgensis X14]
 gi|122418089|sp|Q1QN13|RS5_NITHX RecName: Full=30S ribosomal protein S5
 gi|91800009|gb|ABE62384.1| SSU ribosomal protein S5P [Nitrobacter hamburgensis X14]
          Length = 190

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 109/191 (57%), Positives = 141/191 (73%), Gaps = 1/191 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA +      +   REERD+  VD++V INRV+  + GG+RF F+ LVV+GD K +VGF 
Sbjct: 1   MAGERERGGGHRGGREERDSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKRN+  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAG
Sbjct: 61  HGKAREVPEAIRKATESAKRNLTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKS+GSSNP+N+IRATF+ L+ Q  PR V+ RR IK S LQ+RR
Sbjct: 121 GPMRAVFETLGIQDVVAKSVGSSNPYNMIRATFDALKHQDSPRSVSARRNIKVSTLQSRR 180

Query: 181 VVSSKSSSYSR 191
           V    + + + 
Sbjct: 181 V-GGDAEAVAE 190


>gi|111220563|ref|YP_711357.1| 30S ribosomal protein S5 [Frankia alni ACN14a]
 gi|123044850|sp|Q0RRQ4|RS5_FRAAA RecName: Full=30S ribosomal protein S5
 gi|111148095|emb|CAJ59763.1| 30S ribosomal protein S5 [Frankia alni ACN14a]
          Length = 202

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 74/174 (42%), Positives = 109/174 (62%), Gaps = 1/174 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           +  N+ V+R+VAINRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E
Sbjct: 29  QEKNAYVERVVAINRVAKVVKGGRRFSFTALVVVGDADGTVGVGYGKAKEVPAAIAKGVE 88

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++   V  + G T+ H   G   AG V+++ A  GTGVIAGG +RAV E  G+HDV+
Sbjct: 89  EAKKHFFKVPRI-GSTIPHPVQGEEAAGVVLLKPASPGTGVIAGGPVRAVLECAGVHDVL 147

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +KS+GSSNP N++ AT   LR    P ++A RRG+    +    ++ ++++   
Sbjct: 148 SKSLGSSNPINIVHATVAALRGLMRPEEIAARRGLPLEDVAPPAMLRARAAGAG 201


>gi|146313368|ref|YP_001178442.1| 30S ribosomal protein S5 [Enterobacter sp. 638]
 gi|311277742|ref|YP_003939973.1| ribosomal protein S5 [Enterobacter cloacae SCF1]
 gi|189045414|sp|A4WFB1|RS5_ENT38 RecName: Full=30S ribosomal protein S5
 gi|145320244|gb|ABP62391.1| SSU ribosomal protein S5P [Enterobacter sp. 638]
 gi|308746937|gb|ADO46689.1| ribosomal protein S5 [Enterobacter cloacae SCF1]
          Length = 166

 Score =  174 bits (442), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NHGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILG 166


>gi|304405599|ref|ZP_07387258.1| ribosomal protein S5 [Paenibacillus curdlanolyticus YK9]
 gi|304345638|gb|EFM11473.1| ribosomal protein S5 [Paenibacillus curdlanolyticus YK9]
          Length = 165

 Score =  174 bits (441), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 102/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRVS  + GGRRF+FS LVVVGD K  VG     A EVP+A+RK
Sbjct: 2   RVDPNTLELTEKVVNINRVSKVVKGGRRFSFSALVVVGDGKGYVGAGIGKAAEVPDAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ V L+ G T+ H  +G  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKNLVHVPLV-GTTIPHQVIGHFGAGEVLLKPASQGTGVIAGGPVRAVLELAGVG 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GSSN  N++ AT E L       DVA  RG     L  
Sbjct: 121 DILTKSLGSSNSMNMVNATLEGLSRLKRAEDVAKLRGKTVQELLG 165


>gi|225571570|ref|ZP_03780566.1| hypothetical protein CLOHYLEM_07668 [Clostridium hylemonae DSM
           15053]
 gi|225159647|gb|EEG72266.1| hypothetical protein CLOHYLEM_07668 [Clostridium hylemonae DSM
           15053]
          Length = 169

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 98/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KQVRIDAGQLELNEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+I+V+L +  ++ HD +G+ G   V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAAKNLITVALDENDSITHDFIGKFGGASVLLKKAPDGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT + LR    P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIDGLRQLKTPEEVAKLRGKSVEEILG 169


>gi|126736622|ref|ZP_01752362.1| ribosomal protein S5 [Roseobacter sp. CCS2]
 gi|126713935|gb|EBA10806.1| ribosomal protein S5 [Roseobacter sp. CCS2]
          Length = 200

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 103/189 (54%), Positives = 132/189 (69%), Gaps = 2/189 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++ ++    +  E       DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MAERDNNRGGRGRRDET--PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V+L DGRTLHHD  GRHGAGKV+MR+A  GTG+IAG
Sbjct: 59  KGKAKEVPEAIRKATEQAKRQMIRVALRDGRTLHHDIEGRHGAGKVVMRTAPVGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVV+KSIGS NP+N+IRAT   L  +  PR+VA RRG K + +  +R
Sbjct: 119 GPMRAVFEMLGVQDVVSKSIGSQNPYNMIRATMNGLGKEQSPRNVAQRRGKKVADILPKR 178

Query: 181 VVSSKSSSY 189
               + S  
Sbjct: 179 ETVDEQSDV 187


>gi|282855191|ref|ZP_06264523.1| ribosomal protein S5 [Propionibacterium acnes J139]
 gi|282581779|gb|EFB87164.1| ribosomal protein S5 [Propionibacterium acnes J139]
 gi|314924167|gb|EFS87998.1| ribosomal protein S5 [Propionibacterium acnes HL001PA1]
 gi|314965077|gb|EFT09176.1| ribosomal protein S5 [Propionibacterium acnes HL082PA2]
 gi|314982269|gb|EFT26362.1| ribosomal protein S5 [Propionibacterium acnes HL110PA3]
 gi|315090456|gb|EFT62432.1| ribosomal protein S5 [Propionibacterium acnes HL110PA4]
 gi|315093691|gb|EFT65667.1| ribosomal protein S5 [Propionibacterium acnes HL060PA1]
 gi|315103984|gb|EFT75960.1| ribosomal protein S5 [Propionibacterium acnes HL050PA2]
 gi|327326694|gb|EGE68480.1| ribosomal protein S5 [Propionibacterium acnes HL103PA1]
          Length = 215

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 1/177 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
             R    +R    N  ++R+VAINRV+  + GGRRF+F+ LVVVGD +  VG  +  A+E
Sbjct: 19  DNRRGQNDRNRNQNEYLERVVAINRVAKVVQGGRRFSFTALVVVGDGEGSVGVGYGKAKE 78

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP A+ KA E AK++   V L+ GRT+ H  +G   AG V++R A  GTGVIAGG+ RAV
Sbjct: 79  VPAAIAKAVEEAKKHFFKVPLV-GRTITHPVIGEKAAGIVMLRPASPGTGVIAGGSARAV 137

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
            E  G+HDV+AKS+GSSN  NV+ AT + L+    P +VA RRG     +    ++ 
Sbjct: 138 LECAGVHDVLAKSLGSSNAINVVHATVDALQQLEEPEEVARRRGKSVEEIAPAAMLR 194


>gi|225376425|ref|ZP_03753646.1| hypothetical protein ROSEINA2194_02067 [Roseburia inulinivorans DSM
           16841]
 gi|225211801|gb|EEG94155.1| hypothetical protein ROSEINA2194_02067 [Roseburia inulinivorans DSM
           16841]
          Length = 169

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 61/168 (36%), Positives = 93/168 (55%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + D++V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KREIIDASQLELNDKVVSIKRVTKVVKGGRNMRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +ISV L +  ++ HD  G+     V+++ +  GTG+IAGG  R VCE+ 
Sbjct: 62  IRKGKEDAMKKLISVKLDEVDSITHDVQGKFTGASVLLKKSPEGTGIIAGGPARTVCELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT + L     P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVFATIDALGQLKSPEEVAKLRGKSVEEILG 169


>gi|218282154|ref|ZP_03488453.1| hypothetical protein EUBIFOR_01035 [Eubacterium biforme DSM 3989]
 gi|218216833|gb|EEC90371.1| hypothetical protein EUBIFOR_01035 [Eubacterium biforme DSM 3989]
          Length = 169

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/178 (42%), Positives = 110/178 (61%), Gaps = 9/178 (5%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA   + +RD             +++++INRV+  + GGRRF F+ LVVVGD K +VG  
Sbjct: 1   MAMDRKPRRDQK--------EFEEQVISINRVTKVVKGGRRFRFAALVVVGDRKGRVGVG 52

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A EVP+A++KA E AK+N+ +V ++ G T+ H+  GR+GAG V MR A+ GTGVIAG
Sbjct: 53  TGKANEVPDAIKKAVEDAKKNIFTVPVI-GTTIPHEITGRYGAGSVYMRPAIEGTGVIAG 111

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GA RA+ E+ G+ D++ K +GS    NV+RAT + L++      VA  RG K   ++ 
Sbjct: 112 GATRAILELAGISDILTKCLGSRTKINVVRATVDGLQNLRTVESVAALRGKKPEEIRG 169


>gi|33357882|pdb|1P6G|E Chain E, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 gi|33357959|pdb|1P87|E Chain E, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754043|pdb|2AVY|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|83754099|pdb|2AW7|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 gi|118138057|pdb|2I2P|E Chain E, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138128|pdb|2I2U|E Chain E, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|157836027|pdb|2QOU|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|157836078|pdb|2QOW|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|157836131|pdb|2QOY|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|157836182|pdb|2QP0|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|158429702|pdb|2QAL|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429754|pdb|2QAN|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429812|pdb|2QB9|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429864|pdb|2QBB|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429916|pdb|2QBD|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429968|pdb|2QBF|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158430022|pdb|2QBH|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158430075|pdb|2QBJ|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431375|pdb|2Z4K|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431428|pdb|2Z4M|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|168988792|pdb|2VHO|E Chain E, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 gi|168988813|pdb|2VHP|E Chain E, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 gi|197107282|pdb|3DF1|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|197107334|pdb|3DF3|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|329665996|pdb|3J00|E Chain E, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
          Length = 166

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 4   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 63

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 64  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 122

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  +
Sbjct: 123 LAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK 166


>gi|149922195|ref|ZP_01910633.1| ribosomal protein S5 [Plesiocystis pacifica SIR-1]
 gi|149816935|gb|EDM76420.1| ribosomal protein S5 [Plesiocystis pacifica SIR-1]
          Length = 166

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 83/159 (52%), Positives = 106/159 (66%), Gaps = 1/159 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            +VDR+V INRV+  + GGRRFAFS LVVVG+    VG+ +  AREVPEA+RKA + A++
Sbjct: 9   DLVDRVVDINRVAKVVKGGRRFAFSALVVVGNENGWVGYGYGKAREVPEAIRKANDIARK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+  V L  G T+ H  VG  GAG+V++  A  GTGVIAGGA+RAV E  G+HDV+ K I
Sbjct: 69  NLFQVPL-QGATIPHRIVGHFGAGEVLLVPASPGTGVIAGGAVRAVVECAGIHDVLTKCI 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           GS+NP NVI AT   L+    P  VA RRG+  S +   
Sbjct: 128 GSNNPLNVIHATVTALKGLRSPEQVARRRGMTVSQMMEA 166


>gi|317050545|ref|YP_004111661.1| 30S ribosomal protein S5 [Desulfurispirillum indicum S5]
 gi|316945629|gb|ADU65105.1| ribosomal protein S5 [Desulfurispirillum indicum S5]
          Length = 167

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 74/167 (44%), Positives = 107/167 (64%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
                     + D+I+ I RV+  + GGRRF+F+ LVVVGD    VG A   AREVPEA+
Sbjct: 2   RDEIRSEQPELQDKIIHIGRVAKVVKGGRRFSFTALVVVGDGNGSVGVAKGKAREVPEAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  E AK+NM++V L    T+  + +G+ G G+V+++ A  GTG+IAG A+RAV EV G
Sbjct: 62  RKGIEKAKKNMVTVPLRK-GTIPCEIIGKFGGGQVLLKPASEGTGIIAGSAVRAVLEVAG 120

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + ++++KS+GS+NP N+ +AT E LR+   P +VA  RGI    L+ 
Sbjct: 121 VTNILSKSLGSNNPQNMAKATIEGLRNLKSPEEVAEMRGIPVEQLRG 167


>gi|158317774|ref|YP_001510282.1| 30S ribosomal protein S5 [Frankia sp. EAN1pec]
 gi|226703348|sp|A8LB15|RS5_FRASN RecName: Full=30S ribosomal protein S5
 gi|158113179|gb|ABW15376.1| ribosomal protein S5 [Frankia sp. EAN1pec]
          Length = 202

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 73/174 (41%), Positives = 108/174 (62%), Gaps = 1/174 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           +   + V+R+VAINRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E
Sbjct: 29  QEKTAYVERVVAINRVAKVVKGGRRFSFTALVVVGDADGTVGVGYGKAKEVPAAIAKGVE 88

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++   V  + G T+ H   G   AG V+++ A  GTGVIAGG +RAV E  G+HDV+
Sbjct: 89  EAKKHFFKVPRI-GSTIPHPVQGEEAAGVVLLKPASPGTGVIAGGPVRAVLECAGVHDVL 147

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +KS+GSSNP N++ AT   LR    P ++A RRG+    +    ++ ++++   
Sbjct: 148 SKSLGSSNPINIVHATVAALRGLMRPEEIAARRGLPLEDVAPPAMLRARAAGVG 201


>gi|328958711|ref|YP_004376097.1| 30S ribosomal protein S5 [Carnobacterium sp. 17-4]
 gi|328675035|gb|AEB31081.1| 30S ribosomal protein S5 [Carnobacterium sp. 17-4]
          Length = 166

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 71/163 (43%), Positives = 103/163 (63%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + DR+V+INRV+  + GGRR  F+ +VVVGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPTHLELEDRVVSINRVTKVVKGGRRLRFAAIVVVGDKNGHVGFGTGKAQEVPEAIRKAI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A++N+I V ++D  T+ H  +GR   G ++++ A+AG+GV AGG +RAV E+ G+ DV
Sbjct: 65  EDARKNLIEVPMVD-TTIPHAVIGRFSGGNILIKPAVAGSGVSAGGPVRAVLELAGVADV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GSS P N+IRAT + L       +VA  RG     +  
Sbjct: 124 TSKSLGSSTPINMIRATVDGLLQLKRVEEVAKLRGKTVEEIIG 166


>gi|289548525|ref|YP_003473513.1| ribosomal protein S5 [Thermocrinis albus DSM 14484]
 gi|289182142|gb|ADC89386.1| ribosomal protein S5 [Thermocrinis albus DSM 14484]
          Length = 196

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 66/186 (35%), Positives = 108/186 (58%), Gaps = 1/186 (0%)

Query: 5   ERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTA 64
           +  +++      E    + +R++   R +    GG+RF+FS LV+VGD +  VGF    A
Sbjct: 11  DEKRKEQNIAELEDQLQLEERLIYAKRTTRVTKGGKRFSFSALVIVGDRRGFVGFGLGKA 70

Query: 65  REVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIR 124
           REVP A+ KA E  K+++I V ++D  T+ HD +G +G   V +  A  GTG++AGGA +
Sbjct: 71  REVPIAIAKAIEDGKKHIIRVPIVD-GTVPHDVIGHYGPTMVKVLPARRGTGIVAGGAAK 129

Query: 125 AVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSS 184
            + E+ G  DV+ K +GS+NP+NV+RA F+ L       +VA  RGI    L+ R  + +
Sbjct: 130 PIFELAGYTDVLTKILGSTNPNNVVRAVFDALLKLRSLEEVAAIRGIDPDELRKRYRLYA 189

Query: 185 KSSSYS 190
           + + ++
Sbjct: 190 RVAPWA 195


>gi|254483432|ref|ZP_05096661.1| ribosomal protein S5 [marine gamma proteobacterium HTCC2148]
 gi|214036306|gb|EEB76984.1| ribosomal protein S5 [marine gamma proteobacterium HTCC2148]
          Length = 171

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 79/167 (47%), Positives = 110/167 (65%), Gaps = 1/167 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           ++ + +++ +  + +++V +NRV+  + GGR F F+ L VVGD   KVGF    AREVP 
Sbjct: 4   NDQKKQQQTEGDLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGNGKVGFGRGKAREVPV 63

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++KA EAA+RNMI V L +  T+ +     HGA KV M+ A  GTGVIAGGA+RAV E+
Sbjct: 64  AIQKAMEAARRNMIQVDL-NNGTIQYPVKAAHGASKVYMQPASEGTGVIAGGAMRAVLEI 122

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            G+H+V+AK  GS+NP NV+RATF  LR    P DVA +RG     +
Sbjct: 123 AGVHNVLAKCYGSTNPVNVVRATFNGLRDMCAPEDVAAKRGKSVEEI 169


>gi|238922846|ref|YP_002936359.1| ribosomal protein S5 [Eubacterium rectale ATCC 33656]
 gi|238874518|gb|ACR74225.1| ribosomal protein S5 [Eubacterium rectale ATCC 33656]
 gi|291523747|emb|CBK89334.1| SSU ribosomal protein S5P [Eubacterium rectale DSM 17629]
 gi|291528787|emb|CBK94373.1| SSU ribosomal protein S5P [Eubacterium rectale M104/1]
          Length = 169

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 63/168 (37%), Positives = 97/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     +VD++V I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KREIIDASQLELVDQVVDIKRVTKVVKGGRNMRFTALVVVGDKNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A ++M++V L +  ++ HD  G++    V+++ +  GTG+IAGG  R+VCE+ 
Sbjct: 62  IRKGKEDAIKSMVNVKLDENNSITHDVTGKYTGASVLLKKSPEGTGIIAGGPARSVCEIA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E L+    P DVA  RG     +  
Sbjct: 122 GIQNIRTKSLGSNNKQNVVLATIEALKQLRSPEDVAKLRGKSVEEILG 169


>gi|266620246|ref|ZP_06113181.1| ribosomal protein S5 [Clostridium hathewayi DSM 13479]
 gi|288868149|gb|EFD00448.1| ribosomal protein S5 [Clostridium hathewayi DSM 13479]
          Length = 169

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 68/163 (41%), Positives = 97/163 (59%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D++VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 7   DASQLELNDKVVAIKRVSKTVKGGRTMRFSALVVVGDGNGHVGAGLGKAGEVPEAIRKGK 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           EAA +NM++V + +  ++ HD +G+ G+  V+++ A  GTG+IAGG  RAV E+ G+ ++
Sbjct: 67  EAAVKNMVTVPVDENSSIPHDLIGKFGSAAVLLKRAPEGTGIIAGGPARAVVELAGIKNI 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
             KS+GS+N  NV+ AT E L     P +VA  RG     +  
Sbjct: 127 RTKSLGSNNKTNVVLATIEGLTQLKTPEEVAKLRGKSVEEILG 169


>gi|119773371|ref|YP_926111.1| 30S ribosomal protein S5 [Shewanella amazonensis SB2B]
 gi|171704649|sp|A1S235|RS5_SHEAM RecName: Full=30S ribosomal protein S5
 gi|119765871|gb|ABL98441.1| SSU ribosomal protein S5P [Shewanella amazonensis SB2B]
          Length = 168

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++ + + ++++A+NRVS  + GGR F+F+ L VVGD   +VG+ +  AREVP A++K
Sbjct: 5   EAQQQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGRVGYGYGKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM++V L +  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 65  AMEKARRNMVTVEL-NEGTLHHPVKGRHTGSRVYMQPASQGTGIIAGGAMRAVLEVAGVH 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP N++RAT + L     P  VA +RG+    ++ 
Sbjct: 124 NVLSKAYGSTNPINIVRATVDALTHMKSPAQVAAKRGLSVEEIRG 168


>gi|15607861|ref|NP_215235.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis H37Rv]
 gi|15840129|ref|NP_335166.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis CDC1551]
 gi|31791907|ref|NP_854400.1| 30S ribosomal protein S5 [Mycobacterium bovis AF2122/97]
 gi|121636643|ref|YP_976866.1| 30S ribosomal protein S5 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660496|ref|YP_001282019.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis H37Ra]
 gi|167968279|ref|ZP_02550556.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis H37Ra]
 gi|215410278|ref|ZP_03419086.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425963|ref|ZP_03423882.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis T92]
 gi|215429562|ref|ZP_03427481.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis EAS054]
 gi|215444845|ref|ZP_03431597.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis T85]
 gi|218752371|ref|ZP_03531167.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis GM 1503]
 gi|219556570|ref|ZP_03535646.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis T17]
 gi|224989115|ref|YP_002643802.1| 30S ribosomal protein S5 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797664|ref|YP_003030665.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis KZN 1435]
 gi|254231041|ref|ZP_04924368.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis C]
 gi|254363667|ref|ZP_04979713.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549682|ref|ZP_05140129.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260185603|ref|ZP_05763077.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis CPHL_A]
 gi|260199731|ref|ZP_05767222.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis T46]
 gi|260203892|ref|ZP_05771383.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis K85]
 gi|289442122|ref|ZP_06431866.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis T46]
 gi|289446281|ref|ZP_06436025.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis CPHL_A]
 gi|289552978|ref|ZP_06442188.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis KZN 605]
 gi|289568665|ref|ZP_06448892.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis T17]
 gi|289573329|ref|ZP_06453556.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis K85]
 gi|289749228|ref|ZP_06508606.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis T92]
 gi|289752768|ref|ZP_06512146.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis EAS054]
 gi|289756809|ref|ZP_06516187.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis T85]
 gi|289760848|ref|ZP_06520226.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis GM 1503]
 gi|294993100|ref|ZP_06798791.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis 210]
 gi|297633220|ref|ZP_06951000.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis KZN 4207]
 gi|297730200|ref|ZP_06959318.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis KZN R506]
 gi|298524212|ref|ZP_07011621.1| ribosomal protein S5 [Mycobacterium tuberculosis 94_M4241A]
 gi|306774832|ref|ZP_07413169.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu001]
 gi|306781435|ref|ZP_07419772.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu002]
 gi|306783373|ref|ZP_07421695.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu003]
 gi|306787743|ref|ZP_07426065.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu004]
 gi|306794511|ref|ZP_07432813.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu005]
 gi|306796476|ref|ZP_07434778.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu006]
 gi|306802336|ref|ZP_07439004.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu008]
 gi|306806545|ref|ZP_07443213.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu007]
 gi|306966743|ref|ZP_07479404.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu009]
 gi|306970934|ref|ZP_07483595.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu010]
 gi|307078664|ref|ZP_07487834.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu011]
 gi|307083228|ref|ZP_07492341.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu012]
 gi|313657527|ref|ZP_07814407.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis KZN V2475]
 gi|54039517|sp|P66575|RS5_MYCBO RecName: Full=30S ribosomal protein S5
 gi|54041968|sp|P66574|RS5_MYCTU RecName: Full=30S ribosomal protein S5
 gi|189045422|sp|A1KGK2|RS5_MYCBP RecName: Full=30S ribosomal protein S5
 gi|189045424|sp|A5U0A7|RS5_MYCTA RecName: Full=30S ribosomal protein S5
 gi|254765697|sp|C1AL55|RS5_MYCBT RecName: Full=30S ribosomal protein S5
 gi|1806189|emb|CAB06445.1| PROBABLE 30S RIBOSOMAL PROTEIN S5 RPSE [Mycobacterium tuberculosis
           H37Rv]
 gi|13880280|gb|AAK44980.1| ribosomal protein S5 [Mycobacterium tuberculosis CDC1551]
 gi|31617494|emb|CAD93604.1| PROBABLE 30S RIBOSOMAL PROTEIN S5 RPSE [Mycobacterium bovis
           AF2122/97]
 gi|121492290|emb|CAL70757.1| Probable 30S ribosomal protein S5 rpsE [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|124600100|gb|EAY59110.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis C]
 gi|134149181|gb|EBA41226.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504648|gb|ABQ72457.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis H37Ra]
 gi|224772228|dbj|BAH25034.1| 30S ribosomal protein S5 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319167|gb|ACT23770.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis KZN 1435]
 gi|289415041|gb|EFD12281.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis T46]
 gi|289419239|gb|EFD16440.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis CPHL_A]
 gi|289437610|gb|EFD20103.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis KZN 605]
 gi|289537760|gb|EFD42338.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis K85]
 gi|289542419|gb|EFD46067.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis T17]
 gi|289689815|gb|EFD57244.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis T92]
 gi|289693355|gb|EFD60784.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis EAS054]
 gi|289708354|gb|EFD72370.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis GM 1503]
 gi|289712373|gb|EFD76385.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis T85]
 gi|298494006|gb|EFI29300.1| ribosomal protein S5 [Mycobacterium tuberculosis 94_M4241A]
 gi|308216721|gb|EFO76120.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu001]
 gi|308325737|gb|EFP14588.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu002]
 gi|308331866|gb|EFP20717.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu003]
 gi|308335653|gb|EFP24504.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu004]
 gi|308337110|gb|EFP25961.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu005]
 gi|308343135|gb|EFP31986.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu006]
 gi|308347022|gb|EFP35873.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu007]
 gi|308350906|gb|EFP39757.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu008]
 gi|308355596|gb|EFP44447.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu009]
 gi|308359555|gb|EFP48406.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu010]
 gi|308363459|gb|EFP52310.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu011]
 gi|308367098|gb|EFP55949.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis SUMu012]
 gi|323720848|gb|EGB29915.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis CDC1551A]
 gi|326905057|gb|EGE51990.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis W-148]
 gi|328457445|gb|AEB02868.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis KZN 4207]
          Length = 220

 Score =  174 bits (441), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/180 (41%), Positives = 110/180 (61%), Gaps = 1/180 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            R+   ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K
Sbjct: 34  ERDGEKSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAK 93

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A+++   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+H
Sbjct: 94  GVEEARKSFFRVPLI-GGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVH 152

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           D++AKS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S +  +
Sbjct: 153 DILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRKSEALAA 212


>gi|56551429|ref|YP_162268.1| 30S ribosomal protein S5 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761077|ref|ZP_04759166.1| ribosomal protein S5 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752957|ref|YP_003225850.1| 30S ribosomal protein S5 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|73919116|sp|Q5NQ48|RS5_ZYMMO RecName: Full=30S ribosomal protein S5
 gi|56543003|gb|AAV89157.1| ribosomal protein S5 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374696|gb|EER64157.1| ribosomal protein S5 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258552320|gb|ACV75266.1| ribosomal protein S5 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 233

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 96/166 (57%), Positives = 121/166 (72%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            EE    +++++V INRVS  + GG+RF F+ LVVVGD K +VGF H  AREVPEA+ KA
Sbjct: 52  NEEAGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRVGFGHGKAREVPEAISKA 111

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
           T AAK+ MI V L +GRTLHHDG GR GAG V +RSA +GTG+IAGG +RA+ E LG+ D
Sbjct: 112 TAAAKKTMIRVPLREGRTLHHDGRGRFGAGLVYLRSAPSGTGIIAGGPMRAIFESLGVAD 171

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           VV KS+G+SNP+N+IRATFE L  Q  P+ VA RRG + + L  R 
Sbjct: 172 VVTKSVGTSNPYNMIRATFEALNDQKSPKAVAQRRGKRIADLFGRG 217


>gi|328955896|ref|YP_004373229.1| SSU ribosomal protein S5P [Coriobacterium glomerans PW2]
 gi|328456220|gb|AEB07414.1| SSU ribosomal protein S5P [Coriobacterium glomerans PW2]
          Length = 174

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 74/181 (40%), Positives = 115/181 (63%), Gaps = 8/181 (4%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+ +R QR          +   +R+V INRVS  + GGRRF+   LVVVGD + +VG  
Sbjct: 1   MARNQRQQR--------EASEFEERVVFINRVSKVVKGGRRFSLVALVVVGDGRGRVGLG 52

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              + EVP A+ KAT  AK+NM +V L D  T+ H+ +GR GAG++I++ A+ GTG+IAG
Sbjct: 53  MGKSTEVPLAISKATIDAKKNMFAVPLTDTGTIPHEVLGRFGAGRIIIKPAVEGTGLIAG 112

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GA+R + E+ G+ +V+AKS+G+ N  N+++A  + LR  + P ++A RRG+  + +   +
Sbjct: 113 GAVRPLFELAGIKNVLAKSLGTDNGLNIVKAAAQGLRELASPEEIAERRGLTVAEMFVGK 172

Query: 181 V 181
            
Sbjct: 173 E 173


>gi|108760922|ref|YP_631515.1| 30S ribosomal protein S5 [Myxococcus xanthus DK 1622]
 gi|123374510|sp|Q1D758|RS5_MYXXD RecName: Full=30S ribosomal protein S5
 gi|108464802|gb|ABF89987.1| ribosomal protein S5 [Myxococcus xanthus DK 1622]
          Length = 173

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 74/159 (46%), Positives = 99/159 (62%), Gaps = 1/159 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
              D  + DR+V INRV+  + GGRRF+F+ LVVVGD    VG     A EVPEA+RK  
Sbjct: 6   NPNDLDLTDRVVNINRVAKVVKGGRRFSFAALVVVGDGAGHVGVGLGKANEVPEAIRKGG 65

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N+  V L+ G T+ H+ +G  GAG V+++ A  GTGVIAGGA+RAV E  G+ ++
Sbjct: 66  ENAKKNLFRVPLV-GHTIPHEVLGHFGAGWVLLKPATQGTGVIAGGAVRAVLEAAGIRNI 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           + KS GS NPHNV++AT   L+       V+  RG    
Sbjct: 125 LTKSQGSRNPHNVLKATVAGLKLLRSAEQVSRLRGKDVE 163


>gi|15803830|ref|NP_289864.1| 30S ribosomal protein S5 [Escherichia coli O157:H7 EDL933]
 gi|15833422|ref|NP_312195.1| 30S ribosomal protein S5 [Escherichia coli O157:H7 str. Sakai]
 gi|16131182|ref|NP_417762.1| 30S ribosomal subunit protein S5 [Escherichia coli str. K-12
           substr. MG1655]
 gi|16762860|ref|NP_458477.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766712|ref|NP_462327.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|24114581|ref|NP_709091.1| 30S ribosomal protein S5 [Shigella flexneri 2a str. 301]
 gi|26249889|ref|NP_755929.1| 30S ribosomal protein S5 [Escherichia coli CFT073]
 gi|29144347|ref|NP_807689.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|30065396|ref|NP_839567.1| 30S ribosomal protein S5 [Shigella flexneri 2a str. 2457T]
 gi|56415342|ref|YP_152417.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181927|ref|YP_218344.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|74313822|ref|YP_312241.1| 30S ribosomal protein S5 [Shigella sonnei Ss046]
 gi|82545666|ref|YP_409613.1| 30S ribosomal protein S5 [Shigella boydii Sb227]
 gi|89110707|ref|AP_004487.1| 30S ribosomal subunit protein S5 [Escherichia coli str. K-12
           substr. W3110]
 gi|91212732|ref|YP_542718.1| 30S ribosomal protein S5 [Escherichia coli UTI89]
 gi|110643542|ref|YP_671272.1| 30S ribosomal protein S5 [Escherichia coli 536]
 gi|110807151|ref|YP_690671.1| 30S ribosomal protein S5 [Shigella flexneri 5 str. 8401]
 gi|117625583|ref|YP_858906.1| 30S ribosomal protein S5 [Escherichia coli APEC O1]
 gi|157148878|ref|YP_001456197.1| 30S ribosomal protein S5 [Citrobacter koseri ATCC BAA-895]
 gi|157155673|ref|YP_001464771.1| 30S ribosomal protein S5 [Escherichia coli E24377A]
 gi|157162777|ref|YP_001460095.1| 30S ribosomal protein S5 [Escherichia coli HS]
 gi|161506025|ref|YP_001573138.1| 30S ribosomal protein S5 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|161616449|ref|YP_001590414.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|170018461|ref|YP_001723415.1| 30S ribosomal protein S5 [Escherichia coli ATCC 8739]
 gi|170082823|ref|YP_001732143.1| 30S ribosomal subunit protein S5 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170679847|ref|YP_001745565.1| 30S ribosomal protein S5 [Escherichia coli SMS-3-5]
 gi|170769498|ref|ZP_02903951.1| ribosomal protein S5 [Escherichia albertii TW07627]
 gi|187732964|ref|YP_001881987.1| 30S ribosomal protein S5 [Shigella boydii CDC 3083-94]
 gi|187776457|ref|ZP_02802844.2| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4196]
 gi|188025274|ref|ZP_02777268.2| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4113]
 gi|188495442|ref|ZP_03002712.1| ribosomal protein S5 [Escherichia coli 53638]
 gi|189010700|ref|ZP_02808879.2| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4076]
 gi|189403225|ref|ZP_02794173.2| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4486]
 gi|189404701|ref|ZP_02810124.2| ribosomal protein S5 [Escherichia coli O157:H7 str. EC869]
 gi|191174457|ref|ZP_03035958.1| ribosomal protein S5 [Escherichia coli F11]
 gi|193066500|ref|ZP_03047544.1| ribosomal protein S5 [Escherichia coli E22]
 gi|193071538|ref|ZP_03052447.1| ribosomal protein S5 [Escherichia coli E110019]
 gi|194435084|ref|ZP_03067322.1| ribosomal protein S5 [Shigella dysenteriae 1012]
 gi|194439992|ref|ZP_03072050.1| ribosomal protein S5 [Escherichia coli 101-1]
 gi|194445564|ref|YP_002042673.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448021|ref|YP_002047446.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194468683|ref|ZP_03074667.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194736871|ref|YP_002116365.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195874420|ref|ZP_02701855.2| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197248800|ref|YP_002148342.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262480|ref|ZP_03162554.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197364272|ref|YP_002143909.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198242338|ref|YP_002217385.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389250|ref|ZP_03215862.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205354949|ref|YP_002228750.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205360816|ref|ZP_02686667.2| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206580716|ref|YP_002236297.1| ribosomal protein S5 [Klebsiella pneumoniae 342]
 gi|207858665|ref|YP_002245316.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208813650|ref|ZP_03254979.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4045]
 gi|208821351|ref|ZP_03261671.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4042]
 gi|209398165|ref|YP_002272759.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4115]
 gi|209920769|ref|YP_002294853.1| 30S ribosomal protein S5 [Escherichia coli SE11]
 gi|213021518|ref|ZP_03335965.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213425768|ref|ZP_03358518.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213581356|ref|ZP_03363182.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213612291|ref|ZP_03370117.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213646541|ref|ZP_03376594.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|215488603|ref|YP_002331034.1| 30S ribosomal protein S5 [Escherichia coli O127:H6 str. E2348/69]
 gi|217325486|ref|ZP_03441570.1| ribosomal protein S5 [Escherichia coli O157:H7 str. TW14588]
 gi|218550578|ref|YP_002384369.1| 30S ribosomal protein S5 [Escherichia fergusonii ATCC 35469]
 gi|218555860|ref|YP_002388773.1| 30S ribosomal protein S5 [Escherichia coli IAI1]
 gi|218560364|ref|YP_002393277.1| 30S ribosomal protein S5 [Escherichia coli S88]
 gi|218691589|ref|YP_002399801.1| 30S ribosomal protein S5 [Escherichia coli ED1a]
 gi|218696995|ref|YP_002404662.1| 30S ribosomal protein S5 [Escherichia coli 55989]
 gi|218702065|ref|YP_002409694.1| 30S ribosomal protein S5 [Escherichia coli IAI39]
 gi|218706910|ref|YP_002414429.1| 30S ribosomal protein S5 [Escherichia coli UMN026]
 gi|224585218|ref|YP_002639017.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|227883434|ref|ZP_04001239.1| 30S ribosomal protein S5 [Escherichia coli 83972]
 gi|237703033|ref|ZP_04533514.1| 30S ribosomal subunit protein S5 [Escherichia sp. 3_2_53FAA]
 gi|238902394|ref|YP_002928190.1| 30S ribosomal subunit protein S5 [Escherichia coli BW2952]
 gi|238913862|ref|ZP_04657699.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|254038464|ref|ZP_04872520.1| 30S ribosomal protein S5 [Escherichia sp. 1_1_43]
 gi|254795240|ref|YP_003080077.1| 30S ribosomal protein S5 [Escherichia coli O157:H7 str. TW14359]
 gi|256020662|ref|ZP_05434527.1| 30S ribosomal protein S5 [Shigella sp. D9]
 gi|256025969|ref|ZP_05439834.1| 30S ribosomal protein S5 [Escherichia sp. 4_1_40B]
 gi|260846101|ref|YP_003223879.1| 30S ribosomal subunit protein S5 [Escherichia coli O103:H2 str.
           12009]
 gi|260857424|ref|YP_003231315.1| 30S ribosomal subunit protein S5 [Escherichia coli O26:H11 str.
           11368]
 gi|260870046|ref|YP_003236448.1| 30S ribosomal subunit protein S5 [Escherichia coli O111:H- str.
           11128]
 gi|261224608|ref|ZP_05938889.1| 30S ribosomal subunit protein S5 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254498|ref|ZP_05947031.1| 30S ribosomal subunit protein S5 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|283788061|ref|YP_003367926.1| 30S ribosomal subunit protein S5 [Citrobacter rodentium ICC168]
 gi|288933283|ref|YP_003437342.1| ribosomal protein S5 [Klebsiella variicola At-22]
 gi|289824208|ref|ZP_06543803.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|290512086|ref|ZP_06551454.1| 30S ribosomal protein S5 [Klebsiella sp. 1_1_55]
 gi|291284661|ref|YP_003501479.1| 30S ribosomal protein S5 [Escherichia coli O55:H7 str. CB9615]
 gi|293406900|ref|ZP_06650824.1| 30S ribosomal protein S5 [Escherichia coli FVEC1412]
 gi|293412722|ref|ZP_06655390.1| 30S ribosomal protein S5 [Escherichia coli B354]
 gi|293416720|ref|ZP_06659357.1| 30S ribosomal protein S5 [Escherichia coli B185]
 gi|293453621|ref|ZP_06664040.1| 30S ribosomal protein S5 [Escherichia coli B088]
 gi|298382641|ref|ZP_06992236.1| rpsE [Escherichia coli FVEC1302]
 gi|300815487|ref|ZP_07095712.1| ribosomal protein S5 [Escherichia coli MS 107-1]
 gi|300822894|ref|ZP_07103030.1| ribosomal protein S5 [Escherichia coli MS 119-7]
 gi|300896651|ref|ZP_07115167.1| ribosomal protein S5 [Escherichia coli MS 198-1]
 gi|300903551|ref|ZP_07121473.1| ribosomal protein S5 [Escherichia coli MS 84-1]
 gi|300918276|ref|ZP_07134880.1| ribosomal protein S5 [Escherichia coli MS 115-1]
 gi|300921888|ref|ZP_07138044.1| ribosomal protein S5 [Escherichia coli MS 182-1]
 gi|300932196|ref|ZP_07147475.1| ribosomal protein S5 [Escherichia coli MS 187-1]
 gi|300935301|ref|ZP_07150311.1| ribosomal protein S5 [Escherichia coli MS 21-1]
 gi|300946525|ref|ZP_07160790.1| ribosomal protein S5 [Escherichia coli MS 116-1]
 gi|300954823|ref|ZP_07167249.1| ribosomal protein S5 [Escherichia coli MS 175-1]
 gi|300973982|ref|ZP_07172389.1| ribosomal protein S5 [Escherichia coli MS 200-1]
 gi|300979874|ref|ZP_07174750.1| ribosomal protein S5 [Escherichia coli MS 45-1]
 gi|301018833|ref|ZP_07183077.1| ribosomal protein S5 [Escherichia coli MS 69-1]
 gi|301021158|ref|ZP_07185196.1| ribosomal protein S5 [Escherichia coli MS 196-1]
 gi|301046074|ref|ZP_07193252.1| ribosomal protein S5 [Escherichia coli MS 185-1]
 gi|301305512|ref|ZP_07211604.1| ribosomal protein S5 [Escherichia coli MS 124-1]
 gi|301325130|ref|ZP_07218664.1| ribosomal protein S5 [Escherichia coli MS 78-1]
 gi|301643877|ref|ZP_07243908.1| ribosomal protein S5 [Escherichia coli MS 146-1]
 gi|306816354|ref|ZP_07450492.1| 30S ribosomal protein S5 [Escherichia coli NC101]
 gi|307139986|ref|ZP_07499342.1| 30S ribosomal protein S5 [Escherichia coli H736]
 gi|307315118|ref|ZP_07594701.1| ribosomal protein S5 [Escherichia coli W]
 gi|309794578|ref|ZP_07689000.1| ribosomal protein S5 [Escherichia coli MS 145-7]
 gi|312968372|ref|ZP_07782582.1| ribosomal protein S5 [Escherichia coli 2362-75]
 gi|312972436|ref|ZP_07786610.1| ribosomal protein S5 [Escherichia coli 1827-70]
 gi|331643999|ref|ZP_08345128.1| ribosomal protein S5 [Escherichia coli H736]
 gi|331649100|ref|ZP_08350186.1| ribosomal protein S5 [Escherichia coli M605]
 gi|331654896|ref|ZP_08355895.1| ribosomal protein S5 [Escherichia coli M718]
 gi|331659593|ref|ZP_08360531.1| ribosomal protein S5 [Escherichia coli TA206]
 gi|331664916|ref|ZP_08365817.1| ribosomal protein S5 [Escherichia coli TA143]
 gi|331670132|ref|ZP_08370971.1| ribosomal protein S5 [Escherichia coli TA271]
 gi|331674808|ref|ZP_08375565.1| ribosomal protein S5 [Escherichia coli TA280]
 gi|331679372|ref|ZP_08380042.1| ribosomal protein S5 [Escherichia coli H591]
 gi|331684945|ref|ZP_08385531.1| ribosomal protein S5 [Escherichia coli H299]
 gi|62288981|sp|P0A7W1|RS5_ECOLI RecName: Full=30S ribosomal protein S5
 gi|62288982|sp|P0A7W2|RS5_ECOL6 RecName: Full=30S ribosomal protein S5
 gi|62288983|sp|P0A7W3|RS5_ECO57 RecName: Full=30S ribosomal protein S5
 gi|62288984|sp|P0A7W4|RS5_SALTY RecName: Full=30S ribosomal protein S5
 gi|62288985|sp|P0A7W5|RS5_SALTI RecName: Full=30S ribosomal protein S5
 gi|62288986|sp|P0A7W6|RS5_SHIFL RecName: Full=30S ribosomal protein S5
 gi|73919096|sp|Q57J49|RS5_SALCH RecName: Full=30S ribosomal protein S5
 gi|73919097|sp|Q5PK01|RS5_SALPA RecName: Full=30S ribosomal protein S5
 gi|91207886|sp|Q31VX3|RS5_SHIBS RecName: Full=30S ribosomal protein S5
 gi|91207888|sp|Q3YWV6|RS5_SHISS RecName: Full=30S ribosomal protein S5
 gi|122422196|sp|Q1R627|RS5_ECOUT RecName: Full=30S ribosomal protein S5
 gi|123147625|sp|Q0TCF8|RS5_ECOL5 RecName: Full=30S ribosomal protein S5
 gi|123342433|sp|Q0SZZ9|RS5_SHIF8 RecName: Full=30S ribosomal protein S5
 gi|172045614|sp|A8AQJ8|RS5_CITK8 RecName: Full=30S ribosomal protein S5
 gi|189045410|sp|A7ZSJ2|RS5_ECO24 RecName: Full=30S ribosomal protein S5
 gi|189045411|sp|A8A5A8|RS5_ECOHS RecName: Full=30S ribosomal protein S5
 gi|189045412|sp|A1AGJ2|RS5_ECOK1 RecName: Full=30S ribosomal protein S5
 gi|189045413|sp|B1IPZ6|RS5_ECOLC RecName: Full=30S ribosomal protein S5
 gi|189045434|sp|A9MN66|RS5_SALAR RecName: Full=30S ribosomal protein S5
 gi|189045435|sp|A9MSY1|RS5_SALPB RecName: Full=30S ribosomal protein S5
 gi|25294529|pir||AB1008 30S ribosomal chain protein S5 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|116666552|pdb|1VS5|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666604|pdb|1VS7|E Chain E, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|257097326|pdb|3I1M|E Chain E, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097378|pdb|3I1O|E Chain E, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097430|pdb|3I1Q|E Chain E, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097484|pdb|3I1S|E Chain E, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097538|pdb|3I1Z|E Chain E, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097593|pdb|3I21|E Chain E, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560311|pdb|3KC4|E Chain E, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 gi|308198691|pdb|3OR9|E Chain E, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 gi|308198712|pdb|3ORA|E Chain E, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|326634283|pdb|3IZV|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 gi|326634308|pdb|3IZW|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|12517932|gb|AAG58424.1|AE005556_17 30S ribosomal subunit protein S5 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26110317|gb|AAN82503.1|AE016767_263 30S ribosomal protein S5 [Escherichia coli CFT073]
 gi|42986|emb|CAA25722.1| unnamed protein product [Escherichia coli]
 gi|606237|gb|AAA58100.1| 30S ribosomal subunit protein S5 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789699|gb|AAC76328.1| 30S ribosomal subunit protein S5 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363641|dbj|BAB37591.1| 30S ribosomal subunit protein S5 [Escherichia coli O157:H7 str.
           Sakai]
 gi|16421979|gb|AAL22286.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16505167|emb|CAD09163.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|24053777|gb|AAN44798.1| 30S ribosomal subunit protein S5 [Shigella flexneri 2a str. 301]
 gi|29139985|gb|AAO71549.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|30043658|gb|AAP19378.1| 30S ribosomal subunit protein S5 [Shigella flexneri 2a str. 2457T]
 gi|56129599|gb|AAV79105.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129560|gb|AAX67263.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|73857299|gb|AAZ90006.1| 30S ribosomal subunit protein S5 [Shigella sonnei Ss046]
 gi|81247077|gb|ABB67785.1| 30S ribosomal subunit protein S5 [Shigella boydii Sb227]
 gi|85676738|dbj|BAE77988.1| 30S ribosomal subunit protein S5 [Escherichia coli str. K12 substr.
           W3110]
 gi|91074306|gb|ABE09187.1| 30S ribosomal subunit protein S5 [Escherichia coli UTI89]
 gi|110345134|gb|ABG71371.1| 30S ribosomal protein S5 [Escherichia coli 536]
 gi|110616699|gb|ABF05366.1| 30S ribosomal subunit protein S5 [Shigella flexneri 5 str. 8401]
 gi|115514707|gb|ABJ02782.1| 30S ribosomal subunit protein S5 [Escherichia coli APEC O1]
 gi|157068457|gb|ABV07712.1| ribosomal protein S5 [Escherichia coli HS]
 gi|157077703|gb|ABV17411.1| ribosomal protein S5 [Escherichia coli E24377A]
 gi|157086083|gb|ABV15761.1| hypothetical protein CKO_04716 [Citrobacter koseri ATCC BAA-895]
 gi|160867372|gb|ABX23995.1| hypothetical protein SARI_04206 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161365813|gb|ABX69581.1| hypothetical protein SPAB_04264 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169753389|gb|ACA76088.1| ribosomal protein S5 [Escherichia coli ATCC 8739]
 gi|169890658|gb|ACB04365.1| 30S ribosomal subunit protein S5 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170121555|gb|EDS90486.1| ribosomal protein S5 [Escherichia albertii TW07627]
 gi|170517565|gb|ACB15743.1| ribosomal protein S5 [Escherichia coli SMS-3-5]
 gi|187429956|gb|ACD09230.1| ribosomal protein S5 [Shigella boydii CDC 3083-94]
 gi|187767001|gb|EDU30845.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4196]
 gi|188013868|gb|EDU51990.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4113]
 gi|188490641|gb|EDU65744.1| ribosomal protein S5 [Escherichia coli 53638]
 gi|188998851|gb|EDU67837.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4076]
 gi|189361810|gb|EDU80229.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4486]
 gi|189374519|gb|EDU92935.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC869]
 gi|190905265|gb|EDV64903.1| ribosomal protein S5 [Escherichia coli F11]
 gi|192925881|gb|EDV80531.1| ribosomal protein S5 [Escherichia coli E22]
 gi|192955126|gb|EDV85620.1| ribosomal protein S5 [Escherichia coli E110019]
 gi|194404227|gb|ACF64449.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194406325|gb|ACF66544.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194416691|gb|EDX32822.1| ribosomal protein S5 [Shigella dysenteriae 1012]
 gi|194421044|gb|EDX37073.1| ribosomal protein S5 [Escherichia coli 101-1]
 gi|194455047|gb|EDX43886.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194712373|gb|ACF91594.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628901|gb|EDX48311.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095749|emb|CAR61319.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197212503|gb|ACH49900.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197240735|gb|EDY23355.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197936854|gb|ACH74187.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199606348|gb|EDZ04893.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205274730|emb|CAR39786.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205346871|gb|EDZ33502.1| ribosomal protein S5 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206569774|gb|ACI11550.1| ribosomal protein S5 [Klebsiella pneumoniae 342]
 gi|206710468|emb|CAR34826.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|208734927|gb|EDZ83614.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4045]
 gi|208741474|gb|EDZ89156.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4042]
 gi|209159565|gb|ACI36998.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4115]
 gi|209757208|gb|ACI76916.1| 30S ribosomal subunit protein S5 [Escherichia coli]
 gi|209757210|gb|ACI76917.1| 30S ribosomal subunit protein S5 [Escherichia coli]
 gi|209757212|gb|ACI76918.1| 30S ribosomal subunit protein S5 [Escherichia coli]
 gi|209757214|gb|ACI76919.1| 30S ribosomal subunit protein S5 [Escherichia coli]
 gi|209757216|gb|ACI76920.1| 30S ribosomal subunit protein S5 [Escherichia coli]
 gi|209914028|dbj|BAG79102.1| 30S ribosomal protein S5 [Escherichia coli SE11]
 gi|215266675|emb|CAS11114.1| 30S ribosomal subunit protein S5 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217321707|gb|EEC30131.1| ribosomal protein S5 [Escherichia coli O157:H7 str. TW14588]
 gi|218353727|emb|CAV00009.1| 30S ribosomal subunit protein S5 [Escherichia coli 55989]
 gi|218358119|emb|CAQ90766.1| 30S ribosomal subunit protein S5 [Escherichia fergusonii ATCC
           35469]
 gi|218362628|emb|CAR00254.1| 30S ribosomal subunit protein S5 [Escherichia coli IAI1]
 gi|218367133|emb|CAR04907.1| 30S ribosomal subunit protein S5 [Escherichia coli S88]
 gi|218372051|emb|CAR19911.1| 30S ribosomal subunit protein S5 [Escherichia coli IAI39]
 gi|218429153|emb|CAR10105.2| 30S ribosomal subunit protein S5 [Escherichia coli ED1a]
 gi|218434007|emb|CAR14924.1| 30S ribosomal subunit protein S5 [Escherichia coli UMN026]
 gi|222035012|emb|CAP77755.1| 30S ribosomal protein S5 [Escherichia coli LF82]
 gi|224469746|gb|ACN47576.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|226838970|gb|EEH70993.1| 30S ribosomal protein S5 [Escherichia sp. 1_1_43]
 gi|226902297|gb|EEH88556.1| 30S ribosomal subunit protein S5 [Escherichia sp. 3_2_53FAA]
 gi|227839578|gb|EEJ50044.1| 30S ribosomal protein S5 [Escherichia coli 83972]
 gi|238859800|gb|ACR61798.1| 30S ribosomal subunit protein S5 [Escherichia coli BW2952]
 gi|254594640|gb|ACT74001.1| 30S ribosomal subunit protein S5 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756073|dbj|BAI27575.1| 30S ribosomal subunit protein S5 [Escherichia coli O26:H11 str.
           11368]
 gi|257761248|dbj|BAI32745.1| 30S ribosomal subunit protein S5 [Escherichia coli O103:H2 str.
           12009]
 gi|257766402|dbj|BAI37897.1| 30S ribosomal subunit protein S5 [Escherichia coli O111:H- str.
           11128]
 gi|260447678|gb|ACX38100.1| ribosomal protein S5 [Escherichia coli DH1]
 gi|261248580|emb|CBG26418.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995632|gb|ACY90517.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|281180338|dbj|BAI56668.1| 30S ribosomal protein S5 [Escherichia coli SE15]
 gi|281602668|gb|ADA75652.1| 30S ribosomal protein S5 [Shigella flexneri 2002017]
 gi|282951515|emb|CBG91214.1| 30S ribosomal subunit protein S5 [Citrobacter rodentium ICC168]
 gi|284923309|emb|CBG36403.1| 30S ribosomal subunit protein S5 [Escherichia coli 042]
 gi|288888012|gb|ADC56330.1| ribosomal protein S5 [Klebsiella variicola At-22]
 gi|289775876|gb|EFD83876.1| 30S ribosomal protein S5 [Klebsiella sp. 1_1_55]
 gi|290764534|gb|ADD58495.1| 30S ribosomal protein S5 [Escherichia coli O55:H7 str. CB9615]
 gi|291321747|gb|EFE61178.1| 30S ribosomal protein S5 [Escherichia coli B088]
 gi|291425711|gb|EFE98745.1| 30S ribosomal protein S5 [Escherichia coli FVEC1412]
 gi|291431296|gb|EFF04281.1| 30S ribosomal protein S5 [Escherichia coli B185]
 gi|291468369|gb|EFF10862.1| 30S ribosomal protein S5 [Escherichia coli B354]
 gi|294492565|gb|ADE91321.1| ribosomal protein S5 [Escherichia coli IHE3034]
 gi|298276477|gb|EFI17995.1| rpsE [Escherichia coli FVEC1302]
 gi|299881634|gb|EFI89845.1| ribosomal protein S5 [Escherichia coli MS 196-1]
 gi|300301900|gb|EFJ58285.1| ribosomal protein S5 [Escherichia coli MS 185-1]
 gi|300308992|gb|EFJ63512.1| ribosomal protein S5 [Escherichia coli MS 200-1]
 gi|300318223|gb|EFJ68007.1| ribosomal protein S5 [Escherichia coli MS 175-1]
 gi|300359482|gb|EFJ75352.1| ribosomal protein S5 [Escherichia coli MS 198-1]
 gi|300399543|gb|EFJ83081.1| ribosomal protein S5 [Escherichia coli MS 69-1]
 gi|300404424|gb|EFJ87962.1| ribosomal protein S5 [Escherichia coli MS 84-1]
 gi|300409385|gb|EFJ92923.1| ribosomal protein S5 [Escherichia coli MS 45-1]
 gi|300414537|gb|EFJ97847.1| ribosomal protein S5 [Escherichia coli MS 115-1]
 gi|300421736|gb|EFK05047.1| ribosomal protein S5 [Escherichia coli MS 182-1]
 gi|300453771|gb|EFK17391.1| ribosomal protein S5 [Escherichia coli MS 116-1]
 gi|300459457|gb|EFK22950.1| ribosomal protein S5 [Escherichia coli MS 21-1]
 gi|300460020|gb|EFK23513.1| ribosomal protein S5 [Escherichia coli MS 187-1]
 gi|300524660|gb|EFK45729.1| ribosomal protein S5 [Escherichia coli MS 119-7]
 gi|300532379|gb|EFK53441.1| ribosomal protein S5 [Escherichia coli MS 107-1]
 gi|300839207|gb|EFK66967.1| ribosomal protein S5 [Escherichia coli MS 124-1]
 gi|300848009|gb|EFK75769.1| ribosomal protein S5 [Escherichia coli MS 78-1]
 gi|301077780|gb|EFK92586.1| ribosomal protein S5 [Escherichia coli MS 146-1]
 gi|301159966|emb|CBW19485.1| 30S ribosomal subunit protein S5 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|305850750|gb|EFM51207.1| 30S ribosomal protein S5 [Escherichia coli NC101]
 gi|306905467|gb|EFN36002.1| ribosomal protein S5 [Escherichia coli W]
 gi|307555391|gb|ADN48166.1| 30S ribosomal subunit protein S5 [Escherichia coli ABU 83972]
 gi|307628338|gb|ADN72642.1| 30S ribosomal protein S5 [Escherichia coli UM146]
 gi|308121628|gb|EFO58890.1| ribosomal protein S5 [Escherichia coli MS 145-7]
 gi|309703715|emb|CBJ03056.1| 30s ribosomal protein S5 [Escherichia coli ETEC H10407]
 gi|310334813|gb|EFQ01018.1| ribosomal protein S5 [Escherichia coli 1827-70]
 gi|312287197|gb|EFR15107.1| ribosomal protein S5 [Escherichia coli 2362-75]
 gi|312914446|dbj|BAJ38420.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|312947854|gb|ADR28681.1| 30S ribosomal protein S5 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647387|gb|EFS11839.1| ribosomal protein S5 [Shigella flexneri 2a str. 2457T]
 gi|315062595|gb|ADT76922.1| 30S ribosomal subunit protein S5 [Escherichia coli W]
 gi|315137878|dbj|BAJ45037.1| 30S ribosomal protein S5 [Escherichia coli DH1]
 gi|315255886|gb|EFU35854.1| ribosomal protein S5 [Escherichia coli MS 85-1]
 gi|315284622|gb|EFU44067.1| ribosomal protein S5 [Escherichia coli MS 110-3]
 gi|315292380|gb|EFU51732.1| ribosomal protein S5 [Escherichia coli MS 153-1]
 gi|315298601|gb|EFU57856.1| ribosomal protein S5 [Escherichia coli MS 16-3]
 gi|320087868|emb|CBY97631.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|320173947|gb|EFW49123.1| SSU ribosomal protein S5p (S2e) [Shigella dysenteriae CDC 74-1112]
 gi|320182699|gb|EFW57585.1| SSU ribosomal protein S5p (S2e) [Shigella boydii ATCC 9905]
 gi|320187024|gb|EFW61736.1| SSU ribosomal protein S5p (S2e) [Shigella flexneri CDC 796-83]
 gi|320191663|gb|EFW66313.1| SSU ribosomal protein S5p (S2e) [Escherichia coli O157:H7 str.
           EC1212]
 gi|320195395|gb|EFW70022.1| SSU ribosomal protein S5p (S2e) [Escherichia coli WV_060327]
 gi|320199490|gb|EFW74080.1| SSU ribosomal protein S5p (S2e) [Escherichia coli EC4100B]
 gi|320639608|gb|EFX09202.1| 30S ribosomal protein S5 [Escherichia coli O157:H7 str. G5101]
 gi|320645106|gb|EFX14122.1| 30S ribosomal protein S5 [Escherichia coli O157:H- str. 493-89]
 gi|320650417|gb|EFX18883.1| 30S ribosomal protein S5 [Escherichia coli O157:H- str. H 2687]
 gi|320655942|gb|EFX23862.1| 30S ribosomal protein S5 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661394|gb|EFX28809.1| 30S ribosomal protein S5 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666416|gb|EFX33399.1| 30S ribosomal protein S5 [Escherichia coli O157:H7 str. LSU-61]
 gi|321226473|gb|EFX51523.1| SSU ribosomal protein S5p (S2e) [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322615036|gb|EFY11960.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617323|gb|EFY14224.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625545|gb|EFY22370.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626387|gb|EFY23196.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632101|gb|EFY28854.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635020|gb|EFY31743.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643279|gb|EFY39846.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646637|gb|EFY43144.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649983|gb|EFY46402.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652700|gb|EFY49040.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659543|gb|EFY55787.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665515|gb|EFY61702.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670409|gb|EFY66548.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670482|gb|EFY66616.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675058|gb|EFY71141.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681595|gb|EFY77624.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685939|gb|EFY81928.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716414|gb|EFZ07985.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323131781|gb|ADX19211.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323154141|gb|EFZ40344.1| ribosomal protein S5 [Escherichia coli EPECa14]
 gi|323162982|gb|EFZ48817.1| ribosomal protein S5 [Escherichia coli E128010]
 gi|323164867|gb|EFZ50658.1| ribosomal protein S5 [Shigella sonnei 53G]
 gi|323173939|gb|EFZ59567.1| ribosomal protein S5 [Escherichia coli LT-68]
 gi|323179161|gb|EFZ64735.1| ribosomal protein S5 [Escherichia coli 1180]
 gi|323182781|gb|EFZ68182.1| ribosomal protein S5 [Escherichia coli 1357]
 gi|323189092|gb|EFZ74376.1| ribosomal protein S5 [Escherichia coli RN587/1]
 gi|323195809|gb|EFZ80982.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196435|gb|EFZ81586.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202326|gb|EFZ87371.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207325|gb|EFZ92275.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211239|gb|EFZ96084.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216052|gb|EGA00783.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223457|gb|EGA07785.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226813|gb|EGA11003.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231825|gb|EGA15935.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233222|gb|EGA17317.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237289|gb|EGA21354.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245524|gb|EGA29523.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249030|gb|EGA32952.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250653|gb|EGA34534.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256882|gb|EGA40596.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263031|gb|EGA46578.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266031|gb|EGA49526.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272788|gb|EGA56191.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|323376818|gb|ADX49086.1| ribosomal protein S5 [Escherichia coli KO11]
 gi|323934499|gb|EGB30907.1| ribosomal protein S5 [Escherichia coli E1520]
 gi|323939275|gb|EGB35487.1| ribosomal protein S5 [Escherichia coli E482]
 gi|323944276|gb|EGB40352.1| ribosomal protein S5 [Escherichia coli H120]
 gi|323950217|gb|EGB46099.1| ribosomal protein S5 [Escherichia coli H252]
 gi|323954574|gb|EGB50357.1| ribosomal protein S5 [Escherichia coli H263]
 gi|323959546|gb|EGB55199.1| ribosomal protein S5 [Escherichia coli H489]
 gi|323966265|gb|EGB61700.1| ribosomal protein S5 [Escherichia coli M863]
 gi|323970107|gb|EGB65381.1| ribosomal protein S5 [Escherichia coli TA007]
 gi|323974744|gb|EGB69857.1| ribosomal protein S5 [Escherichia coli TW10509]
 gi|324009037|gb|EGB78256.1| ribosomal protein S5 [Escherichia coli MS 57-2]
 gi|324014919|gb|EGB84138.1| ribosomal protein S5 [Escherichia coli MS 60-1]
 gi|324017879|gb|EGB87098.1| ribosomal protein S5 [Escherichia coli MS 117-3]
 gi|324111982|gb|EGC05961.1| ribosomal protein S5 [Escherichia fergusonii B253]
 gi|324116307|gb|EGC10227.1| ribosomal protein S5 [Escherichia coli E1167]
 gi|325498870|gb|EGC96729.1| 30S ribosomal protein S5 [Escherichia fergusonii ECD227]
 gi|326342551|gb|EGD66325.1| SSU ribosomal protein S5p (S2e) [Escherichia coli O157:H7 str.
           1044]
 gi|326344538|gb|EGD68287.1| SSU ribosomal protein S5p (S2e) [Escherichia coli O157:H7 str.
           1125]
 gi|326625166|gb|EGE31511.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326630098|gb|EGE36441.1| 30S ribosomal protein S5 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|327250951|gb|EGE62644.1| ribosomal protein S5 [Escherichia coli STEC_7v]
 gi|330909347|gb|EGH37861.1| SSU ribosomal protein S5p (S2e) [Escherichia coli AA86]
 gi|331036293|gb|EGI08519.1| ribosomal protein S5 [Escherichia coli H736]
 gi|331041598|gb|EGI13742.1| ribosomal protein S5 [Escherichia coli M605]
 gi|331046911|gb|EGI18989.1| ribosomal protein S5 [Escherichia coli M718]
 gi|331052808|gb|EGI24841.1| ribosomal protein S5 [Escherichia coli TA206]
 gi|331057426|gb|EGI29412.1| ribosomal protein S5 [Escherichia coli TA143]
 gi|331062194|gb|EGI34114.1| ribosomal protein S5 [Escherichia coli TA271]
 gi|331067717|gb|EGI39115.1| ribosomal protein S5 [Escherichia coli TA280]
 gi|331072544|gb|EGI43869.1| ribosomal protein S5 [Escherichia coli H591]
 gi|331077316|gb|EGI48528.1| ribosomal protein S5 [Escherichia coli H299]
 gi|332085452|gb|EGI90618.1| ribosomal protein S5 [Shigella boydii 5216-82]
 gi|332086271|gb|EGI91427.1| ribosomal protein S5 [Shigella dysenteriae 155-74]
 gi|332090409|gb|EGI95507.1| ribosomal protein S5 [Shigella boydii 3594-74]
 gi|332104210|gb|EGJ07556.1| 30S ribosomal subunit protein S5 [Shigella sp. D9]
          Length = 167

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK 167


>gi|116787540|gb|ABK24549.1| unknown [Picea sitchensis]
          Length = 328

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 63/173 (36%), Positives = 99/173 (57%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           KE+      +  ++  +   +R+V + RV+  + GG++ +F  +V+VGD   KVG     
Sbjct: 154 KEKKGFRLTKKTDKIKDGFEERVVQVRRVTKVVKGGKQMSFRAVVIVGDKNGKVGVGVGK 213

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A+EV  AV+K+   A+R++++V +    T  H   G +GA KV++R A AGTGVIAGGA+
Sbjct: 214 AKEVIAAVQKSAVDARRHVVTVPMTKYLTFPHRADGHYGAAKVMLRPATAGTGVIAGGAV 273

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           R V E+ G+ + + K +GS NP N  RA  + +      R+VA  RGI    L
Sbjct: 274 RVVLELAGVENALGKQLGSDNPLNNARAVIDAVSQMRQFREVAEYRGIPMEEL 326


>gi|163791683|ref|ZP_02186078.1| ribosomal protein S5 [Carnobacterium sp. AT7]
 gi|159873062|gb|EDP67171.1| ribosomal protein S5 [Carnobacterium sp. AT7]
          Length = 166

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 104/163 (63%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + DR+V+INRV+  + GGRR  F+ +VVVGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPTHLELEDRVVSINRVTKVVKGGRRLRFAAIVVVGDKNGHVGFGTGKAQEVPEAIRKAI 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N+I V ++D  T+ H  +GR+  G ++++ A+AG+GV AGG +RAV E+ G+ DV
Sbjct: 65  EDAKKNLIEVPMVD-TTIPHAVIGRYSGGNILIKPAVAGSGVSAGGPVRAVLELAGVADV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GSS P N+IRAT E L       +VA  RG     +  
Sbjct: 124 TSKSLGSSTPINMIRATVEGLLQLKRVEEVAKLRGKTVEEIIG 166


>gi|257065016|ref|YP_003144688.1| SSU ribosomal protein S5P [Slackia heliotrinireducens DSM 20476]
 gi|256792669|gb|ACV23339.1| SSU ribosomal protein S5P [Slackia heliotrinireducens DSM 20476]
          Length = 179

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 69/169 (40%), Positives = 104/169 (61%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
              +  +     + +R+V INRV+  + GG RF  + LVVVGD    VG     ++EVP 
Sbjct: 4   RKEEKNQPAVPELQERVVYINRVAKVVKGGTRFGLTALVVVGDGNGHVGVGLGKSKEVPI 63

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+RK  E AK+NM +V L + +TL H+ +G  GAG+V+++ A  GTGVIAGG +RA+ E+
Sbjct: 64  AIRKGVEDAKKNMFTVPLTEAKTLPHEIIGEFGAGRVLLKPATPGTGVIAGGPVRAIMEL 123

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G+ D + KS+G+ NP N+++A  E L+S S P +VA RR    + +  
Sbjct: 124 AGVQDCLTKSLGTDNPMNIVKAAAEGLKSMSSPTEVAERRNTTVAKIYG 172


>gi|83591259|ref|YP_431268.1| 30S ribosomal protein S5 [Moorella thermoacetica ATCC 39073]
 gi|123523763|sp|Q2RFR4|RS5_MOOTA RecName: Full=30S ribosomal protein S5
 gi|83574173|gb|ABC20725.1| SSU ribosomal protein S5P [Moorella thermoacetica ATCC 39073]
          Length = 166

 Score =  174 bits (440), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E R+  + +++V++NRV+  + GGRRF+F+ LVVVGD K  VG     A EVPEA+RK
Sbjct: 3   RIEARELDLTEKVVSVNRVAKVVKGGRRFSFAALVVVGDGKGHVGAGLGKASEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V ++ G T+ H+ +G  GAGKV+++ A  GTGVIAGG +RAV E  G+ 
Sbjct: 63  GIEDAKKNLIKVPMV-GTTIPHEIIGHFGAGKVLLKPAAPGTGVIAGGPVRAVLEAAGIR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+NP+N + AT E L+      +VA  RG   + L  
Sbjct: 122 DILTKSLGSANPNNAVYATIEGLKGLKRAEEVARLRGKTVAELIG 166


>gi|148260922|ref|YP_001235049.1| 30S ribosomal protein S5 [Acidiphilium cryptum JF-5]
 gi|326404320|ref|YP_004284402.1| 30S ribosomal protein S5 [Acidiphilium multivorum AIU301]
 gi|172047771|sp|A5FZU8|RS5_ACICJ RecName: Full=30S ribosomal protein S5
 gi|146402603|gb|ABQ31130.1| SSU ribosomal protein S5P [Acidiphilium cryptum JF-5]
 gi|325051182|dbj|BAJ81520.1| 30S ribosomal protein S5 [Acidiphilium multivorum AIU301]
          Length = 189

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 97/189 (51%), Positives = 129/189 (68%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++ R  R   + R+   + ++D++V INRV+  + GGRRFAF+ LVVVGD K +VGF 
Sbjct: 1   MAREPREGRGRERERDRDGDELIDKLVTINRVAKVVKGGRRFAFAALVVVGDQKGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V + +GRTLHHD  GR GAG V++R+A  GTG+IAG
Sbjct: 61  AGKAKEVPEAIRKATERAKRGMIRVPMKEGRTLHHDIEGRFGAGHVVLRAAPPGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E LG+ DVVAKS+GS NPHN+++AT   L   + PR VA+RRG K + L   +
Sbjct: 121 GPMRAVFETLGIGDVVAKSLGSRNPHNMVKATVAALSQCASPRSVASRRGKKVADLFGPK 180

Query: 181 VVSSKSSSY 189
                 +  
Sbjct: 181 REKEAPADV 189


>gi|114771251|ref|ZP_01448671.1| 30S ribosomal protein S5 [alpha proteobacterium HTCC2255]
 gi|114548176|gb|EAU51063.1| 30S ribosomal protein S5 [alpha proteobacterium HTCC2255]
          Length = 178

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 100/182 (54%), Positives = 128/182 (70%), Gaps = 4/182 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++  +  +     +      DR+VAINRVS  + GG+RF F+ LVVVGD K +VG+ 
Sbjct: 1   MAREDNRKGRDR----DEAPEFQDRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGYG 56

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAG
Sbjct: 57  KGKAKEVPEAIRKATEQAKRQMIRVPLREGRTLHHDVNGRHGAGKVVMRTAPQGTGIIAG 116

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVVAKSIGS NP+N+IRAT + L  ++ PR VA RRG K S +  + 
Sbjct: 117 GPMRAVFEMLGVQDVVAKSIGSQNPYNMIRATMDGLGKEASPRSVAQRRGKKVSEILPKE 176

Query: 181 VV 182
             
Sbjct: 177 EA 178


>gi|242278675|ref|YP_002990804.1| 30S ribosomal protein S5 [Desulfovibrio salexigens DSM 2638]
 gi|259495308|sp|C6C1A2|RS5_DESAD RecName: Full=30S ribosomal protein S5
 gi|242121569|gb|ACS79265.1| ribosomal protein S5 [Desulfovibrio salexigens DSM 2638]
          Length = 163

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 84/165 (50%), Positives = 119/165 (72%), Gaps = 3/165 (1%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E+ D  ++++IV +NRV+  + GGRRF+FS LVVVGD K +VGF    A EVPEA+RKA+
Sbjct: 2   EQNDLGLIEKIVYLNRVAKVVKGGRRFSFSALVVVGDGKGQVGFGLGKANEVPEAIRKAS 61

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A++ MISV LLD  TL ++ +GR+GAG+V+++ A  GTG+IAGG +RAV EV+G+HD+
Sbjct: 62  EKARKEMISVPLLD-GTLPYEVLGRYGAGRVMLKPASKGTGIIAGGPVRAVLEVVGVHDI 120

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           + K+IG++NPHNV+RAT   L S     +V   RG K   +  R+
Sbjct: 121 LTKAIGTNNPHNVLRATIAGLASLRSADEVGQLRGKKV--VTPRK 163


>gi|237728638|ref|ZP_04559119.1| 30S ribosomal protein S5 [Citrobacter sp. 30_2]
 gi|283835720|ref|ZP_06355461.1| hypothetical protein CIT292_10112 [Citrobacter youngae ATCC 29220]
 gi|226909260|gb|EEH95178.1| 30S ribosomal protein S5 [Citrobacter sp. 30_2]
 gi|291068399|gb|EFE06508.1| ribosomal protein S5 [Citrobacter youngae ATCC 29220]
          Length = 167

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMINVAL-NHGTLQHPVKGTHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMKSPEMVAAKRGKSVEEILGK 167


>gi|82778599|ref|YP_404948.1| 30S ribosomal protein S5 [Shigella dysenteriae Sd197]
 gi|309785625|ref|ZP_07680256.1| ribosomal protein S5 [Shigella dysenteriae 1617]
 gi|91207887|sp|Q32B48|RS5_SHIDS RecName: Full=30S ribosomal protein S5
 gi|81242747|gb|ABB63457.1| 30S ribosomal subunit protein S5 [Shigella dysenteriae Sd197]
 gi|308926745|gb|EFP72221.1| ribosomal protein S5 [Shigella dysenteriae 1617]
          Length = 167

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK 167


>gi|284006146|emb|CBA71388.1| 30S ribosomal protein S5 [Arsenophonus nasoniae]
          Length = 166

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRV+  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVAKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM +V+L +  TL+H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMKNVAL-NNGTLYHPVKGAHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG 166


>gi|197287085|ref|YP_002152957.1| 30S ribosomal protein S5 [Proteus mirabilis HI4320]
 gi|227354917|ref|ZP_03839331.1| 30S ribosomal protein S5 [Proteus mirabilis ATCC 29906]
 gi|194684572|emb|CAR46416.1| 30S ribosomal protein S5 [Proteus mirabilis HI4320]
 gi|227164999|gb|EEI49838.1| 30S ribosomal protein S5 [Proteus mirabilis ATCC 29906]
          Length = 166

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM +V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMKTVAL-NNGTLFHPIKGTHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG 166


>gi|156932253|ref|YP_001436169.1| 30S ribosomal protein S5 [Cronobacter sakazakii ATCC BAA-894]
 gi|260599622|ref|YP_003212193.1| 30S ribosomal protein S5 [Cronobacter turicensis z3032]
 gi|189045415|sp|A7MPG7|RS5_ENTS8 RecName: Full=30S ribosomal protein S5
 gi|156530507|gb|ABU75333.1| hypothetical protein ESA_00024 [Cronobacter sakazakii ATCC BAA-894]
 gi|260218799|emb|CBA34147.1| 30S ribosomal protein S5 [Cronobacter turicensis z3032]
          Length = 166

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NHGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLANMKSPEMVAAKRGKSVEEILG 166


>gi|260584433|ref|ZP_05852180.1| 30S ribosomal protein S5 [Granulicatella elegans ATCC 700633]
 gi|260157951|gb|EEW93020.1| 30S ribosomal protein S5 [Granulicatella elegans ATCC 700633]
          Length = 166

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N + R+  + DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RK
Sbjct: 3   NIDARNLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDRNGHVGFGTGKAQEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N+I V    G T+ H+ +GR   G V+++ A AG+GV AGG +RAV E+ G+ 
Sbjct: 63  AIEDAKKNLIEVP-TSGSTIPHEVIGRFCGGNVLLKPAQAGSGVAAGGPVRAVVELAGIA 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV +KS+GS+ P N++RAT E L+      DVA  RG     L  
Sbjct: 122 DVTSKSLGSNTPVNMVRATIEGLKQLKRVEDVAALRGKSVEELLG 166


>gi|289641149|ref|ZP_06473317.1| ribosomal protein S5 [Frankia symbiont of Datisca glomerata]
 gi|289509090|gb|EFD30021.1| ribosomal protein S5 [Frankia symbiont of Datisca glomerata]
          Length = 202

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 77/188 (40%), Positives = 114/188 (60%), Gaps = 2/188 (1%)

Query: 3   QKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHS 62
           ++ER  R      ++  N+ V+R+VAINRV+  + GGRRF+F+ LVVVGD    VG  + 
Sbjct: 16  RRERRDRQGGGPAQD-KNAYVERVVAINRVAKVVKGGRRFSFTALVVVGDADGTVGVGYG 74

Query: 63  TAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGA 122
            A+EVP A+ K  E AK++   V  + G T+ H   G   AG V+++ A  GTGVIAGG 
Sbjct: 75  KAKEVPAAIAKGVEEAKKHFFKVPRI-GSTIPHPIQGEAAAGIVLLKPASPGTGVIAGGP 133

Query: 123 IRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVV 182
           +RAV E  G+HDV++KS+GSSNP N++ AT   LR    P ++A RRG+    +    ++
Sbjct: 134 VRAVLECAGVHDVLSKSLGSSNPINIVHATVAALRGLMRPEEIAARRGLPIEDVAPPAML 193

Query: 183 SSKSSSYS 190
            +++    
Sbjct: 194 RARTVGAG 201


>gi|148821926|ref|YP_001286680.1| 30S ribosomal protein S5 [Mycobacterium tuberculosis F11]
 gi|148720453|gb|ABR05078.1| 30S ribosomal protein S5 rpsE [Mycobacterium tuberculosis F11]
          Length = 220

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 74/180 (41%), Positives = 109/180 (60%), Gaps = 1/180 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            R+   ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K
Sbjct: 34  ERDGEKSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAK 93

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A+++     L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+H
Sbjct: 94  GVEEARKSFFRAPLI-GGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVH 152

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           D++AKS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S +  +
Sbjct: 153 DILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRKSEALAA 212


>gi|50843301|ref|YP_056528.1| 30S ribosomal protein S5 [Propionibacterium acnes KPA171202]
 gi|289424828|ref|ZP_06426610.1| ribosomal protein S5 [Propionibacterium acnes SK187]
 gi|289427637|ref|ZP_06429349.1| ribosomal protein S5 [Propionibacterium acnes J165]
 gi|295131370|ref|YP_003582033.1| ribosomal protein S5 [Propionibacterium acnes SK137]
 gi|73919087|sp|Q6A6P3|RS5_PROAC RecName: Full=30S ribosomal protein S5
 gi|50840903|gb|AAT83570.1| 30S ribosomal protein S5 [Propionibacterium acnes KPA171202]
 gi|289154791|gb|EFD03474.1| ribosomal protein S5 [Propionibacterium acnes SK187]
 gi|289159128|gb|EFD07320.1| ribosomal protein S5 [Propionibacterium acnes J165]
 gi|291375693|gb|ADD99547.1| ribosomal protein S5 [Propionibacterium acnes SK137]
 gi|313763220|gb|EFS34584.1| ribosomal protein S5 [Propionibacterium acnes HL013PA1]
 gi|313773135|gb|EFS39101.1| ribosomal protein S5 [Propionibacterium acnes HL074PA1]
 gi|313793275|gb|EFS41333.1| ribosomal protein S5 [Propionibacterium acnes HL110PA1]
 gi|313801081|gb|EFS42349.1| ribosomal protein S5 [Propionibacterium acnes HL110PA2]
 gi|313808822|gb|EFS47276.1| ribosomal protein S5 [Propionibacterium acnes HL087PA2]
 gi|313810384|gb|EFS48098.1| ribosomal protein S5 [Propionibacterium acnes HL083PA1]
 gi|313812280|gb|EFS49994.1| ribosomal protein S5 [Propionibacterium acnes HL025PA1]
 gi|313816557|gb|EFS54271.1| ribosomal protein S5 [Propionibacterium acnes HL059PA1]
 gi|313819915|gb|EFS57629.1| ribosomal protein S5 [Propionibacterium acnes HL036PA1]
 gi|313823405|gb|EFS61119.1| ribosomal protein S5 [Propionibacterium acnes HL036PA2]
 gi|313824877|gb|EFS62591.1| ribosomal protein S5 [Propionibacterium acnes HL063PA1]
 gi|313828381|gb|EFS66095.1| ribosomal protein S5 [Propionibacterium acnes HL063PA2]
 gi|313830119|gb|EFS67833.1| ribosomal protein S5 [Propionibacterium acnes HL007PA1]
 gi|313832610|gb|EFS70324.1| ribosomal protein S5 [Propionibacterium acnes HL056PA1]
 gi|313837966|gb|EFS75680.1| ribosomal protein S5 [Propionibacterium acnes HL086PA1]
 gi|314914349|gb|EFS78180.1| ribosomal protein S5 [Propionibacterium acnes HL005PA4]
 gi|314917669|gb|EFS81500.1| ribosomal protein S5 [Propionibacterium acnes HL050PA1]
 gi|314919599|gb|EFS83430.1| ribosomal protein S5 [Propionibacterium acnes HL050PA3]
 gi|314925771|gb|EFS89602.1| ribosomal protein S5 [Propionibacterium acnes HL036PA3]
 gi|314930190|gb|EFS94021.1| ribosomal protein S5 [Propionibacterium acnes HL067PA1]
 gi|314957203|gb|EFT01307.1| ribosomal protein S5 [Propionibacterium acnes HL027PA1]
 gi|314957779|gb|EFT01882.1| ribosomal protein S5 [Propionibacterium acnes HL002PA1]
 gi|314963525|gb|EFT07625.1| ribosomal protein S5 [Propionibacterium acnes HL082PA1]
 gi|314973032|gb|EFT17128.1| ribosomal protein S5 [Propionibacterium acnes HL053PA1]
 gi|314975528|gb|EFT19623.1| ribosomal protein S5 [Propionibacterium acnes HL045PA1]
 gi|314979730|gb|EFT23824.1| ribosomal protein S5 [Propionibacterium acnes HL072PA2]
 gi|314984904|gb|EFT28996.1| ribosomal protein S5 [Propionibacterium acnes HL005PA1]
 gi|314986071|gb|EFT30163.1| ribosomal protein S5 [Propionibacterium acnes HL005PA2]
 gi|314988686|gb|EFT32777.1| ribosomal protein S5 [Propionibacterium acnes HL005PA3]
 gi|315077147|gb|EFT49214.1| ribosomal protein S5 [Propionibacterium acnes HL053PA2]
 gi|315079833|gb|EFT51809.1| ribosomal protein S5 [Propionibacterium acnes HL078PA1]
 gi|315083201|gb|EFT55177.1| ribosomal protein S5 [Propionibacterium acnes HL027PA2]
 gi|315089938|gb|EFT61914.1| ribosomal protein S5 [Propionibacterium acnes HL072PA1]
 gi|315096740|gb|EFT68716.1| ribosomal protein S5 [Propionibacterium acnes HL038PA1]
 gi|315097968|gb|EFT69944.1| ribosomal protein S5 [Propionibacterium acnes HL059PA2]
 gi|315100611|gb|EFT72587.1| ribosomal protein S5 [Propionibacterium acnes HL046PA1]
 gi|315106056|gb|EFT78032.1| ribosomal protein S5 [Propionibacterium acnes HL030PA1]
 gi|315109215|gb|EFT81191.1| ribosomal protein S5 [Propionibacterium acnes HL030PA2]
 gi|327325154|gb|EGE66960.1| ribosomal protein S5 [Propionibacterium acnes HL096PA3]
 gi|327325216|gb|EGE67021.1| ribosomal protein S5 [Propionibacterium acnes HL096PA2]
 gi|327332726|gb|EGE74460.1| ribosomal protein S5 [Propionibacterium acnes HL097PA1]
 gi|327444017|gb|EGE90671.1| ribosomal protein S5 [Propionibacterium acnes HL043PA1]
 gi|327449355|gb|EGE96009.1| ribosomal protein S5 [Propionibacterium acnes HL013PA2]
 gi|327449417|gb|EGE96071.1| ribosomal protein S5 [Propionibacterium acnes HL043PA2]
 gi|327451438|gb|EGE98092.1| ribosomal protein S5 [Propionibacterium acnes HL087PA3]
 gi|327451587|gb|EGE98241.1| ribosomal protein S5 [Propionibacterium acnes HL092PA1]
 gi|327451874|gb|EGE98528.1| ribosomal protein S5 [Propionibacterium acnes HL083PA2]
 gi|328752088|gb|EGF65704.1| ribosomal protein S5 [Propionibacterium acnes HL087PA1]
 gi|328755516|gb|EGF69132.1| ribosomal protein S5 [Propionibacterium acnes HL025PA2]
 gi|328756300|gb|EGF69916.1| ribosomal protein S5 [Propionibacterium acnes HL020PA1]
 gi|328761366|gb|EGF74893.1| ribosomal protein S5 [Propionibacterium acnes HL099PA1]
          Length = 215

 Score =  174 bits (440), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 1/177 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
             R    +R    N  ++R+VAINRV+  + GGRRF+F+ LVVVGD +  VG  +  A+E
Sbjct: 19  DNRRGQNDRNRNQNEYLERVVAINRVAKVVQGGRRFSFTALVVVGDGEGSVGVGYGKAKE 78

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP A+ KA E AK++   V L+ GRT+ H  +G   AG V++R A  GTGVIAGG+ RAV
Sbjct: 79  VPAAIAKAVEEAKKHFFKVPLV-GRTITHPVIGEKAAGVVMLRPASPGTGVIAGGSARAV 137

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
            E  G+HDV+AKS+GSSN  NV+ AT + L+    P +VA RRG     +    ++ 
Sbjct: 138 LECAGVHDVLAKSLGSSNAINVVHATVDALQQLEEPEEVARRRGKSVEDIAPAAMLR 194


>gi|304413162|ref|ZP_07394635.1| 30S ribosomal subunit protein S5 [Candidatus Regiella insecticola
           LSR1]
 gi|304284005|gb|EFL92398.1| 30S ribosomal subunit protein S5 [Candidatus Regiella insecticola
           LSR1]
          Length = 166

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR F+F+ L VVG+ + +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGNGEGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM+ V L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV +V G+H
Sbjct: 63  AMEKARRNMMKVPLHN-GTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLDVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLAKTYGSTNPINVVRATVDALANMKSPEMVAAKRGKSVEEILG 166


>gi|157377432|ref|YP_001476032.1| 30S ribosomal protein S5 [Shewanella sediminis HAW-EB3]
 gi|157319806|gb|ABV38904.1| ribosomal protein S5 [Shewanella sediminis HAW-EB3]
          Length = 167

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 113/166 (68%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +   ++ + + +++VA+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++
Sbjct: 3   KFEAQQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RN++SV L++  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNIVSVELIN-GTLHHPVKGRHTGSRVYMQPASDGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 122 HNVLSKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVDEIRG 167


>gi|150015060|ref|YP_001307314.1| 30S ribosomal protein S5 [Clostridium beijerinckii NCIMB 8052]
 gi|149901525|gb|ABR32358.1| ribosomal protein S5 [Clostridium beijerinckii NCIMB 8052]
          Length = 165

 Score =  174 bits (440), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 98/165 (59%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGR F FS LVVVGD    VG     + E+PEA++K
Sbjct: 2   RIDPSTLDLKEKVVFINRVTKVVKGGRNFRFSALVVVGDENGHVGVGMGKSIEIPEAIKK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++SV+++ G T+ H   G+ G   V++  A  GTGVIAGG  RAV E+ G+ 
Sbjct: 62  GIEDAKKNLVSVAMV-GTTIPHQVNGKFGTANVLIMPAKEGTGVIAGGPARAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP+N++ AT   L S     D+A  RG     +  
Sbjct: 121 DVRAKSLGSNNPNNMVNATINGLASLRTVEDIAKLRGKSVEEILG 165


>gi|261342773|ref|ZP_05970631.1| ribosomal protein S5 [Enterobacter cancerogenus ATCC 35316]
 gi|296105011|ref|YP_003615157.1| 30S ribosomal protein S5 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|288314951|gb|EFC53889.1| ribosomal protein S5 [Enterobacter cancerogenus ATCC 35316]
 gi|295059470|gb|ADF64208.1| 30S ribosomal protein S5 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295096944|emb|CBK86034.1| ribosomal protein S5, bacterial/organelle type [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 166

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILG 166


>gi|54778758|gb|AAV39592.1| ribosomal protein S5 [synthetic construct]
          Length = 194

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 29  EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 88

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 89  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 147

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  + +
Sbjct: 148 LAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGKGI 193


>gi|323144981|ref|ZP_08079541.1| ribosomal protein S5 [Succinatimonas hippei YIT 12066]
 gi|322415260|gb|EFY06034.1| ribosomal protein S5 [Succinatimonas hippei YIT 12066]
          Length = 168

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 73/167 (43%), Positives = 104/167 (62%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               E +   + +++VA+NRV+  + GGR F+F+ L VVGD K +VG+ +  A EVP A+
Sbjct: 2   QHKDESQAGELQEKLVAVNRVAKVVKGGRIFSFTALTVVGDGKGRVGYGYGKAGEVPAAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA E A+RN+ S   L   TL H   GRH    V ++ A  GTG+IAGGA+RAV EV G
Sbjct: 62  QKAIEQARRNIHSHIELKDGTLFHPIKGRHSGSMVYLQPASEGTGIIAGGAMRAVLEVAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + +V+AK+ GS+NP NV+RAT + L S   P  VA +RG+    +  
Sbjct: 122 VRNVLAKAYGSTNPINVVRATVDALASMRTPESVAAKRGLSVKDILE 168


>gi|260468537|ref|ZP_05813704.1| ribosomal protein S5 [Mesorhizobium opportunistum WSM2075]
 gi|319783337|ref|YP_004142813.1| ribosomal protein S5 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|259028693|gb|EEW30002.1| ribosomal protein S5 [Mesorhizobium opportunistum WSM2075]
 gi|317169225|gb|ADV12763.1| ribosomal protein S5 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 187

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 107/167 (64%), Positives = 133/167 (79%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
           +VD++V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATE+AKR+
Sbjct: 21  MVDKLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATESAKRD 80

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           MI V L  GRTLHHD  GR GAG+V++R+A  GTG+IAGG +RAV E LGMHDVVAKS+G
Sbjct: 81  MIFVPLRSGRTLHHDVEGRWGAGRVLLRAAKQGTGIIAGGPMRAVFETLGMHDVVAKSMG 140

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           SSNP+N++RATF+ L+SQ HP+DVA  RGIK+S LQARR  +  +  
Sbjct: 141 SSNPYNMVRATFDALKSQMHPKDVAAARGIKYSTLQARRGTAVAAEE 187


>gi|29244648|gb|AAO73241.1| putative ribosomal protein S5 [Oryza sativa Japonica Group]
          Length = 327

 Score =  173 bits (439), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 61/167 (36%), Positives = 93/167 (55%), Gaps = 1/167 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +    +   +   +R+V +NRV+  + GGR+ +F  +VVVGD K  VG     A+EV EA
Sbjct: 159 DMDREQRPSDEFSERVVQVNRVTKVVKGGRQLSFRAIVVVGDMKGHVGVGVGKAKEVTEA 218

Query: 71  VRKATEAAKRNMISVSLLDGRTLHH-DGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           + KA    +RN+++V L    T  H      +GA +V++R A  G+GVIAGGA+R V E+
Sbjct: 219 ITKAAMNGRRNLVTVPLTKYSTFPHSRADADYGAARVMLRPACPGSGVIAGGAVRVVLEM 278

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            G+ + + K + S NP N  RAT +  +     +DVA  RG+    L
Sbjct: 279 AGVENALGKQLRSKNPLNNARATIKATQMMRQFKDVAAERGLPMEQL 325


>gi|320352930|ref|YP_004194269.1| 30S ribosomal protein S5P [Desulfobulbus propionicus DSM 2032]
 gi|320121432|gb|ADW16978.1| SSU ribosomal protein S5P [Desulfobulbus propionicus DSM 2032]
          Length = 170

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/167 (41%), Positives = 106/167 (63%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            ++++     ++++IV INRV+  + GGRRF+FS +VVVGD   KVG+    A +VPEA+
Sbjct: 5   KKSKDGIQEELIEKIVFINRVAKVVKGGRRFSFSAIVVVGDGHGKVGYGLGKANQVPEAI 64

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  E A+++M  VSL    ++ HD VG+  +G V+++ A  GTGVIAGGA+RAV E  G
Sbjct: 65  RKGIEQARKDMQHVSLTSV-SIPHDVVGQFKSGSVMLKPASDGTGVIAGGAVRAVLEAAG 123

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + +++ K +GS+NPHN+++AT   LR       +A  R      + A
Sbjct: 124 VQNILTKCLGSNNPHNLVKATMNGLRRLRTAEQIAKLRNKTIEEIAA 170


>gi|226323027|ref|ZP_03798545.1| hypothetical protein COPCOM_00799 [Coprococcus comes ATCC 27758]
 gi|225208594|gb|EEG90948.1| hypothetical protein COPCOM_00799 [Coprococcus comes ATCC 27758]
          Length = 169

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KQERIDANQLELTEKVVSIKRVTKVVKGGRNMRFTALVVVGDGNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +I V+L +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKLIKVTLDENDSITHDYIGKFGSASVLLKKAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E L     P DVA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIEGLSQLKAPEDVAKLRGKTVEEILG 169


>gi|209884830|ref|YP_002288687.1| ribosomal protein S5 [Oligotropha carboxidovorans OM5]
 gi|226703367|sp|B6JEY2|RS5_OLICO RecName: Full=30S ribosomal protein S5
 gi|209873026|gb|ACI92822.1| ribosomal protein S5 [Oligotropha carboxidovorans OM5]
          Length = 192

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 105/171 (61%), Positives = 132/171 (77%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VD++V INRV+  + GG+RF F+ LVV+GD K +VGF H  AREVPEA+RKAT++AK
Sbjct: 22  SEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFGHGKAREVPEAIRKATDSAK 81

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RN+  V L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKS
Sbjct: 82  RNLTRVPLREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIQDVVAKS 141

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +GSSNP+N+IRATF+ L+ Q  PR VANRR IK S+LQARRV     +S  
Sbjct: 142 VGSSNPYNMIRATFDALKHQDSPRSVANRRNIKVSVLQARRVGGDAEASAD 192


>gi|238783183|ref|ZP_04627209.1| hypothetical protein yberc0001_2690 [Yersinia bercovieri ATCC
           43970]
 gi|238797224|ref|ZP_04640725.1| hypothetical protein ymoll0001_2840 [Yersinia mollaretii ATCC
           43969]
 gi|238715979|gb|EEQ07965.1| hypothetical protein yberc0001_2690 [Yersinia bercovieri ATCC
           43970]
 gi|238718861|gb|EEQ10676.1| hypothetical protein ymoll0001_2840 [Yersinia mollaretii ATCC
           43969]
          Length = 167

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R MI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRAMINVALDN-GTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT   L     P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATILALEDMKSPEMVAAKRGKSVEEILGK 167


>gi|302336364|ref|YP_003801571.1| SSU ribosomal protein S5P [Olsenella uli DSM 7084]
 gi|301320204|gb|ADK68691.1| SSU ribosomal protein S5P [Olsenella uli DSM 7084]
          Length = 173

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 68/172 (39%), Positives = 107/172 (62%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
               + + D+ + +R+V I+RVS  + GGRR +   LVVVGD K  VG     + EVP A
Sbjct: 2   PRDRKRQNDSDLQERVVYIHRVSKTVKGGRRMSLLALVVVGDGKGNVGIGTGKSAEVPLA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA + AK+NM  V + +  ++ H   G  GAG+V+++ A  GTGVIAGG +R + E+ 
Sbjct: 62  IQKAVDDAKKNMFKVPVTEHGSIPHAVEGHFGAGRVLIKPAFEGTGVIAGGPVRPLFELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVV 182
           G+++V++KS+G+ N  N+I+A  E L+S S P D A RRG+  S + + +  
Sbjct: 122 GINNVLSKSLGTDNALNIIKAAAEGLKSLSSPEDSAERRGLTVSEMFSGKEA 173


>gi|94676648|ref|YP_588793.1| ribosomal protein S5 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|172046200|sp|Q1LTC1|RS5_BAUCH RecName: Full=30S ribosomal protein S5
 gi|94219798|gb|ABF13957.1| ribosomal protein S5 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 167

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 72/161 (44%), Positives = 106/161 (65%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++ + + ++++A+NRVS  + GGR F+F+ L VVGD+  +VGF +  AREVP A++KA 
Sbjct: 5   EKQISDLQEKLIAVNRVSKTVKGGRIFSFTALTVVGDSNGRVGFGYGKAREVPTAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           + A+RNM ++ L  G TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  DKARRNMTTIVLNSGGTLQHSIKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVTGIRNV 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +AK+ GS+NP NV+RAT   L     P  +A +RG     +
Sbjct: 125 LAKTYGSTNPINVVRATINALNKMKSPEMIAAKRGKTIEEI 165


>gi|226329499|ref|ZP_03805017.1| hypothetical protein PROPEN_03408 [Proteus penneri ATCC 35198]
 gi|225202685|gb|EEG85039.1| hypothetical protein PROPEN_03408 [Proteus penneri ATCC 35198]
          Length = 166

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM +VSL +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMKTVSL-NNGTLFHPVKGTHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPDMVAAKRGKSVEEILG 166


>gi|312899060|ref|ZP_07758444.1| ribosomal protein S5 [Megasphaera micronuciformis F0359]
 gi|310619845|gb|EFQ03421.1| ribosomal protein S5 [Megasphaera micronuciformis F0359]
          Length = 166

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 106/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + + +V INRV+  + GGRRF+FS LVVVGD   +VG     A EVPEA+RK
Sbjct: 3   KVDHTGLELQENVVFINRVAKVVKGGRRFSFSALVVVGDGNGRVGAGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+++++V+L +  ++ +   G  GAGKV+++ A  GTGVIAGG +RAV E++G+ 
Sbjct: 63  GVEDAKKHLVTVNLKN-GSIPYKTTGVFGAGKVMLKPAAEGTGVIAGGPVRAVLELVGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +++ KS+GSSNP+N++RAT E L      ++VA  RG     +  
Sbjct: 122 NILTKSLGSSNPNNMVRATIEGLSQLKDVKEVAELRGKTVEEIYG 166


>gi|86135784|ref|ZP_01054363.1| 30S ribosomal protein S5 [Roseobacter sp. MED193]
 gi|85826658|gb|EAQ46854.1| 30S ribosomal protein S5 [Roseobacter sp. MED193]
          Length = 189

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 97/161 (60%), Positives = 120/161 (74%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R M+ V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RQMVRVPLKEGRTLHHDMNGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           IGS NP+N+IRAT + L  +  PR VA RRG K + +  +R
Sbjct: 138 IGSQNPYNMIRATIDGLTKEQSPRSVAQRRGKKVADILPKR 178


>gi|152972210|ref|YP_001337356.1| 30S ribosomal protein S5 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238896799|ref|YP_002921544.1| 30S ribosomal protein S5 [Klebsiella pneumoniae NTUH-K2044]
 gi|262045160|ref|ZP_06018187.1| 30S ribosomal protein S5 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330002277|ref|ZP_08304271.1| ribosomal protein S5 [Klebsiella sp. MS 92-3]
 gi|189045420|sp|A6TEV5|RS5_KLEP7 RecName: Full=30S ribosomal protein S5
 gi|150957059|gb|ABR79089.1| 30S ribosomal protein S5 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238549126|dbj|BAH65477.1| 30S ribosomal protein S5 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259037480|gb|EEW38724.1| 30S ribosomal protein S5 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328537350|gb|EGF63600.1| ribosomal protein S5 [Klebsiella sp. MS 92-3]
          Length = 167

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMINVAL-NHGTLQHPVKGTHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMKSPDMVAAKRGKSVEEILGK 167


>gi|77361717|ref|YP_341292.1| 30S ribosomal protein S5 [Pseudoalteromonas haloplanktis TAC125]
 gi|91207880|sp|Q3IJK2|RS5_PSEHT RecName: Full=30S ribosomal protein S5
 gi|76876628|emb|CAI87850.1| 30S ribosomal subunit protein S5 [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 168

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++   + ++++A+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++K
Sbjct: 5   EAKQQQPDLAEKLIAVNRVSKVVKGGRIFSFTALTVVGDGAGKVGFGYGKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V L +G TL H   GRH   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 65  AMEKARRNMINVDL-NGNTLQHPVKGRHAGSQVFMKPASEGTGIIAGGAMRAVLEVTGVQ 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K  GS+NP NV+RAT   L + + P+ +A +RG++   +  
Sbjct: 124 NVLSKCYGSTNPINVVRATISALENMNSPQSIAAKRGLRIDEILG 168


>gi|148655320|ref|YP_001275525.1| 30S ribosomal protein S5 [Roseiflexus sp. RS-1]
 gi|172048079|sp|A5USH2|RS5_ROSS1 RecName: Full=30S ribosomal protein S5
 gi|148567430|gb|ABQ89575.1| SSU ribosomal protein S5P [Roseiflexus sp. RS-1]
          Length = 180

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/179 (41%), Positives = 105/179 (58%), Gaps = 1/179 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +     +  + +R+V INRVS  + GGRRF+FS +VVVGD K  VG     A EVPEA+
Sbjct: 3   KRRINADELELEERVVQINRVSKVVKGGRRFSFSTVVVVGDGKGHVGIGMGKAAEVPEAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  EAAK+N+I V L  G T+ H+      A KV +  A  GTGVIAG  +R V E+ G
Sbjct: 63  RKGVEAAKKNLIRVPLS-GTTIPHEVQMEFAASKVRLLPAAPGTGVIAGRGVRPVLEMAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           + DV++K  GS+NP NV++ATF+ L + +   + A  RG+    L  RR+    +   +
Sbjct: 122 IKDVLSKRYGSNNPINVVKATFKALSALTSLEEQARMRGMTPRELNLRRMRREPAPQEA 180


>gi|37528526|ref|NP_931871.1| 30S ribosomal protein S5 [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|73919083|sp|Q7MYG8|RS5_PHOLL RecName: Full=30S ribosomal protein S5
 gi|36787964|emb|CAE17081.1| 30S ribosomal protein S5 [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 166

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM +V+L +  TL+H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMKTVAL-NSGTLYHPVKGAHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG 166


>gi|256821679|ref|YP_003145642.1| 30S ribosomal protein S5 [Kangiella koreensis DSM 16069]
 gi|256795218|gb|ACV25874.1| ribosomal protein S5 [Kangiella koreensis DSM 16069]
          Length = 167

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 80/160 (50%), Positives = 107/160 (66%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
                +V+++V +NRV+  + GGR F F+ L VVGD K KVGF    A+EVP A++KA E
Sbjct: 6   NNQEGLVEKLVNVNRVAKVVKGGRIFGFTALTVVGDGKGKVGFGRGKAKEVPVAIQKAME 65

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+RNMI V L DG TL H     HGA KV M+ A  GTG+IAGGA+RAV EVLG+ +++
Sbjct: 66  QARRNMIQVELKDGHTLQHAVKAAHGASKVYMQPASEGTGIIAGGAMRAVFEVLGIQNIL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           AKSIGS+NP N++RAT   L+  + P D+A +RG     +
Sbjct: 126 AKSIGSTNPINIVRATINGLKQMTSPEDMAAKRGKTVEEI 165


>gi|319899082|ref|YP_004159175.1| 30S ribosomal protein S5 [Bartonella clarridgeiae 73]
 gi|319403046|emb|CBI76601.1| 30S ribosomal protein S5 [Bartonella clarridgeiae 73]
          Length = 186

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 113/180 (62%), Positives = 142/180 (78%), Gaps = 2/180 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MAQ  + + D  + R+ERD+  VD++V INRVS  + GGRRF F+ LVVVGD K +VGF 
Sbjct: 1   MAQ--KERSDRDERRDERDSEFVDKLVHINRVSKVVKGGRRFGFAALVVVGDQKGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE+AKR MI + L  GRTLHHD  GRHGAG V+MR+A AGTG+IAG
Sbjct: 59  HGKAREVPEAIRKATESAKRAMIYIPLRSGRTLHHDVEGRHGAGYVLMRAASAGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RA+ E LGM DVVAKS+GSSNP+N++RA F+ L+ Q HP+D+A +RGIK+S+LQARR
Sbjct: 119 GPMRAIFETLGMQDVVAKSLGSSNPYNMVRAAFDALKRQVHPKDIAAQRGIKYSVLQARR 178


>gi|163815992|ref|ZP_02207362.1| hypothetical protein COPEUT_02172 [Coprococcus eutactus ATCC 27759]
 gi|158448802|gb|EDP25797.1| hypothetical protein COPEUT_02172 [Coprococcus eutactus ATCC 27759]
          Length = 186

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 62/175 (35%), Positives = 100/175 (57%)

Query: 2   AQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAH 61
           + KE  QR   +  +     + D++VAI RV+  + GGR    + LVVVGD    VG   
Sbjct: 10  SSKEEEQRMKREIIDASKLELEDKVVAIKRVTKVVKGGRNSRVAALVVVGDRNGHVGVGV 69

Query: 62  STAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGG 121
             A E PEA+RK  E A +++++V + +  ++ +D  G+ G+  V++++A  GTG+IAGG
Sbjct: 70  GKAVETPEAIRKGKEDAAKHLVTVPVNEVGSIPYDWNGQFGSASVLLKTAPEGTGIIAGG 129

Query: 122 AIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
             R+V E+ G  ++  KS+GS+N  NV+ AT + L    +P D+A  RG     +
Sbjct: 130 PARSVLELAGYKNIRTKSLGSNNKQNVVLATIKGLTEIKNPEDIARLRGKSVDEI 184


>gi|308190078|ref|YP_003923009.1| 30S ribosomal protein S5 [Mycoplasma fermentans JER]
 gi|319777374|ref|YP_004137025.1| 30S ribosomal protein s5 [Mycoplasma fermentans M64]
 gi|307624820|gb|ADN69125.1| 30S ribosomal protein S5 [Mycoplasma fermentans JER]
 gi|318038449|gb|ADV34648.1| 30S ribosomal protein S5 [Mycoplasma fermentans M64]
          Length = 236

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 63/175 (36%), Positives = 109/175 (62%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           ++ ++RD   + +  DN   +++V I+RV+  + GGRRF+F+  VVVGD K +VGF H  
Sbjct: 62  EKGNRRDRRNHFDASDNEFSEKVVNISRVTKVVKGGRRFSFAAFVVVGDKKGRVGFGHGK 121

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EVP++++KA + AK ++I+V + +  T+ H+   +  A +V+++ A  G G++A G +
Sbjct: 122 ANEVPDSIKKAVKDAKNHLITVPIQNKITVPHEVHAKFLASRVMLKPATKGKGIVASGTV 181

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           RAV E+ G  D+  K+ GS +  N++RAT + L++   P  +A+ RG     L A
Sbjct: 182 RAVVELAGYTDIYTKTYGSRSKANIVRATLKALQALRTPEQIADIRGKDVKDLLA 236


>gi|290968227|ref|ZP_06559770.1| ribosomal protein S5 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781709|gb|EFD94294.1| ribosomal protein S5 [Megasphaera genomosp. type_1 str. 28L]
          Length = 166

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + + +V INRV+  + GGRRF+FS LVVVGD   +VG     A EVPEA+RK
Sbjct: 3   KVDHAGLELQENVVFINRVAKVVKGGRRFSFSALVVVGDGNGRVGAGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++++SV L +  ++ H  +G  GAG+V+++ A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  GVEDAKKHLVSVPLKN-GSIPHQIIGIFGAGQVLLKPAAEGTGVIAGGPVRAVLELAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +++ KSIGSSNP+N+++AT E L        VA  RG     +  
Sbjct: 122 NILTKSIGSSNPNNMVQATIEGLTRLKDVNKVAELRGKTVEEIYG 166


>gi|255536137|ref|YP_003096508.1| 30S ribosomal protein S5 [Flavobacteriaceae bacterium 3519-10]
 gi|255342333|gb|ACU08446.1| SSU ribosomal protein S5p (S2e) [Flavobacteriaceae bacterium
           3519-10]
          Length = 173

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/168 (43%), Positives = 106/168 (63%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           DN +  +     + DR+V++NRV+    GGR F FS +VVVGD    VGF    ++EV  
Sbjct: 5   DNIEKVKPGGLELKDRLVSVNRVTKVTKGGRAFGFSAIVVVGDEAGTVGFGLGKSKEVAS 64

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ V +++  T+ H    R+G   + +R A  GTG+IAGGA+RAV E 
Sbjct: 65  AIAKAVEDAKKNLVKVPVIN-HTIPHQSSARYGGADIFLRPASHGTGLIAGGAVRAVLES 123

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            G+HD+++KS GSSNPHNV++ATF+ L     P D+A  RG+  S + 
Sbjct: 124 AGVHDILSKSKGSSNPHNVVKATFKALLDIRRPEDIAKLRGVSLSKVF 171


>gi|192359431|ref|YP_001981225.1| 30S ribosomal protein S5 [Cellvibrio japonicus Ueda107]
 gi|190685596|gb|ACE83274.1| ribosomal protein S5 [Cellvibrio japonicus Ueda107]
          Length = 170

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 79/167 (47%), Positives = 111/167 (66%), Gaps = 1/167 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           +  +  E  +  + +++V +NRV+  + GGR FAF+ L VVGD   +VGF    AREVP 
Sbjct: 3   NAKREEENNNEGLQEKLVQVNRVAKTVKGGRIFAFTALTVVGDGNGRVGFGRGKAREVPT 62

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++KA EAA+RNMI+V L +G T+ +   G HGA KV M+ A  GTGVIAGGA+RAV E+
Sbjct: 63  AIQKAMEAARRNMITVDL-NGDTIQYPTKGAHGASKVYMQPASQGTGVIAGGAMRAVLEI 121

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            G+ +V++K  GS+NP NV+RATF  L++ S P  VA +RG     +
Sbjct: 122 AGIQNVLSKCYGSTNPVNVVRATFNALKAMSSPETVAAKRGKTVEEI 168


>gi|153812881|ref|ZP_01965549.1| hypothetical protein RUMOBE_03288 [Ruminococcus obeum ATCC 29174]
 gi|149831093|gb|EDM86182.1| hypothetical protein RUMOBE_03288 [Ruminococcus obeum ATCC 29174]
          Length = 169

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 63/168 (37%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KNNLIDASQLELEDKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +++V+  +  ++ HD VG+ G+ +++++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKLVTVARDENNSITHDYVGKFGSAEMLLKRAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  K +GS N  NV+ AT E L     P +VA  RG     + A
Sbjct: 122 GIKNIRTKCMGSRNKQNVVLATIEGLSKLKTPEEVAKLRGKSVEEILA 169


>gi|329893616|ref|ZP_08269750.1| SSU ribosomal protein S5p (S2e) [gamma proteobacterium IMCC3088]
 gi|328923543|gb|EGG30855.1| SSU ribosomal protein S5p (S2e) [gamma proteobacterium IMCC3088]
          Length = 168

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 82/164 (50%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q +++ +  + +++V +NRV+  + GGR F+F+ L VVGD   KVGF    AREVP A++
Sbjct: 4   QRKQQTEGDLQEKLVQVNRVAKVVKGGRIFSFTALTVVGDGNGKVGFGRGKAREVPVAIQ 63

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L DG T+ +    RHGA KV M+ A  GTGVIAGGA+RAV E+ G+
Sbjct: 64  KAMEAARRNMIQVEL-DGGTIQYPIKARHGASKVYMQPASEGTGVIAGGAMRAVLEIAGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            +V+AK  GS+NP NV+RATF  LR  + P DVA +RG     +
Sbjct: 123 ENVLAKCYGSTNPVNVVRATFNGLRDMASPDDVAAKRGKTVEEI 166


>gi|300775031|ref|ZP_07084894.1| 30S ribosomal protein S5 [Chryseobacterium gleum ATCC 35910]
 gi|300506846|gb|EFK37981.1| 30S ribosomal protein S5 [Chryseobacterium gleum ATCC 35910]
          Length = 173

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 72/168 (42%), Positives = 107/168 (63%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           DN +  +     + DR+VA+NRV+    GGR F FS +VVVG+ +  +GF    ++EV  
Sbjct: 5   DNIERVKPGGLELKDRLVAVNRVTKVTKGGRAFGFSAIVVVGNEEGVIGFGLGKSKEVAS 64

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ V +++  T+ H    R+G   + +R A  GTG+IAGGA+RAV E 
Sbjct: 65  AIAKAVEDAKKNLVKVPVMN-HTIPHQTTARYGGADIFLRPASHGTGLIAGGAVRAVLES 123

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            G+HD+++KS GSSNPHNV++ATF+ L     P ++A  RGI  S + 
Sbjct: 124 AGIHDILSKSKGSSNPHNVVKATFKALLDIRRPEEIARMRGISLSKVF 171


>gi|2780218|emb|CAA11205.1| ribosomal protein S5 [Salmonella typhimurium]
          Length = 167

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/164 (46%), Positives = 112/164 (68%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +VIM+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGVHTGLRVIMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK 167


>gi|253991672|ref|YP_003043028.1| 30S ribosomal protein S5 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783122|emb|CAQ86287.1| 30S ribosomal subunit protein S5 [Photorhabdus asymbiotica]
          Length = 166

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM +V+L +  TLHH   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMKTVAL-NSGTLHHPVKGAHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG 166


>gi|302876517|ref|YP_003845150.1| 30S ribosomal protein S5 [Clostridium cellulovorans 743B]
 gi|307687189|ref|ZP_07629635.1| 30S ribosomal protein S5 [Clostridium cellulovorans 743B]
 gi|302579374|gb|ADL53386.1| ribosomal protein S5 [Clostridium cellulovorans 743B]
          Length = 165

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 96/165 (58%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGR F FSVLVVVGD    VG     + E+PEA+RK
Sbjct: 2   KIDPSTLDLKEKVVHINRVAKVVKGGRNFRFSVLVVVGDENGHVGVGTGKSVEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ VS++ G T+ H   G  G G+V++  A  GTG+IAGG  R V E+ G+ 
Sbjct: 62  GIEDAKKNLVKVSVV-GNTVPHTFEGEFGRGRVLVMPATEGTGIIAGGPARIVLELAGIK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS NP N++ AT   L +     ++A  RG     +  
Sbjct: 121 DVRAKSLGSKNPKNMVNATINALSNMRTVEEIAALRGKTVEEIIG 165


>gi|255536781|ref|XP_002509457.1| 30S ribosomal protein S5, putative [Ricinus communis]
 gi|223549356|gb|EEF50844.1| 30S ribosomal protein S5, putative [Ricinus communis]
          Length = 309

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 95/166 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +   RE+  +   +R+V + RV+  + GG++  F  +VVVGD + +VG     A+EV  A
Sbjct: 142 SKGKREKIRDGFEERVVQVRRVTKVVKGGKQLHFRAIVVVGDKQGQVGVGVGKAKEVIAA 201

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           V+K+   A+RN+I+V +    T  H   G +GA KV++R A  GTGVIAGGA+R V E+ 
Sbjct: 202 VQKSAVNARRNIITVPMTKYLTFPHRSDGDYGAAKVMLRPASPGTGVIAGGAVRIVLEMA 261

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K IGS N  N  RAT   ++      DVA  RGI    L
Sbjct: 262 GVENALGKQIGSKNALNNARATVVAVQKMRQFSDVARERGIPMEEL 307


>gi|260425859|ref|ZP_05779838.1| ribosomal protein S5 [Citreicella sp. SE45]
 gi|260420351|gb|EEX13602.1| ribosomal protein S5 [Citreicella sp. SE45]
          Length = 195

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 100/175 (57%), Positives = 129/175 (73%), Gaps = 1/175 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 21  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 80

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAG+V+MR+A  GTG+IAGG +RAV E+LG+HDVVAKS
Sbjct: 81  RKMIRVPLREGRTLHHDIEGRHGAGRVVMRTAPQGTGIIAGGPMRAVFEMLGVHDVVAKS 140

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV-VSSKSSSYSRDS 193
           IGS NP+N+IRAT   L  +  PR+VA RRG K + +  +R   +++S+  + ++
Sbjct: 141 IGSQNPYNMIRATLAGLGREQSPRNVAQRRGKKVADILPKREDAAAESTQVAEEA 195


>gi|242237876|ref|YP_002986057.1| 30S ribosomal protein S5 [Dickeya dadantii Ech703]
 gi|242129933|gb|ACS84235.1| ribosomal protein S5 [Dickeya dadantii Ech703]
          Length = 166

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLANMKSPEMVAAKRGKSVEEILG 166


>gi|255326860|ref|ZP_05367936.1| 30S ribosomal protein S5 [Rothia mucilaginosa ATCC 25296]
 gi|283457566|ref|YP_003362149.1| 30S ribosomal protein S5 [Rothia mucilaginosa DY-18]
 gi|255296077|gb|EET75418.1| 30S ribosomal protein S5 [Rothia mucilaginosa ATCC 25296]
 gi|283133564|dbj|BAI64329.1| ribosomal protein S5 [Rothia mucilaginosa DY-18]
          Length = 224

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 80/176 (45%), Positives = 109/176 (61%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           REE  +  ++R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K 
Sbjct: 48  REEEKDKYIERVVTINRVSKVVKGGRRFSFTALVVVGDGNGLVGVGYGKAKEVPAAISKG 107

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E AK+N   V  ++GRT+ H   G   AG V++R A AGTGVIAGG +RAV E  G+HD
Sbjct: 108 VEEAKKNFFRVPRIEGRTIPHRVQGEAAAGVVMLRPATAGTGVIAGGPVRAVLECAGIHD 167

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           V++KS+GSSN  N++ AT   L+    P  VA RRG+    +    + ++KS    
Sbjct: 168 VLSKSLGSSNQINIVHATVAALKELEEPLAVAARRGLPTDEVIPSYLRNTKSEKAG 223


>gi|238758778|ref|ZP_04619952.1| hypothetical protein yaldo0001_31940 [Yersinia aldovae ATCC 35236]
 gi|238703075|gb|EEP95618.1| hypothetical protein yaldo0001_31940 [Yersinia aldovae ATCC 35236]
          Length = 167

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R MI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRAMINVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT   L     P  VA +RG     +  +
Sbjct: 124 LAKTYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEEILGK 167


>gi|212708998|ref|ZP_03317126.1| hypothetical protein PROVALCAL_00030 [Providencia alcalifaciens DSM
           30120]
 gi|261346918|ref|ZP_05974562.1| ribosomal protein S5 [Providencia rustigianii DSM 4541]
 gi|212688364|gb|EEB47892.1| hypothetical protein PROVALCAL_00030 [Providencia alcalifaciens DSM
           30120]
 gi|282564983|gb|EFB70518.1| ribosomal protein S5 [Providencia rustigianii DSM 4541]
          Length = 166

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRV+  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVAKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R+M +V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRSMKTVAL-NNGTLFHPVKGTHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG 166


>gi|291547996|emb|CBL21104.1| SSU ribosomal protein S5P [Ruminococcus sp. SR1/5]
          Length = 169

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 60/168 (35%), Positives = 94/168 (55%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KRNLIDASQLELEDKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +++V+  +  ++ HD +G+ G+ +++++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKLVTVARDENNSITHDFIGKFGSAEMLLKRAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  K +GS N  NV+ AT   L     P +VA  RG     +  
Sbjct: 122 GIKNIRTKCMGSRNKQNVVLATIAGLSQLKTPEEVAKLRGKSVDEILG 169


>gi|253580636|ref|ZP_04857900.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848007|gb|EES75973.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 169

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 98/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KRNLIDASQLELEDKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +++V+  +  ++ HD VG++G+ +++++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAIKKLVTVARDENNSITHDFVGKYGSAEMLLKRAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  K +GS N  NV+ AT E LR    P +VA  RG     + A
Sbjct: 122 GIKNIRTKCMGSRNKQNVVLATIEGLRQLKTPEEVARLRGKSVDEILA 169


>gi|170728992|ref|YP_001763018.1| 30S ribosomal protein S5 [Shewanella woodyi ATCC 51908]
 gi|169814339|gb|ACA88923.1| ribosomal protein S5 [Shewanella woodyi ATCC 51908]
          Length = 168

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++ + + +++VA+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++K
Sbjct: 5   EAQQQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGFGYGKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RN++SV L +  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 65  AMEKARRNIVSVEL-NNGTLHHPVKGRHTGSRVYMQPASDGTGIIAGGAMRAVLEVAGVH 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 124 NVLSKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVDEIRG 168


>gi|123444081|ref|YP_001008051.1| 30S ribosomal protein S5 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238752672|ref|ZP_04614143.1| hypothetical protein yrohd0001_14070 [Yersinia rohdei ATCC 43380]
 gi|238763715|ref|ZP_04624674.1| hypothetical protein ykris0001_22900 [Yersinia kristensenii ATCC
           33638]
 gi|238792953|ref|ZP_04636583.1| hypothetical protein yinte0001_36120 [Yersinia intermedia ATCC
           29909]
 gi|332163243|ref|YP_004299820.1| 30S ribosomal protein S5 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|189045447|sp|A1JS11|RS5_YERE8 RecName: Full=30S ribosomal protein S5
 gi|122091042|emb|CAL13925.1| 30S ribosomal protein S5 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238698017|gb|EEP90775.1| hypothetical protein ykris0001_22900 [Yersinia kristensenii ATCC
           33638]
 gi|238709099|gb|EEQ01346.1| hypothetical protein yrohd0001_14070 [Yersinia rohdei ATCC 43380]
 gi|238727807|gb|EEQ19331.1| hypothetical protein yinte0001_36120 [Yersinia intermedia ATCC
           29909]
 gi|318607728|emb|CBY29226.1| SSU ribosomal protein S5p (S2e) [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667473|gb|ADZ44117.1| 30S ribosomal protein S5 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861838|emb|CBX72009.1| 30S ribosomal protein S5 [Yersinia enterocolitica W22703]
          Length = 167

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R MI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRAMINVALDN-GTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT   L     P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEEILGK 167


>gi|139438867|ref|ZP_01772327.1| Hypothetical protein COLAER_01331 [Collinsella aerofaciens ATCC
           25986]
 gi|133775578|gb|EBA39398.1| Hypothetical protein COLAER_01331 [Collinsella aerofaciens ATCC
           25986]
          Length = 174

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/181 (40%), Positives = 111/181 (61%), Gaps = 8/181 (4%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+ ++ QR          +   +R+V INRVS  + GGRR +   LVVVGD K  VG  
Sbjct: 1   MARNQKQQR--------EASEFEERVVYINRVSKTVKGGRRMSLVALVVVGDGKGNVGVG 52

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              + EVP A+ KA+  AK+NM  V + +  T+ H+ +G  GAG++I++ A+ GTGVIAG
Sbjct: 53  MGKSAEVPMAISKASLDAKKNMFHVPVTEQGTIPHEVLGHFGAGRIIIKPAVEGTGVIAG 112

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GA+R + E+ G+ +V++KS+G+ N  N+I+A  E L+  S P DVA RRG+  S +   +
Sbjct: 113 GAVRPLFELAGIKNVLSKSLGTDNGLNIIKAAVEGLKELSSPEDVAARRGLTVSEMFVGK 172

Query: 181 V 181
            
Sbjct: 173 E 173


>gi|227871784|ref|ZP_03990189.1| ribosomal protein S5 [Oribacterium sinus F0268]
 gi|227842385|gb|EEJ52610.1| ribosomal protein S5 [Oribacterium sinus F0268]
          Length = 169

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/168 (41%), Positives = 99/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + D +VAI RV+  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KREKIDANQLELNDSVVAIKRVAKTVKGGRTMRFSALVVVGDGNGHVGCGTGKATEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA EAA RNM++V + + +++ HD +G+ GA  V+++ A  GTG+IAGG  R VCE+ 
Sbjct: 62  IRKAREAAVRNMVTVPVNEDKSVPHDYLGKFGASTVLLKKAPEGTGIIAGGPARMVCELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT + L S   P   A  RG   + +  
Sbjct: 122 GIRNIRTKSLGSNNKTNVVYATLQGLTSMKTPEQFAALRGKTVAEITG 169


>gi|260589261|ref|ZP_05855174.1| ribosomal protein S5 [Blautia hansenii DSM 20583]
 gi|331082668|ref|ZP_08331791.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540342|gb|EEX20911.1| ribosomal protein S5 [Blautia hansenii DSM 20583]
 gi|330400287|gb|EGG79929.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 169

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 60/168 (35%), Positives = 95/168 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KRSIIDASQFELEEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +++V+  +  ++ HD +G+ G+ +++++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKLVTVARDENGSITHDFIGKFGSAEMLLKKAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  K +GS N  NV+ AT   L     P +VA  RG     + A
Sbjct: 122 GIKNIRTKCMGSRNKQNVVLATIAGLSQLKTPEEVAKLRGKSVDEIFA 169


>gi|270291116|ref|ZP_06197339.1| 30S ribosomal protein S5 [Pediococcus acidilactici 7_4]
 gi|304385397|ref|ZP_07367742.1| 30S ribosomal protein S5 [Pediococcus acidilactici DSM 20284]
 gi|270280512|gb|EFA26347.1| 30S ribosomal protein S5 [Pediococcus acidilactici 7_4]
 gi|304328604|gb|EFL95825.1| 30S ribosomal protein S5 [Pediococcus acidilactici DSM 20284]
          Length = 167

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 110/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 3   KFIDPEKLELEDRVVAINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A++++I V ++ G TL H+ +G +G G+++M+ A  G+GV AGGA+RAV E+ G+
Sbjct: 63  KAVETARKSLIEVPIV-GTTLPHEAIGVYGGGRILMKPAAEGSGVTAGGAVRAVMELAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +K +GS+ P NVIRATFE L+S  +  +VA  RG+    L  
Sbjct: 122 DDVTSKRLGSNTPVNVIRATFEGLKSMRNAEEVAALRGVSVDHLAE 167


>gi|313836042|gb|EFS73756.1| ribosomal protein S5 [Propionibacterium acnes HL037PA2]
 gi|314929580|gb|EFS93411.1| ribosomal protein S5 [Propionibacterium acnes HL044PA1]
 gi|314970535|gb|EFT14633.1| ribosomal protein S5 [Propionibacterium acnes HL037PA3]
 gi|328906210|gb|EGG25985.1| 30S ribosomal protein S5 [Propionibacterium sp. P08]
          Length = 215

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 79/177 (44%), Positives = 109/177 (61%), Gaps = 1/177 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
             R    +R    N  ++R+VAINRV+  + GGRRF+F+ LVVVGD +  VG  +  A+E
Sbjct: 19  DNRRGQNDRNRNQNEYLERVVAINRVAKVVQGGRRFSFTALVVVGDGEGSVGVGYGKAKE 78

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP A+ KA E AK++   V L+ GRT+ H  +G   AG V++R A  GTGVIAGG+ RAV
Sbjct: 79  VPAAIAKAVEEAKKHFFKVPLI-GRTITHPVIGEKAAGMVMLRPASPGTGVIAGGSARAV 137

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
            E  G+ DV+AKS+GSSN  NV+ AT + L+    P +VA RRG     +    ++ 
Sbjct: 138 LECAGVQDVLAKSLGSSNAINVVHATVDALQQLEEPEEVARRRGKSVEDVAPAAMLR 194


>gi|289423697|ref|ZP_06425496.1| ribosomal protein S5 [Peptostreptococcus anaerobius 653-L]
 gi|289155947|gb|EFD04613.1| ribosomal protein S5 [Peptostreptococcus anaerobius 653-L]
          Length = 169

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 69/166 (41%), Positives = 100/166 (60%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R++ + RV+  + GGR F F+ LVVVGD+   VG     A EVP+A++
Sbjct: 5   KPIDATQFDLEERVIEVRRVTKVVKGGRNFRFAALVVVGDSNGHVGIGSGKAMEVPDAIK 64

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V  + G T+ H+ VG  GAG +++  A  GTGV+AGG +RAV E+ G+
Sbjct: 65  KAVEDAKKNLIVVPRV-GTTVPHEVVGHFGAGNILIMPAKEGTGVLAGGPVRAVLELAGV 123

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV AKS GS+NP N++ AT   L+S      +A  RG K   L  
Sbjct: 124 MDVRAKSTGSNNPRNMVNATIAGLKSLKTAESIARLRGKKVEELLG 169


>gi|164686544|ref|ZP_02210572.1| hypothetical protein CLOBAR_00111 [Clostridium bartlettii DSM
           16795]
 gi|164604413|gb|EDQ97878.1| hypothetical protein CLOBAR_00111 [Clostridium bartlettii DSM
           16795]
          Length = 168

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/168 (44%), Positives = 101/168 (60%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  + R   + +R+V + RV+  + GGR F F+ LVVVGD    VG     A EVP+A
Sbjct: 2   RRKLIDARQLDLQERVVEVRRVTKVVKGGRNFRFAALVVVGDENGHVGIGTGKAMEVPDA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA E AK+N+I V ++ G T+ H+ +G  GAGK+I+  A  GTG+IAGGA R V E+ 
Sbjct: 62  IKKAAEDAKKNLIRVPIV-GTTIPHEVIGHFGAGKIIIMPAQEGTGIIAGGAARTVLELS 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ DV AKS+GS NP N++ A  E L S     DVA  RG K   L  
Sbjct: 121 GLKDVRAKSLGSKNPRNMVNAAIEGLSSLKTAEDVARLRGKKVEDLLG 168


>gi|71065076|ref|YP_263803.1| 30S ribosomal protein S5 [Psychrobacter arcticus 273-4]
 gi|93005331|ref|YP_579768.1| 30S ribosomal protein S5 [Psychrobacter cryohalolentis K5]
 gi|91207882|sp|Q4FUD9|RS5_PSYA2 RecName: Full=30S ribosomal protein S5
 gi|122415892|sp|Q1QDG9|RS5_PSYCK RecName: Full=30S ribosomal protein S5
 gi|71038061|gb|AAZ18369.1| SSU ribosomal protein S5P [Psychrobacter arcticus 273-4]
 gi|92393009|gb|ABE74284.1| SSU ribosomal protein S5P [Psychrobacter cryohalolentis K5]
          Length = 171

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 83/170 (48%), Positives = 113/170 (66%), Gaps = 1/170 (0%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           R++  ++ E+ + +V+R+V ++RV+  + GGR F+F+ L VVGD   +VGF    AREVP
Sbjct: 3   RNDKNDKNEQTDGLVERLVTVDRVAKVVKGGRIFSFTALTVVGDGNGRVGFGRGKAREVP 62

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
            A++KA EAAKRNMI+V L +  TL+H    RHGA KV M+ A  GTGVIAGGA+RAV E
Sbjct: 63  AAIQKALEAAKRNMITVEL-NDATLYHPIKARHGASKVYMQPASEGTGVIAGGAMRAVLE 121

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V G+ DV+ K  GS+N  NV+RATF  LR  S P  +A +RG     +  
Sbjct: 122 VAGVKDVLTKCYGSTNTANVVRATFNGLRDMSTPEKMAAKRGKSVDEILG 171


>gi|149184328|ref|ZP_01862646.1| 30S ribosomal protein S5 [Erythrobacter sp. SD-21]
 gi|148831648|gb|EDL50081.1| 30S ribosomal protein S5 [Erythrobacter sp. SD-21]
          Length = 268

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 92/160 (57%), Positives = 119/160 (74%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            I++++V INRVS  + GG+RF F+ LVVVGD   +VGF    AREVPEA++KA+ AA++
Sbjct: 93  GIIEKLVHINRVSKTVKGGKRFGFAALVVVGDGSGRVGFGKGKAREVPEAIQKASAAARK 152

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
            MI V L +GRTLHHDG GR GAGKV +R+A  GTG+IAGG +RAV E LG+ DVV KS+
Sbjct: 153 KMIRVPLKEGRTLHHDGNGRFGAGKVTVRTAPPGTGIIAGGPMRAVFESLGVADVVTKSV 212

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G+SNP+N+IRATF+ L  Q+ P+ VA RRG K + L  R 
Sbjct: 213 GTSNPYNMIRATFDALTDQTSPKSVAQRRGKKVADLLGRG 252


>gi|119472056|ref|ZP_01614314.1| 30S ribosomal subunit protein S5 [Alteromonadales bacterium TW-7]
 gi|119445191|gb|EAW26483.1| 30S ribosomal subunit protein S5 [Alteromonadales bacterium TW-7]
          Length = 168

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 110/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++   + ++++A+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++K
Sbjct: 5   EAKQQQPDLAEKLIAVNRVSKVVKGGRIFSFTALTVVGDGAGKVGFGYGKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V L +G TL H   GRH    V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 65  AMEKARRNMINVDL-NGNTLQHPVKGRHAGSLVFMKPASEGTGIIAGGAMRAVLEVTGVQ 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K  GS+NP NV+RAT   L + + P+ +A +RG++   +  
Sbjct: 124 NVLSKCYGSTNPINVVRATISALENMNSPQSIAAKRGLRVEEILG 168


>gi|302388071|ref|YP_003823893.1| ribosomal protein S5 [Clostridium saccharolyticum WM1]
 gi|302198699|gb|ADL06270.1| ribosomal protein S5 [Clostridium saccharolyticum WM1]
          Length = 169

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/163 (42%), Positives = 98/163 (60%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + DR+VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 7   DASQLELNDRVVAIKRVSKTVKGGRTMRFSALVVVGDGNGHVGAGLGKAGEVPEAIRKGK 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           EAA +NM++V + +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ G+ ++
Sbjct: 67  EAAVKNMVAVPVDENNSIPHDLIGKFGSASVLLKRANEGTGVIAGGPARAVLELAGIKNI 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +KS+GS+N  NV+ AT E L     P +VA  RG     +  
Sbjct: 127 HSKSLGSNNKTNVVLATIEGLTRLKTPEEVAKLRGKSVEEILG 169


>gi|163733797|ref|ZP_02141239.1| 30S ribosomal protein S5 [Roseobacter litoralis Och 149]
 gi|161392908|gb|EDQ17235.1| 30S ribosomal protein S5 [Roseobacter litoralis Och 149]
          Length = 191

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 108/193 (55%), Positives = 143/193 (74%), Gaps = 2/193 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++ ++R N ++R+E      DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MAERDNNRRGNRRDRDEA-PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MRSA  GTG+IAG
Sbjct: 60  KGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDMEGRHGAGKVVMRSAPEGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVV+KSIGS NP+N+IRAT + LR +S PR VA RRG K + +   +
Sbjct: 120 GPMRAVFEMLGIKDVVSKSIGSQNPYNMIRATMDGLRKESSPRSVAQRRGKKVADILP-K 178

Query: 181 VVSSKSSSYSRDS 193
           V ++ + + + D+
Sbjct: 179 VDAAPAPAETADA 191


>gi|189424427|ref|YP_001951604.1| 30S ribosomal protein S5 [Geobacter lovleyi SZ]
 gi|226703349|sp|B3E847|RS5_GEOLS RecName: Full=30S ribosomal protein S5
 gi|189420686|gb|ACD95084.1| ribosomal protein S5 [Geobacter lovleyi SZ]
          Length = 162

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/158 (46%), Positives = 108/158 (68%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                D ++ DR+V I+RV+  + GGRRF+FS LVVVGD    VG+    A EVPEA+RK
Sbjct: 3   RINANDLNLTDRVVHISRVAKVVKGGRRFSFSALVVVGDASGHVGYGLGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V +   +++ ++ +GR GAG+++M+ A  GTGVIAGGA RA+ E  G+ 
Sbjct: 63  GVEQAKKNLIKVPVNQNQSIPYEIIGRFGAGRILMKPASPGTGVIAGGAARAIFEAAGIS 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGI 171
           ++++K +GS+NPHNV++A FE LR    P ++  RRG+
Sbjct: 123 NILSKCLGSNNPHNVVKAAFEGLRLLKTPEELTARRGL 160


>gi|330447020|ref|ZP_08310670.1| ribosomal protein S5 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491211|dbj|GAA05167.1| ribosomal protein S5 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 165

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 72/164 (43%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E+  + + ++++A+NRVS  + GGR F+F+ L VVGD   ++GF +  AREVP A++KA
Sbjct: 3   NEKTQSDLHEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRIGFGYGKAREVPAAIQKA 62

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM++V++ +  TL+H   G H   KV M+ A  GTG+IAGGA+RAV EV G+ +
Sbjct: 63  MEKARRNMVTVAI-NEGTLYHPVKGVHTGSKVYMQPASEGTGIIAGGAMRAVLEVAGIRN 121

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP NV+RAT + L   + P  +A +RG+    +  
Sbjct: 122 VLAKAYGSTNPINVVRATIDGLSGMNSPEMIAAKRGLSVKEILE 165


>gi|153952878|ref|YP_001393643.1| 30S ribosomal protein S5 [Clostridium kluyveri DSM 555]
 gi|219853543|ref|YP_002470665.1| hypothetical protein CKR_0200 [Clostridium kluyveri NBRC 12016]
 gi|146345759|gb|EDK32295.1| RpsE [Clostridium kluyveri DSM 555]
 gi|219567267|dbj|BAH05251.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 165

 Score =  173 bits (438), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FS LVVVGD    VG     + E+PEA+RK
Sbjct: 2   RIDPSTLNLKEKVVFINRVAKVVKGGRNFRFSALVVVGDENGHVGVGTGKSIEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V ++ G T+ H+  G+ G GKV + +A  GTG+IAGG  RAV E+ G+ 
Sbjct: 62  GIEDAKKNLIEVPII-GTTVPHNITGQFGTGKVFIMTASEGTGIIAGGPSRAVLELSGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT + L        +A+ RG     +  
Sbjct: 121 DVRAKSVGSNNPRNMVNATIDGLSKLKTAEHIASLRGKTVEEILG 165


>gi|303247010|ref|ZP_07333286.1| ribosomal protein S5 [Desulfovibrio fructosovorans JJ]
 gi|302491717|gb|EFL51600.1| ribosomal protein S5 [Desulfovibrio fructosovorans JJ]
          Length = 177

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 80/174 (45%), Positives = 117/174 (67%), Gaps = 1/174 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA    ++R +    ++ D   +++IV +NRV+  + GGRRF+FS LVVVGD K  VG+ 
Sbjct: 1   MAASNSNRRKDDGMDQQSDLGQIEKIVYLNRVAKVVKGGRRFSFSALVVVGDGKGAVGYG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A EVPEA+RKATE A++ MIS+ LLD  TL ++ +G+ GAG+V+++ A  GTG+IAG
Sbjct: 61  LGKANEVPEAIRKATEQARKGMISIPLLD-GTLPYEVLGQFGAGRVMLKPASKGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           G +RA+ E  G++D++ K+IG++NPHNV+RAT E L S      V   RG   +
Sbjct: 120 GPVRAIMEACGVNDILTKAIGTNNPHNVLRATMEGLASLRSAESVGAMRGKALA 173


>gi|320533208|ref|ZP_08033923.1| ribosomal protein S5 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320134572|gb|EFW26805.1| ribosomal protein S5 [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 215

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 1/175 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            ++R+V INRVS  + GGRRF F+ LVVVGD +  VG  +  A+EVP A+ KA E AK+N
Sbjct: 28  YIERVVTINRVSKVVKGGRRFTFTALVVVGDGEGTVGVGYGKAKEVPAAIAKAVEIAKKN 87

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
              V ++  RT+ H   G   AG V++R A  GTGVIAGG +RAV +  G+HD+++KS+G
Sbjct: 88  FFHVPMIR-RTIPHLVQGEDSAGVVLLRPASPGTGVIAGGPVRAVLDCAGVHDILSKSLG 146

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           SSN  N++ AT + L+    P  VA RRG+    +  + ++ +++   +      
Sbjct: 147 SSNAINIVHATVDALKQLEQPEAVAARRGLPLEDVAPQSMLRARAEGEADKRAQA 201


>gi|238921425|ref|YP_002934940.1| 30S ribosomal protein S5 [Edwardsiella ictaluri 93-146]
 gi|294638035|ref|ZP_06716295.1| ribosomal protein S5 [Edwardsiella tarda ATCC 23685]
 gi|238870994|gb|ACR70705.1| 30S ribosomal protein S5 (BS5) [Edwardsiella ictaluri 93-146]
 gi|291088827|gb|EFE21388.1| ribosomal protein S5 [Edwardsiella tarda ATCC 23685]
          Length = 166

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMINVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLESMKSPEMVAAKRGKSVEEILG 166


>gi|295109491|emb|CBL23444.1| SSU ribosomal protein S5P [Ruminococcus obeum A2-162]
          Length = 169

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 63/163 (38%), Positives = 96/163 (58%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA+RK  
Sbjct: 7   DASQLELEDKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKAAEIPEAIRKGK 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A + +++V+  +  ++ HD VG+ G+ +++++ A  GTGVIAGG  RAV E+ G+ ++
Sbjct: 67  EDAMKKLVTVARDENNSITHDYVGKFGSAEMLLKRAPEGTGVIAGGPARAVIELAGIKNI 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
             K +GS N  NV+ AT E L     P +VA  RG     + A
Sbjct: 127 RTKCMGSRNKQNVVMATIEGLSKLKTPEEVAKLRGKSVEEILA 169


>gi|238754191|ref|ZP_04615549.1| hypothetical protein yruck0001_27940 [Yersinia ruckeri ATCC 29473]
 gi|238707687|gb|EEQ00047.1| hypothetical protein yruck0001_27940 [Yersinia ruckeri ATCC 29473]
          Length = 167

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R MI+V+L D  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRAMINVAL-DSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT   L     P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATILALEDMKSPEMVAAKRGKSVEEILGK 167


>gi|315127939|ref|YP_004069942.1| 30S ribosomal protein S5 [Pseudoalteromonas sp. SM9913]
 gi|315016453|gb|ADT69791.1| 30S ribosomal protein S5 [Pseudoalteromonas sp. SM9913]
          Length = 168

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++   + ++++A+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++K
Sbjct: 5   EAKQQQPDLAEKLIAVNRVSKVVKGGRIFSFTALTVVGDGAGKVGFGYGKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V L +G TL H   GRH   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 65  AMEKARRNMINVDL-NGNTLQHPVKGRHAGSQVFMKPASEGTGIIAGGAMRAVLEVTGVQ 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K  GS+NP NV+RAT   L + + P+ +A +RG++   +  
Sbjct: 124 NVLSKCYGSTNPINVVRATISALENMNSPQSIAAKRGLRVDEILG 168


>gi|253682680|ref|ZP_04863477.1| ribosomal protein S5 [Clostridium botulinum D str. 1873]
 gi|253562392|gb|EES91844.1| ribosomal protein S5 [Clostridium botulinum D str. 1873]
          Length = 165

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 68/165 (41%), Positives = 98/165 (59%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FS LVVVGD    VG     A E+PEA+RK
Sbjct: 2   RIDPSTLNLKEKVVFINRVAKVVKGGRNFRFSALVVVGDENGHVGVGMGKAVEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++++ V+++D  T+ H   G +G GKV++  A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKHLVEVAMVD-TTVPHIIEGEYGRGKVLIMPATEGTGVIAGGPVRAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT   L        +A  RG     +  
Sbjct: 121 DVRAKSLGSNNPKNMVGATINGLSRLRTAEQIAKLRGKTVEEILG 165


>gi|332037276|gb|EGI73731.1| 30S ribosomal protein S5 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 168

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 110/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++   + ++++A+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++K
Sbjct: 5   EAKQQQPDLAEKLIAVNRVSKVVKGGRIFSFTALTVVGDGAGKVGFGYGKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V L +G TL H   GRH    V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 65  AMEKARRNMINVDL-NGNTLQHPVKGRHAGSLVFMKPASEGTGIIAGGAMRAVLEVTGVQ 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K  GS+NP NV+RAT   L + + P+ +A +RG++   +  
Sbjct: 124 NVLSKCYGSTNPINVVRATISALENMNSPQSIAAKRGLRVDEILG 168


>gi|183600735|ref|ZP_02962228.1| hypothetical protein PROSTU_04330 [Providencia stuartii ATCC 25827]
 gi|268593558|ref|ZP_06127779.1| ribosomal protein S5 [Providencia rettgeri DSM 1131]
 gi|188019714|gb|EDU57754.1| hypothetical protein PROSTU_04330 [Providencia stuartii ATCC 25827]
 gi|291310836|gb|EFE51289.1| ribosomal protein S5 [Providencia rettgeri DSM 1131]
          Length = 166

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRV+  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVAKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R+M +V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRSMKTVAL-NNGTLFHPVKGTHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG 166


>gi|208805679|ref|ZP_03248016.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4206]
 gi|208725480|gb|EDZ75081.1| ribosomal protein S5 [Escherichia coli O157:H7 str. EC4206]
          Length = 168

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           R+ +   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA
Sbjct: 5   RKNKAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKA 64

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+
Sbjct: 65  MEKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHN 123

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           V+AK+ GS+NP NV+RAT + L + + P  VA +RG     +  +
Sbjct: 124 VLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK 168


>gi|149915861|ref|ZP_01904385.1| 30S ribosomal protein S5 [Roseobacter sp. AzwK-3b]
 gi|149810184|gb|EDM70030.1| 30S ribosomal protein S5 [Roseobacter sp. AzwK-3b]
          Length = 187

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 101/173 (58%), Positives = 124/173 (71%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
                 DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE 
Sbjct: 15  ETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQ 74

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           AKR MI V L +GRTLHHDG GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVVA
Sbjct: 75  AKRQMIRVPLREGRTLHHDGHGRHGAGKVVMRTAPQGTGIIAGGPMRAVFEMLGVQDVVA 134

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           KSIGS NP+N+IRAT   L+ Q+ PR VA RRG K   +  +     K ++ +
Sbjct: 135 KSIGSQNPYNMIRATLNALQFQASPRMVAQRRGKKVVDILKKDEAPVKEAAEA 187


>gi|319938490|ref|ZP_08012884.1| 30S ribosomal protein S5 [Coprobacillus sp. 29_1]
 gi|319806406|gb|EFW03073.1| 30S ribosomal protein S5 [Coprobacillus sp. 29_1]
          Length = 188

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 107/173 (61%), Gaps = 1/173 (0%)

Query: 6   RSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAR 65
           R       N  + +    +R+V INRV+  + GGR+F F+ LVV+GD K +VGF    A 
Sbjct: 17  RKNGPRRNNGPKVEKEFEERVVTINRVTKVVKGGRKFRFAALVVIGDRKGRVGFGTGKAN 76

Query: 66  EVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRA 125
           EVP+A+RKA+EAAKRN+I+V ++   T+ H+  G  G+G V +R A  GTG+IAGG +RA
Sbjct: 77  EVPDAIRKASEAAKRNVINVPMV-HGTIPHEVNGMFGSGNVFLRPASQGTGIIAGGPVRA 135

Query: 126 VCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V E+ G  D+++KS+GS  P N++RAT E L S    + VA  R  K   +  
Sbjct: 136 VVELAGYSDILSKSLGSRTPINMVRATMEGLASLKTAKQVAELRDKKIEEIYG 188


>gi|291562754|emb|CBL41570.1| SSU ribosomal protein S5P [butyrate-producing bacterium SS3/4]
          Length = 169

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 65/167 (38%), Positives = 97/167 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KRTIIDASQLELNDKVVAIKRVSKTVKGGRTMRFSALVVVGDGNGHVGAGLGKAGEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA +N++ + + + +++ HD +G  G+  V+++ A  GTG+IAGG +R+V E+ 
Sbjct: 62  IRKGKEAAMKNLVEIPMDENKSIPHDFLGEFGSASVLIKRAPEGTGIIAGGPVRSVVELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           G+ ++  KS+GS+N  NV+ AT E L     P +VA  RG     + 
Sbjct: 122 GIKNIRTKSLGSNNKTNVVLATIEGLTKLKTPEEVAKNRGKSVEDVV 168


>gi|156743931|ref|YP_001434060.1| 30S ribosomal protein S5 [Roseiflexus castenholzii DSM 13941]
 gi|156235259|gb|ABU60042.1| ribosomal protein S5 [Roseiflexus castenholzii DSM 13941]
          Length = 180

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/179 (42%), Positives = 105/179 (58%), Gaps = 1/179 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +     +  + +R+V INRVS  + GGRRF+FS +VVVGD K  VG     A EVPEA+
Sbjct: 3   KRRIHTDELELEERVVQINRVSKVVKGGRRFSFSTVVVVGDGKGHVGIGMGKAAEVPEAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  EAAK+N+I V L  G T+ H+      A KV +  A  G GVIAG  +R V E+ G
Sbjct: 63  RKGVEAAKKNLIRVPLA-GTTIPHEVQEEFAASKVRLLPAAPGAGVIAGRGVRPVLEMAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           + DV++K  GS+NP NV++ATF+ L S +   + A  RG+    L  RR+    +S  +
Sbjct: 122 IKDVLSKRYGSNNPINVVKATFKALSSLTSLEEQARMRGMTPRELHLRRMRREPASQEA 180


>gi|119478114|ref|ZP_01618193.1| ribosomal protein S5 [marine gamma proteobacterium HTCC2143]
 gi|119448820|gb|EAW30063.1| ribosomal protein S5 [marine gamma proteobacterium HTCC2143]
          Length = 170

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 79/166 (47%), Positives = 110/166 (66%), Gaps = 1/166 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           N   +++    + +++V +NRV+  + GGR F F+ L VVGD   KVGF    AREVP A
Sbjct: 4   NDSKKQDDSEGLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGNGKVGFGRGKAREVPVA 63

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA EAA+RNMI+V L +G T+ +     HGA  + M+ A  GTGVIAGGA+RAV E+ 
Sbjct: 64  IQKAMEAARRNMITVDL-NGDTIQYAIKANHGASNIYMQPASQGTGVIAGGAMRAVLELA 122

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+H+V+AK  GS+NP NV+RATF+ L + + P  VANRRG     +
Sbjct: 123 GVHNVLAKCYGSTNPVNVVRATFKALETMASPEQVANRRGKTVEEI 168


>gi|229815755|ref|ZP_04446080.1| hypothetical protein COLINT_02804 [Collinsella intestinalis DSM
           13280]
 gi|229808671|gb|EEP44448.1| hypothetical protein COLINT_02804 [Collinsella intestinalis DSM
           13280]
          Length = 176

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 72/171 (42%), Positives = 104/171 (60%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N Q ++   +   +R+V INRV+  + GGRR +   LVVVGD K  VG     + EVP 
Sbjct: 3   RNQQKQQREASEFEERVVFINRVAKTVKGGRRMSLVALVVVGDGKGNVGLGMGKSAEVPL 62

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA+  AK++M  V +    T+ HD  G  GA  +IMR A+ GTGVIAGGA+R + E+
Sbjct: 63  AISKASIDAKKHMFHVPVTAEGTIPHDVQGEFGAASIIMRPAVEGTGVIAGGAVRPLFEL 122

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
            G+ ++++KS+GS N  N+I+A  E L+  S P DVA RRG+  S +   +
Sbjct: 123 AGIKNILSKSLGSDNGLNIIKAAAEGLKQLSTPEDVAARRGLTVSEMFVGK 173


>gi|71083787|ref|YP_266507.1| 30S ribosomal protein S5 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763177|ref|ZP_01265141.1| 30S ribosomal protein S5 [Candidatus Pelagibacter ubique HTCC1002]
 gi|91207875|sp|Q4FLN5|RS5_PELUB RecName: Full=30S ribosomal protein S5
 gi|71062900|gb|AAZ21903.1| ribosomal protein S5 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717590|gb|EAS84241.1| 30S ribosomal protein S5 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 170

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 87/166 (52%), Positives = 127/166 (76%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           ++++D+ I++++V INR++  + GGRRF FS LVVVG+   K+G AH+ A++VP+A++KA
Sbjct: 4   KDKKDDGILEKLVHINRITKVVKGGRRFGFSALVVVGNQAGKIGVAHAKAKQVPDAIKKA 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+R +I V L +GRT+HHD  G+ GAGK+I+RSA  GTG+IAGG +RAVCEVLG+ D
Sbjct: 64  NETARRVLIHVPLREGRTIHHDVYGKDGAGKIILRSAPKGTGIIAGGPVRAVCEVLGIKD 123

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           +VAKS+G+SNPHN+IRAT + L  Q+ P+ +A  R  K S +  +R
Sbjct: 124 IVAKSMGTSNPHNMIRATMKALSKQNSPKHIATIRNKKISDVIEKR 169


>gi|300721383|ref|YP_003710654.1| 30S ribosomal subunit protein S5 [Xenorhabdus nematophila ATCC
           19061]
 gi|297627871|emb|CBJ88417.1| 30S ribosomal subunit protein S5 [Xenorhabdus nematophila ATCC
           19061]
          Length = 166

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM +V+L +  TL+H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMKTVAL-NSGTLYHPVKGSHTGSRVFMQPAHEGTGIIAGGAMRAVLEVSGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG 166


>gi|325288595|ref|YP_004264776.1| SSU ribosomal protein S5P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963996|gb|ADY54775.1| SSU ribosomal protein S5P [Syntrophobotulus glycolicus DSM 8271]
          Length = 166

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 103/163 (63%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + ++++ I RV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 5   DPSKLELTEKVIHIARVAKVVKGGRRFSFSALVVVGDGNGIVGAGLGKASEVPEAIRKGV 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N++S+ L  G T+ H  +G +GAG+V+++ A  GTGVIAGG +RAV EV G+ D+
Sbjct: 65  EDAKKNLVSIPLR-GTTIPHPILGVYGAGEVLLKPASKGTGVIAGGPVRAVLEVAGIKDI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + KS+GSSN HN++ AT   L+S     DVA  RG     +  
Sbjct: 124 LTKSLGSSNAHNIVNATMTGLKSLKRDSDVAKLRGKSVEEIYG 166


>gi|225574719|ref|ZP_03783329.1| hypothetical protein RUMHYD_02796 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038048|gb|EEG48294.1| hypothetical protein RUMHYD_02796 [Blautia hydrogenotrophica DSM
           10507]
          Length = 169

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 62/168 (36%), Positives = 97/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KRNLIDASQLELNDKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +++V+  +  ++ HD +G+ G+ +++++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKLVTVARDENGSITHDFIGKFGSAQMLLKRAPEGTGVIAGGPARAVIELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  K +GS N  NV+ AT E L+    P +VA  RG     + A
Sbjct: 122 GIKNIRTKCMGSRNKQNVVLATIEGLKQLKTPEEVAKLRGKSVDEILA 169


>gi|27468724|ref|NP_765361.1| 30S ribosomal protein S5 [Staphylococcus epidermidis ATCC 12228]
 gi|57867692|ref|YP_189377.1| 30S ribosomal protein S5 [Staphylococcus epidermidis RP62A]
 gi|242243964|ref|ZP_04798407.1| 30S ribosomal protein S5 [Staphylococcus epidermidis W23144]
 gi|251812064|ref|ZP_04826537.1| 30S ribosomal protein S5 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875359|ref|ZP_06284232.1| ribosomal protein S5 [Staphylococcus epidermidis SK135]
 gi|293368450|ref|ZP_06615074.1| 30S ribosomal protein S5 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|38258355|sp|Q8CRH7|RS5_STAES RecName: Full=30S ribosomal protein S5
 gi|73919102|sp|Q5HM16|RS5_STAEQ RecName: Full=30S ribosomal protein S5
 gi|27316272|gb|AAO05447.1|AE016750_52 30S ribosomal protein S5 [Staphylococcus epidermidis ATCC 12228]
 gi|57638350|gb|AAW55138.1| ribosomal protein S5 [Staphylococcus epidermidis RP62A]
 gi|242232597|gb|EES34909.1| 30S ribosomal protein S5 [Staphylococcus epidermidis W23144]
 gi|251804398|gb|EES57055.1| 30S ribosomal protein S5 [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296124|gb|EFA88645.1| ribosomal protein S5 [Staphylococcus epidermidis SK135]
 gi|291317408|gb|EFE57830.1| 30S ribosomal protein S5 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319400608|gb|EFV88833.1| ribosomal protein S5 [Staphylococcus epidermidis FRI909]
 gi|329731245|gb|EGG67615.1| ribosomal protein S5 [Staphylococcus epidermidis VCU144]
 gi|329736463|gb|EGG72731.1| ribosomal protein S5 [Staphylococcus epidermidis VCU028]
 gi|329737001|gb|EGG73256.1| ribosomal protein S5 [Staphylococcus epidermidis VCU045]
          Length = 166

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/152 (46%), Positives = 102/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   G++G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGQYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATINGLQNLKNAEDVAKLRGKSVEELY 165


>gi|303230122|ref|ZP_07316891.1| ribosomal protein S5 [Veillonella atypica ACS-134-V-Col7a]
 gi|302515183|gb|EFL57156.1| ribosomal protein S5 [Veillonella atypica ACS-134-V-Col7a]
          Length = 167

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   RIDYTSLDLKERVVFINRVAKVVKGGRRFSFSALVVVGDGNGYVGVGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             + AK+N+++V++ +  T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E++G+ 
Sbjct: 63  GIDDAKKNIVNVAIKN-GTIPHSVTGVFGAGRVFLKPAAEGTGVIAGGPVRAVLELVGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +++ KS+GSSNP+N++RAT E L+      +VA  RG     + 
Sbjct: 122 NILTKSLGSSNPNNMVRATIEGLKDLKRASEVAELRGKSVEEIY 165


>gi|170738686|ref|YP_001767341.1| 30S ribosomal protein S5 [Methylobacterium sp. 4-46]
 gi|226703361|sp|B0UHV2|RS5_METS4 RecName: Full=30S ribosomal protein S5
 gi|168192960|gb|ACA14907.1| ribosomal protein S5 [Methylobacterium sp. 4-46]
          Length = 192

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 109/172 (63%), Positives = 134/172 (77%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VDR+V INRV+  + GGRRF F+ LVVVGD K +VGF H  AREVPEA+RKATEAAKR 
Sbjct: 20  FVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATEAAKRG 79

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +I V+L +GRTLHHD  GRHG+GKVI+R+A  GTG+IAGG +RAV E +GM DVVAKS+G
Sbjct: 80  LIRVALREGRTLHHDVAGRHGSGKVILRAAPQGTGIIAGGPMRAVFESVGMQDVVAKSLG 139

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           SSNP+N+IRATF+ L+ +  PR VA RRG+K S LQARR  +   S+ S D+
Sbjct: 140 SSNPYNLIRATFDALKREDSPRAVAARRGLKVSALQARRRDAEPGSADSADA 191


>gi|182678354|ref|YP_001832500.1| 30S ribosomal protein S5 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226703327|sp|B2IK79|RS5_BEII9 RecName: Full=30S ribosomal protein S5
 gi|182634237|gb|ACB95011.1| ribosomal protein S5 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 189

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 105/172 (61%), Positives = 132/172 (76%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
           D+  VDR+V INRV+  + GGRRF F+ LVVVGD K +VG+ H  AREVPEA+RKATE+A
Sbjct: 17  DSEFVDRLVHINRVAKVVKGGRRFGFAALVVVGDQKGRVGYGHGKAREVPEAIRKATESA 76

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           KR +I V L +GRTLHHD  GRHGAG+V++R+A AGTG+IAGG +RAV E LGMHDVVAK
Sbjct: 77  KRALIRVPLREGRTLHHDVNGRHGAGRVVLRAAPAGTGIIAGGPMRAVFETLGMHDVVAK 136

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           S GSSNP+N+IRATF+ L+ +  PR VA RR +K S+LQ RR+     ++  
Sbjct: 137 SQGSSNPYNMIRATFDALQREDSPRAVAARRSLKVSVLQGRRLGGDTETAAE 188


>gi|118579136|ref|YP_900386.1| 30S ribosomal protein S5 [Pelobacter propionicus DSM 2379]
 gi|171704443|sp|A1ALV8|RS5_PELPD RecName: Full=30S ribosomal protein S5
 gi|118501846|gb|ABK98328.1| SSU ribosomal protein S5P [Pelobacter propionicus DSM 2379]
          Length = 162

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/159 (45%), Positives = 108/159 (67%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                D ++ DR+V I+RV+  + GGRRF+FS L+VVGD    VG+    A EVPEA+RK
Sbjct: 3   RVNPADLNLTDRVVHISRVAKVVKGGRRFSFSALIVVGDGCGYVGYGLGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V +   +T+  +  G+ GAG+++M+ A AGTGVIAGGA RA+ E  G++
Sbjct: 63  GVEQAKKNLIKVPVNQNQTIPFEIEGKFGAGRLLMKPASAGTGVIAGGAARAIFEAAGIN 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIK 172
           ++++K +GS+NPHNV++A F  L+    P ++A RRGI 
Sbjct: 123 NILSKCLGSNNPHNVVKAAFAGLQRLKSPEELAARRGIT 161


>gi|317049823|ref|YP_004117471.1| 30S ribosomal protein S5 [Pantoea sp. At-9b]
 gi|316951440|gb|ADU70915.1| ribosomal protein S5 [Pantoea sp. At-9b]
          Length = 166

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L    TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVALT-HGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLGNMKSPEMVAAKRGKSVEEILG 166


>gi|27380494|ref|NP_772023.1| 30S ribosomal protein S5 [Bradyrhizobium japonicum USDA 110]
 gi|73919039|sp|Q89JA1|RS5_BRAJA RecName: Full=30S ribosomal protein S5
 gi|27353658|dbj|BAC50648.1| 30s ribosomal protein S5 [Bradyrhizobium japonicum USDA 110]
          Length = 197

 Score =  172 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 106/197 (53%), Positives = 139/197 (70%), Gaps = 7/197 (3%)

Query: 1   MAQKERSQRDNWQNREER-------DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDT 53
           MA++E+    + +            D+  VD++V INRV+  + GG+RF F+ LVV+GD 
Sbjct: 1   MAEREQRGGRDQRGGGRERKEREERDSEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQ 60

Query: 54  KSKVGFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMA 113
           K + GF H  AREVPEA+RKATE+AKRN+  VSL +GRTLHHD  GRHGAG+V +R+A A
Sbjct: 61  KGRAGFGHGKAREVPEAIRKATESAKRNLTRVSLREGRTLHHDIAGRHGAGRVYLRAAPA 120

Query: 114 GTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKH 173
           GTG+IAGG +RAV E LG+ DVVAKSIGSSNP+N++RATF+ L+ Q  PR VA RR IK 
Sbjct: 121 GTGIIAGGPMRAVFETLGVQDVVAKSIGSSNPYNMVRATFDALKHQDSPRSVAARRNIKV 180

Query: 174 SLLQARRVVSSKSSSYS 190
           S LQ+RR+     ++  
Sbjct: 181 STLQSRRIGGDAEAAAD 197


>gi|290477175|ref|YP_003470090.1| 30S ribosomal subunit protein S5 [Xenorhabdus bovienii SS-2004]
 gi|289176523|emb|CBJ83332.1| 30S ribosomal subunit protein S5 [Xenorhabdus bovienii SS-2004]
          Length = 166

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/163 (47%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM +V+L +  TLHH   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMKNVAL-NSGTLHHPVKGGHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +Q 
Sbjct: 124 LAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEIQG 166


>gi|331268430|ref|YP_004394922.1| 30S ribosomal protein S5 [Clostridium botulinum BKT015925]
 gi|329124980|gb|AEB74925.1| ribosomal protein S5 [Clostridium botulinum BKT015925]
          Length = 165

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 98/165 (59%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FS LVVVGD    VG     A E+PEA+RK
Sbjct: 2   RIDPSTLNLKEKVVFINRVAKVVKGGRNFRFSALVVVGDENGHVGVGMGKAVEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++++ V+++D  T+ H   G +G G+V++  A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKHLVEVAMVD-TTVPHIIQGEYGRGRVLIMPATEGTGVIAGGPVRAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT   L        +A  RG     +  
Sbjct: 121 DVRAKSLGSNNPKNMVGATINGLSRLRTAEQIAKLRGKTVEEILG 165


>gi|312200003|ref|YP_004020064.1| ribosomal protein S5 [Frankia sp. EuI1c]
 gi|311231339|gb|ADP84194.1| ribosomal protein S5 [Frankia sp. EuI1c]
          Length = 203

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/166 (43%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           +   + V+R+VAINRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E
Sbjct: 29  QEKTAYVERVVAINRVAKVVKGGRRFSFTALVVVGDADGTVGVGYGKAKEVPAAIAKGVE 88

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++   V  + G T+ H   G   AG V+++ A  GTGVIAGG +RAV E  G+HDV+
Sbjct: 89  EAKKHFFKVPRI-GSTIPHPIQGEAAAGVVLLKPASPGTGVIAGGPVRAVLECAGVHDVL 147

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVV 182
           +KS+GSSNP N++ AT   LR  + P ++A RRG+    +    ++
Sbjct: 148 SKSLGSSNPINIVHATVAALRGLTRPEEIAARRGLPLEDVAPPAML 193


>gi|260438199|ref|ZP_05792015.1| ribosomal protein S5 [Butyrivibrio crossotus DSM 2876]
 gi|292809391|gb|EFF68596.1| ribosomal protein S5 [Butyrivibrio crossotus DSM 2876]
          Length = 169

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 64/162 (39%), Positives = 94/162 (58%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     I +++V+I RV+  + GGR   FS LVVVGD    VG     A E+PEA+RK  
Sbjct: 7   DASALEITEKVVSIKRVTKVVKGGRHMRFSALVVVGDGNGHVGAGIGKAIEIPEAIRKGK 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A + ++SV + +  T+ +D VG+ G+  V+++ A  GTGVIAGG  R+V E+ G+ ++
Sbjct: 67  EDAIKKLVSVPVDENGTIPYDYVGKFGSASVLLKKAPEGTGVIAGGPARSVIELAGIKNI 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
             KS+GS+N  NV+ AT   L     P +VA  RG     L 
Sbjct: 127 RTKSLGSNNKQNVVLATINGLAELKTPEEVAKLRGKTVEELY 168


>gi|224077096|ref|XP_002305129.1| predicted protein [Populus trichocarpa]
 gi|118487850|gb|ABK95748.1| unknown [Populus trichocarpa]
 gi|222848093|gb|EEE85640.1| predicted protein [Populus trichocarpa]
          Length = 311

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/166 (36%), Positives = 93/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +   +E+  +   +R+V + RV+  + GG++  F  +V+VGD + +VG     A+EV  A
Sbjct: 144 SRVKKEKIKDGFDERVVQVRRVTKVVKGGKQLHFRAVVIVGDKQGRVGVGVGKAKEVIVA 203

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           V+K+   A+RN+I+V +    T  H   G  GA KV++R A  GTGVIAGGA+R V E+ 
Sbjct: 204 VQKSALNARRNIITVPMTKYLTFPHRSEGDFGAAKVMLRPASPGTGVIAGGAVRIVLEMA 263

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K + S N  N  RAT   ++      +VA  RGI    L
Sbjct: 264 GVENALGKQLRSKNALNNARATVVAVQKMRQFSEVARERGIPMEEL 309


>gi|154483171|ref|ZP_02025619.1| hypothetical protein EUBVEN_00872 [Eubacterium ventriosum ATCC
           27560]
 gi|149735979|gb|EDM51865.1| hypothetical protein EUBVEN_00872 [Eubacterium ventriosum ATCC
           27560]
          Length = 169

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 60/168 (35%), Positives = 98/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + + +V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KREIIDASQLELEETVVSIKRVTKVVKGGRNMRFAALVVVGDKNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +++ISV +    ++ +D +G+ G+ +V+++ A  GTGVIAGG  R+V E+ 
Sbjct: 62  IRKGKEDAMKSLISVPIDQNDSIPYDIIGKFGSAEVLLKRAPEGTGVIAGGPARSVVELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G++++  KS+G++N  NV+ AT E L +   P +VA  RG     +  
Sbjct: 122 GINNIRTKSLGTNNKQNVVLATIEGLAALKTPEEVATLRGKSVEEILG 169


>gi|22127877|ref|NP_671300.1| 30S ribosomal protein S5 [Yersinia pestis KIM 10]
 gi|45440084|ref|NP_991623.1| 30S ribosomal protein S5 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597971|ref|YP_072162.1| 30S ribosomal protein S5 [Yersinia pseudotuberculosis IP 32953]
 gi|108809237|ref|YP_653153.1| 30S ribosomal protein S5 [Yersinia pestis Antiqua]
 gi|108814002|ref|YP_649769.1| 30S ribosomal protein S5 [Yersinia pestis Nepal516]
 gi|145597469|ref|YP_001161544.1| 30S ribosomal protein S5 [Yersinia pestis Pestoides F]
 gi|150260726|ref|ZP_01917454.1| 30S ribosomal protein S5 [Yersinia pestis CA88-4125]
 gi|153950056|ref|YP_001402845.1| 30S ribosomal protein S5 [Yersinia pseudotuberculosis IP 31758]
 gi|162421679|ref|YP_001605191.1| 30S ribosomal protein S5 [Yersinia pestis Angola]
 gi|165927852|ref|ZP_02223684.1| ribosomal protein S5 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165940341|ref|ZP_02228862.1| ribosomal protein S5 [Yersinia pestis biovar Orientalis str. IP275]
 gi|166010595|ref|ZP_02231493.1| ribosomal protein S5 [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166213319|ref|ZP_02239354.1| ribosomal protein S5 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167398472|ref|ZP_02303996.1| ribosomal protein S5 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167419388|ref|ZP_02311141.1| ribosomal protein S5 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425702|ref|ZP_02317455.1| ribosomal protein S5 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022561|ref|YP_001719066.1| 30S ribosomal protein S5 [Yersinia pseudotuberculosis YPIII]
 gi|186897167|ref|YP_001874279.1| 30S ribosomal protein S5 [Yersinia pseudotuberculosis PB1/+]
 gi|218927432|ref|YP_002345307.1| 30S ribosomal protein S5 [Yersinia pestis CO92]
 gi|229836292|ref|ZP_04456459.1| 30S ribosomal subunit protein S5 [Yersinia pestis Pestoides A]
 gi|229840084|ref|ZP_04460243.1| 30S ribosomal subunit protein S5 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229842166|ref|ZP_04462321.1| 30S ribosomal subunit protein S5 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229904534|ref|ZP_04519645.1| 30S ribosomal subunit protein S5 [Yersinia pestis Nepal516]
 gi|238788894|ref|ZP_04632684.1| hypothetical protein yfred0001_27010 [Yersinia frederiksenii ATCC
           33641]
 gi|270488248|ref|ZP_06205322.1| ribosomal protein S5 [Yersinia pestis KIM D27]
 gi|294502303|ref|YP_003566365.1| 30S ribosomal protein S5 [Yersinia pestis Z176003]
 gi|26399436|sp|Q8ZJ95|RS5_YERPE RecName: Full=30S ribosomal protein S5
 gi|73919115|sp|Q664T8|RS5_YERPS RecName: Full=30S ribosomal protein S5
 gi|122979878|sp|Q1CCW1|RS5_YERPN RecName: Full=30S ribosomal protein S5
 gi|123245524|sp|Q1C2W4|RS5_YERPA RecName: Full=30S ribosomal protein S5
 gi|189045448|sp|A7FNL7|RS5_YERP3 RecName: Full=30S ribosomal protein S5
 gi|189045449|sp|A4TH09|RS5_YERPP RecName: Full=30S ribosomal protein S5
 gi|21961013|gb|AAM87551.1|AE014003_9 30S ribosomal subunit protein S5 [Yersinia pestis KIM 10]
 gi|45434939|gb|AAS60500.1| 30S ribosomal protein S5 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591253|emb|CAH22919.1| 30S ribosomal protein S5 [Yersinia pseudotuberculosis IP 32953]
 gi|108777650|gb|ABG20169.1| SSU ribosomal protein S5P [Yersinia pestis Nepal516]
 gi|108781150|gb|ABG15208.1| SSU ribosomal protein S5P [Yersinia pestis Antiqua]
 gi|115346043|emb|CAL18909.1| 30S ribosomal protein S5 [Yersinia pestis CO92]
 gi|145209165|gb|ABP38572.1| SSU ribosomal protein S5P [Yersinia pestis Pestoides F]
 gi|149290134|gb|EDM40211.1| 30S ribosomal protein S5 [Yersinia pestis CA88-4125]
 gi|152961551|gb|ABS49012.1| ribosomal protein S5 [Yersinia pseudotuberculosis IP 31758]
 gi|162354494|gb|ABX88442.1| ribosomal protein S5 [Yersinia pestis Angola]
 gi|165911731|gb|EDR30387.1| ribosomal protein S5 [Yersinia pestis biovar Orientalis str. IP275]
 gi|165920128|gb|EDR37429.1| ribosomal protein S5 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990685|gb|EDR42986.1| ribosomal protein S5 [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166205617|gb|EDR50097.1| ribosomal protein S5 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963382|gb|EDR59403.1| ribosomal protein S5 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050976|gb|EDR62384.1| ribosomal protein S5 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055392|gb|EDR65186.1| ribosomal protein S5 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749095|gb|ACA66613.1| ribosomal protein S5 [Yersinia pseudotuberculosis YPIII]
 gi|186700193|gb|ACC90822.1| ribosomal protein S5 [Yersinia pseudotuberculosis PB1/+]
 gi|229678652|gb|EEO74757.1| 30S ribosomal subunit protein S5 [Yersinia pestis Nepal516]
 gi|229690476|gb|EEO82530.1| 30S ribosomal subunit protein S5 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696450|gb|EEO86497.1| 30S ribosomal subunit protein S5 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706360|gb|EEO92367.1| 30S ribosomal subunit protein S5 [Yersinia pestis Pestoides A]
 gi|238722921|gb|EEQ14571.1| hypothetical protein yfred0001_27010 [Yersinia frederiksenii ATCC
           33641]
 gi|262360383|gb|ACY57104.1| 30S ribosomal protein S5 [Yersinia pestis D106004]
 gi|262364334|gb|ACY60891.1| 30S ribosomal protein S5 [Yersinia pestis D182038]
 gi|270336752|gb|EFA47529.1| ribosomal protein S5 [Yersinia pestis KIM D27]
 gi|294352762|gb|ADE63103.1| 30S ribosomal protein S5 [Yersinia pestis Z176003]
 gi|320013359|gb|ADV96930.1| 30S ribosomal subunit protein S5 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 167

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R MI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRAMINVAL-NNGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT   L     P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEEILGK 167


>gi|227530222|ref|ZP_03960271.1| 30S ribosomal protein S5 [Lactobacillus vaginalis ATCC 49540]
 gi|227349897|gb|EEJ40188.1| 30S ribosomal protein S5 [Lactobacillus vaginalis ATCC 49540]
          Length = 169

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/166 (42%), Positives = 110/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + D++VAINR++  + GGRR  F+ LV+VGD K  VGF    A+EVPEA+R
Sbjct: 5   EFIDPAKLDLDDQVVAINRITKVVKGGRRMRFAALVIVGDRKGHVGFGTGKAQEVPEAIR 64

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA  AA++N+I+V ++ G T+ H+ +G +G GK++++ A+ G+GV AGGA+R V ++ G+
Sbjct: 65  KAQAAAEKNLITVPIV-GTTIPHEVIGTYGGGKIMLKPAVEGSGVAAGGAVRNVMDLAGV 123

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +K +GS+ P NV+RATFE L+      +VA  RG+    L  
Sbjct: 124 ADVTSKRLGSNTPVNVVRATFEGLKQLKSAEEVAKLRGVSVDHLAE 169


>gi|238018640|ref|ZP_04599066.1| hypothetical protein VEIDISOL_00475 [Veillonella dispar ATCC 17748]
 gi|269798533|ref|YP_003312433.1| ribosomal protein S5 [Veillonella parvula DSM 2008]
 gi|282849881|ref|ZP_06259264.1| ribosomal protein S5 [Veillonella parvula ATCC 17745]
 gi|294792811|ref|ZP_06757958.1| ribosomal protein S5 [Veillonella sp. 6_1_27]
 gi|294794565|ref|ZP_06759701.1| ribosomal protein S5 [Veillonella sp. 3_1_44]
 gi|313892987|ref|ZP_07826564.1| ribosomal protein S5 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237865111|gb|EEP66401.1| hypothetical protein VEIDISOL_00475 [Veillonella dispar ATCC 17748]
 gi|269095162|gb|ACZ25153.1| ribosomal protein S5 [Veillonella parvula DSM 2008]
 gi|282580318|gb|EFB85718.1| ribosomal protein S5 [Veillonella parvula ATCC 17745]
 gi|294454895|gb|EFG23268.1| ribosomal protein S5 [Veillonella sp. 3_1_44]
 gi|294456710|gb|EFG25073.1| ribosomal protein S5 [Veillonella sp. 6_1_27]
 gi|313442340|gb|EFR60755.1| ribosomal protein S5 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 167

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   RIDYTSLDLKERVVFINRVAKVVKGGRRFSFSALVVVGDGNGYVGVGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             + AK+N+++V++ +  T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E++G+ 
Sbjct: 63  GIDDAKKNIVNVAIKN-GTIPHSVTGVFGAGRVFLKPAAEGTGVIAGGPVRAVLELVGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +++ KS+GSSNP+N++RAT E L+      +VA  RG     + 
Sbjct: 122 NILTKSLGSSNPNNMVRATIEGLKDLKRASEVAELRGKTVEEIY 165


>gi|153854987|ref|ZP_01996200.1| hypothetical protein DORLON_02206 [Dorea longicatena DSM 13814]
 gi|149752484|gb|EDM62415.1| hypothetical protein DORLON_02206 [Dorea longicatena DSM 13814]
          Length = 169

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 66/168 (39%), Positives = 98/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   RQERIDANSLELNEKVVSIKRVTKVVKGGRNMRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+ISV+L +  ++ HD +G+ G   V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAAKNLISVALDENDSVTHDYIGKFGGASVLLKKAPEGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E LR    P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIEGLRQIKTPEEVAKLRGKSVEEIFG 169


>gi|291619158|ref|YP_003521900.1| RpsE [Pantoea ananatis LMG 20103]
 gi|291154188|gb|ADD78772.1| RpsE [Pantoea ananatis LMG 20103]
 gi|327395487|dbj|BAK12909.1| 30S ribosomal protein S5 RpsE [Pantoea ananatis AJ13355]
          Length = 166

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L++  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMVNVALIN-GTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLGNMKSPEMVAAKRGKSVEEILG 166


>gi|33152937|ref|NP_874290.1| 30S ribosomal protein S5 [Haemophilus ducreyi 35000HP]
 gi|71153730|sp|Q7VKF0|RS5_HAEDU RecName: Full=30S ribosomal protein S5
 gi|33149162|gb|AAP96679.1| 30S ribosomal protein S5 [Haemophilus ducreyi 35000HP]
          Length = 166

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVEEIWG 166


>gi|127511109|ref|YP_001092306.1| 30S ribosomal protein S5 [Shewanella loihica PV-4]
 gi|171855241|sp|A3Q999|RS5_SHELP RecName: Full=30S ribosomal protein S5
 gi|126636404|gb|ABO22047.1| SSU ribosomal protein S5P [Shewanella loihica PV-4]
          Length = 167

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +    + + + +++VA+NRVS  + GGR F+F+ L VVGD   KVG+ +  AREVP A++
Sbjct: 3   KFEAPQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGYGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RN++SV L++  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNIVSVELVN-GTLHHPVKGRHTGSRVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 122 HNVLSKAYGSTNPINIVRATVDALVHMKSPAQIAAKRGLNVDEIRG 167


>gi|85060239|ref|YP_455941.1| 30S ribosomal protein S5 [Sodalis glossinidius str. 'morsitans']
 gi|123518713|sp|Q2NQN9|RS5_SODGM RecName: Full=30S ribosomal protein S5
 gi|84780759|dbj|BAE75536.1| 30S ribosomal protein S5 [Sodalis glossinidius str. 'morsitans']
          Length = 166

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMMNVAL-NSGTLQHPIKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDALGNMKSPEMVAAKRGKSVEEILG 166


>gi|254163231|ref|YP_003046339.1| 30S ribosomal protein S5 [Escherichia coli B str. REL606]
 gi|253975132|gb|ACT40803.1| 30S ribosomal protein S5 [Escherichia coli B str. REL606]
          Length = 167

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+ AV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMCAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMNSPAMVAAKRGKSVEEILGK 167


>gi|118444110|ref|YP_877215.1| 30S ribosomal protein S5 [Clostridium novyi NT]
 gi|171460883|sp|A0PXW3|RS5_CLONN RecName: Full=30S ribosomal protein S5
 gi|118134566|gb|ABK61610.1| ribosomal protein S5 [Clostridium novyi NT]
          Length = 165

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 97/165 (58%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FS LVVVGD    VG     A E+PEA+RK
Sbjct: 2   RIDPSTLNLKEKVVFINRVAKVVKGGRNFRFSALVVVGDENGHVGVGMGKAVEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++++ V+++D  T+ H   G  G G+V++  A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKHLVEVAMVD-TTVPHAIQGEFGRGRVLIMPATEGTGVIAGGPVRAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT   L        +A  RG     +  
Sbjct: 121 DVRAKSLGSNNPKNMVGATINGLSRLRTAEQIAKLRGKSVEEILG 165


>gi|119383528|ref|YP_914584.1| 30S ribosomal protein S5 [Paracoccus denitrificans PD1222]
 gi|189045480|sp|A1B044|RS5_PARDP RecName: Full=30S ribosomal protein S5
 gi|119373295|gb|ABL68888.1| SSU ribosomal protein S5P [Paracoccus denitrificans PD1222]
          Length = 188

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 97/171 (56%), Positives = 127/171 (74%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD + +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R++I V L DGRTLHHD  GRHGAGKVIMR+A+ GTG+IAGG +RAV E+LG+ DVVAKS
Sbjct: 78  RSLIRVPLRDGRTLHHDIEGRHGAGKVIMRTAVPGTGIIAGGPMRAVFEMLGVQDVVAKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
            GS NP+N+IRAT + L+ ++ PR+VA RRG K + +       ++++  +
Sbjct: 138 QGSQNPYNMIRATIDGLKKEASPRNVAQRRGKKVAEILPSNDKPAEAAVEA 188


>gi|255262034|ref|ZP_05341376.1| ribosomal protein S5 [Thalassiobium sp. R2A62]
 gi|255104369|gb|EET47043.1| ribosomal protein S5 [Thalassiobium sp. R2A62]
          Length = 193

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 99/160 (61%), Positives = 121/160 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE+AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATESAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RNMI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RNMIRVPLREGRTLHHDMNGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGIKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           IGS NP+N+IRAT   L  ++ PR VA RRG K + +  R
Sbjct: 138 IGSQNPYNMIRATLNGLTKEASPRSVAQRRGKKVADILPR 177


>gi|257791907|ref|YP_003182513.1| 30S ribosomal protein S5 [Eggerthella lenta DSM 2243]
 gi|257475804|gb|ACV56124.1| ribosomal protein S5 [Eggerthella lenta DSM 2243]
          Length = 175

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/171 (44%), Positives = 107/171 (62%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +        + +R+V INRVS  + GGRRFA + LVVVGD   +VG     ++EVP A
Sbjct: 3   RNKQDNAAVPELQERVVYINRVSKVVKGGRRFALTALVVVGDGNGRVGVGMGKSQEVPIA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++K  E AK+NM SV L   +TL H+ +G +GAG+V+++ A  GTGVIAGGA RAV E+ 
Sbjct: 63  IKKGVEDAKKNMFSVPLTAEKTLPHEIIGEYGAGRVLIKPATPGTGVIAGGAARAVMELA 122

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           G+ D  AKS+G+ N  NV++AT E L+S   P  V+ RRG+  S +   + 
Sbjct: 123 GVTDCFAKSLGTDNVMNVVKATAEGLKSMESPEQVSERRGMSVSKIYGWKE 173


>gi|160947683|ref|ZP_02094850.1| hypothetical protein PEPMIC_01618 [Parvimonas micra ATCC 33270]
 gi|158446817|gb|EDP23812.1| hypothetical protein PEPMIC_01618 [Parvimonas micra ATCC 33270]
          Length = 168

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           +E     + +R+VAINRV+  + GGR F FSVLVVVGD    VG     A EVPEA+RK 
Sbjct: 6   KEVEGLELEERVVAINRVTKVVKGGRNFRFSVLVVVGDGNGHVGVGIGKALEVPEAIRKG 65

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            + AK+++I V L++  T+ H+ VG  GAG+V+++ A AGTGVIAGG +RAVCE+ G+ D
Sbjct: 66  VQDAKKHVIRVPLVN-TTIPHEIVGVFGAGRVLLKPAGAGTGVIAGGPVRAVCELAGIKD 124

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V +KS+G++N  N++ AT E L++     D+A  RG     +  
Sbjct: 125 VRSKSLGTTNARNIVNATMEGLKNLKRAEDIARLRGKSVEEILG 168


>gi|291166862|gb|EFE28908.1| 30S ribosomal protein S5 [Filifactor alocis ATCC 35896]
          Length = 168

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/168 (45%), Positives = 99/168 (58%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  + R   +  ++V I RV+  + GGR F F+ LVVVGD    V      A EVPEA
Sbjct: 2   QRKRIDARQLDLETKVVNIRRVTKVVKGGRNFRFAALVVVGDGNGHVALGTGKASEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA E AK+NMI V ++ G T+ H   GR GAG VI+  A  GTGV+AGG +RAV E+ 
Sbjct: 62  IRKAEEDAKKNMIEVPMV-GTTIPHVVKGRFGAGYVIIMPAPEGTGVLAGGPVRAVLELA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ DV AKSIG++N  N++ AT E L+S      VA  RG K   L  
Sbjct: 121 GIEDVRAKSIGTNNERNMVNATMEGLKSLRTIEQVAELRGKKVEDLLG 168


>gi|157372759|ref|YP_001480748.1| 30S ribosomal protein S5 [Serratia proteamaculans 568]
 gi|270264356|ref|ZP_06192622.1| 30S ribosomal protein S5 [Serratia odorifera 4Rx13]
 gi|189045437|sp|A8GKI0|RS5_SERP5 RecName: Full=30S ribosomal protein S5
 gi|157324523|gb|ABV43620.1| ribosomal protein S5 [Serratia proteamaculans 568]
 gi|270041492|gb|EFA14590.1| 30S ribosomal protein S5 [Serratia odorifera 4Rx13]
          Length = 167

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+R MI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRAMINVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT   L     P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEEILGK 167


>gi|188535261|ref|YP_001909058.1| 30S ribosomal protein S5 [Erwinia tasmaniensis Et1/99]
 gi|292489832|ref|YP_003532722.1| 30S ribosomal protein S5 [Erwinia amylovora CFBP1430]
 gi|292900874|ref|YP_003540243.1| 30S ribosomal protein S5 [Erwinia amylovora ATCC 49946]
 gi|188030303|emb|CAO98192.1| 30S ribosomal protein S5 [Erwinia tasmaniensis Et1/99]
 gi|291200722|emb|CBJ47855.1| 30S ribosomal subunit protein S5 [Erwinia amylovora ATCC 49946]
 gi|291555269|emb|CBA23555.1| 30S ribosomal protein S5 [Erwinia amylovora CFBP1430]
 gi|312174014|emb|CBX82267.1| 30S ribosomal protein S5 [Erwinia amylovora ATCC BAA-2158]
          Length = 166

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   ++GF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRIGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATLDGLANMNSPEMVAAKRGKSVEDILG 166


>gi|168187797|ref|ZP_02622432.1| ribosomal protein S5 [Clostridium botulinum C str. Eklund]
 gi|169294361|gb|EDS76494.1| ribosomal protein S5 [Clostridium botulinum C str. Eklund]
          Length = 165

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 97/165 (58%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FS LVVVGD    VG     A E+PEA+RK
Sbjct: 2   RIDPSTLNLKEKVVFINRVAKVVKGGRNFRFSALVVVGDENGHVGVGMGKAVEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++++ V+++D  T+ H   G  G G+V++  A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  GIEDAKKHLVEVAMVD-TTVPHVIQGEFGRGRVLIMPATEGTGVIAGGPVRAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT   L        +A  RG     +  
Sbjct: 121 DVRAKSLGSNNPKNMVGATINGLSRLRTAEQIAKLRGKSVEEILG 165


>gi|222056688|ref|YP_002539050.1| ribosomal protein S5 [Geobacter sp. FRC-32]
 gi|221565977|gb|ACM21949.1| ribosomal protein S5 [Geobacter sp. FRC-32]
          Length = 163

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 78/158 (49%), Positives = 108/158 (68%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                + ++ DR+V I+RV+  + GGRRF+FS LVVVGD    VG+    A EVPEA+RK
Sbjct: 3   KINPNEINLTDRVVHISRVAKVVKGGRRFSFSALVVVGDGNGYVGYGLGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V +++G+T+  +  GR GAGKV+M  A AGTGVIAGGA RAV E  G+H
Sbjct: 63  GVEQAKKNLIKVPIVEGQTIPFEIEGRFGAGKVLMMPASAGTGVIAGGAARAVFESAGVH 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGI 171
           +++AK +GS+NPHNV++A F  L     P ++  RRG+
Sbjct: 123 NILAKCLGSNNPHNVVKAAFAGLMRLRTPEELIMRRGL 160


>gi|253771873|ref|YP_003034704.1| 30S ribosomal protein S5 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|297516613|ref|ZP_06934999.1| 30S ribosomal protein S5 [Escherichia coli OP50]
 gi|242378830|emb|CAQ33622.1| 30S ribosomal subunit protein S5, subunit of 30S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gi|253322917|gb|ACT27519.1| ribosomal protein S5 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253979288|gb|ACT44958.1| 30S ribosomal protein S5 [Escherichia coli BL21(DE3)]
          Length = 167

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  +
Sbjct: 124 LAKAYGSTNPINVVRATIDGLENMNSPAMVAAKRGKSVEEILGK 167


>gi|326773981|ref|ZP_08233263.1| ribosomal protein S5 [Actinomyces viscosus C505]
 gi|326636120|gb|EGE37024.1| ribosomal protein S5 [Actinomyces viscosus C505]
          Length = 235

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 1/175 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            ++R+V INRVS  + GGRRF F+ LVVVGD +  VG  +  A+EVP A+ KA E AK+N
Sbjct: 48  YIERVVTINRVSKVVKGGRRFTFTALVVVGDGEGTVGVGYGKAKEVPSAIAKAVEIAKKN 107

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
              V ++  RT+ H   G   AG V++R A  GTGVIAGG +RAV +  G+HD+++KS+G
Sbjct: 108 FFHVPMIR-RTIPHLVQGEDSAGVVLLRPASPGTGVIAGGPVRAVLDCAGVHDILSKSLG 166

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           SSN  N++ AT + L+    P  VA RRG+    +  + ++ +++   +      
Sbjct: 167 SSNAINIVHATVDALKQLEQPEAVAARRGLPLEDVAPQSMLRARAEGEADKRAQA 221


>gi|239905875|ref|YP_002952614.1| 30S ribosomal protein S5 [Desulfovibrio magneticus RS-1]
 gi|239795739|dbj|BAH74728.1| 30S ribosomal protein S5 [Desulfovibrio magneticus RS-1]
          Length = 177

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 82/174 (47%), Positives = 115/174 (66%), Gaps = 1/174 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA     +       ++ D S +++IV +NRV+  + GGRRF+FS LVVVGD K  VG+ 
Sbjct: 1   MAASNSKRAKEDGMEQQSDLSQIEKIVYLNRVAKVVKGGRRFSFSALVVVGDGKGSVGYG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A EVPEA+RKATE A++ MI V LLD  TL ++ +G+ GAG+V+++ A  GTG+IAG
Sbjct: 61  LGKANEVPEAIRKATEQARKAMIRVPLLD-GTLPYEILGQFGAGRVMLKPASKGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           G +RA+ E  G+HD++ K+IG++NPHNV+RAT E L S      V+  RG   S
Sbjct: 120 GPVRAIMEACGVHDILTKAIGTNNPHNVLRATMEGLASLRSADSVSAMRGKALS 173


>gi|227533977|ref|ZP_03964026.1| ribosomal protein S5 [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227188354|gb|EEI68421.1| ribosomal protein S5 [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 180

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/180 (41%), Positives = 113/180 (62%), Gaps = 4/180 (2%)

Query: 1   MAQKERSQRDNW---QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKV 57
           MA   R + DN       +     + D++V+INRV+  + GGRR  F+ + +VGD    V
Sbjct: 1   MASNSRKKEDNQHMASFIDPNQLDLEDQVVSINRVTKVVKGGRRLRFAAIAIVGDKNGHV 60

Query: 58  GFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGV 117
           GFA   A+EVPEA+RKA +AAK+++I V ++ G T+ H+ +G  GAG+V+++ A  G+GV
Sbjct: 61  GFATGKAQEVPEAIRKAVDAAKKSLIEVPIV-GTTIPHEVIGHFGAGEVLLKPAEEGSGV 119

Query: 118 IAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            AGGAIR+V E+ G+ D+ +KS+G + P N+IRAT + L        VA  RG+  S L+
Sbjct: 120 AAGGAIRSVMELAGIADITSKSLGRNTPINMIRATMDGLTQLRTREQVAELRGVSASSLE 179


>gi|223042020|ref|ZP_03612201.1| 30S ribosomal protein S5 [Actinobacillus minor 202]
 gi|240948158|ref|ZP_04752561.1| 30S ribosomal protein S5 [Actinobacillus minor NM305]
 gi|322515617|ref|ZP_08068596.1| 30S ribosomal protein S5 [Actinobacillus ureae ATCC 25976]
 gi|223017182|gb|EEF15613.1| 30S ribosomal protein S5 [Actinobacillus minor 202]
 gi|240297511|gb|EER48018.1| 30S ribosomal protein S5 [Actinobacillus minor NM305]
 gi|322118327|gb|EFX90602.1| 30S ribosomal protein S5 [Actinobacillus ureae ATCC 25976]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVEEILG 166


>gi|68536884|ref|YP_251589.1| 30S ribosomal protein S5 [Corynebacterium jeikeium K411]
 gi|91207860|sp|Q4JT86|RS5_CORJK RecName: Full=30S ribosomal protein S5
 gi|68264483|emb|CAI37971.1| 30S ribosomal protein S5 [Corynebacterium jeikeium K411]
          Length = 213

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 70/186 (37%), Positives = 116/186 (62%), Gaps = 1/186 (0%)

Query: 3   QKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHS 62
           + +R  R++ +N+++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD +  VG  + 
Sbjct: 26  RNDRGGRNDRRNQQDERSQFIERVVTINRVSKVVKGGRRFSFTALVIVGDGQGMVGVGYG 85

Query: 63  TAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGA 122
            A+EVP A++K  E A++N   V +++  T+ H   G   AG V+M+ A  GTGVIAGGA
Sbjct: 86  KAKEVPAAIQKGAEEARKNFFRVPMIN-GTITHPVQGEDAAGIVMMKPAAPGTGVIAGGA 144

Query: 123 IRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVV 182
           +R V E  G+ D+++KS+GS N  N++ AT   L+    P +VA RRG     +    ++
Sbjct: 145 VRPVLECAGVQDILSKSLGSDNAINIVHATVAGLKQLVRPEEVAARRGKSLDEVAPAAML 204

Query: 183 SSKSSS 188
            ++++ 
Sbjct: 205 RARAAG 210


>gi|300857229|ref|YP_003782213.1| 30S ribosomal protein S5 [Clostridium ljungdahlii DSM 13528]
 gi|300437344|gb|ADK17111.1| 30S ribosomal protein S5 [Clostridium ljungdahlii DSM 13528]
          Length = 165

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FS LVVVGD    VG     + E+PEA+RK
Sbjct: 2   RIDPSALNLKEKVVFINRVAKVVKGGRNFRFSALVVVGDENGHVGVGTGKSIEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V ++ G T+ H   G+ G G+V++ +A  GTG+IAGG  RAV E+ G+ 
Sbjct: 62  GIEDAKKNLIEVPII-GTTVPHSIAGQFGTGRVLIMTAPEGTGIIAGGPSRAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT + L        +A+ RG     +  
Sbjct: 121 DVRAKSVGSNNPRNMVNATIDGLSRLKTAEHIASLRGKTVEEILG 165


>gi|124003678|ref|ZP_01688526.1| ribosomal protein S5 [Microscilla marina ATCC 23134]
 gi|123990733|gb|EAY30200.1| ribosomal protein S5 [Microscilla marina ATCC 23134]
          Length = 171

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/169 (43%), Positives = 109/169 (64%), Gaps = 1/169 (0%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           +   +  +  +  + +++VAINRV+  + GGRRF+FS +VVVGD    VG+    A EV 
Sbjct: 2   QQRKKAIKASETDLKEKVVAINRVAKVVKGGRRFSFSAIVVVGDGNGTVGYGLGKANEVT 61

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           +A+ K  E AK+N++ V +L   T+ H   G++  G V+++ A  GTGVIAGGA+RAV E
Sbjct: 62  DAITKGVEDAKKNLVKVPILK-NTIPHSMEGKYSGGFVLLKPASPGTGVIAGGAMRAVLE 120

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
             G+ DV+AKS GSSNPHNV++ATF+ L+    P +VA +RGI    + 
Sbjct: 121 SAGIKDVLAKSKGSSNPHNVVKATFDALKKMKAPHEVAYQRGISLEKVF 169


>gi|85858164|ref|YP_460366.1| 30S ribosomal protein S5P [Syntrophus aciditrophicus SB]
 gi|123515686|sp|Q2LQC0|RS5_SYNAS RecName: Full=30S ribosomal protein S5
 gi|85721255|gb|ABC76198.1| SSU ribosomal protein S5P [Syntrophus aciditrophicus SB]
          Length = 164

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 70/164 (42%), Positives = 106/164 (64%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
             ++  +   +DR++AINR +  + GGRRF FS +VVVGD    VG     A EVPEA+R
Sbjct: 2   DKKDLGEVEYLDRVIAINRTAKVVKGGRRFRFSAIVVVGDGNGSVGAGLGKAHEVPEAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK++M  + + +  T+ ++ +G+ GAG+V+++ A  GTG+IAGGA+RAV EV G+
Sbjct: 62  KGMEQAKKSMTKIEI-EKGTIPYEVIGKFGAGRVLLKPASEGTGLIAGGAVRAVLEVAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           H+++ K +GS NPHN+++AT E L     P  +A  RG   S +
Sbjct: 121 HNILTKCLGSHNPHNLVKATIEGLCRLESPGRIAASRGKSISEI 164


>gi|229552725|ref|ZP_04441450.1| ribosomal protein S5 [Lactobacillus rhamnosus LMS2-1]
 gi|229313931|gb|EEN79904.1| ribosomal protein S5 [Lactobacillus rhamnosus LMS2-1]
          Length = 180

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/180 (42%), Positives = 113/180 (62%), Gaps = 4/180 (2%)

Query: 1   MAQKERSQRDNW---QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKV 57
           MA   R + DN       +     + D++VAINRV+  + GGRR  F+ + +VGD    V
Sbjct: 1   MASNSRKKEDNQHMASFIDPNQLDLEDQVVAINRVTKVVKGGRRLRFAAIAIVGDKNGHV 60

Query: 58  GFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGV 117
           GFA   A+EVPEA+RKA +AAK+++I V ++ G T+ H+ +G  GAG+V+++ A  G+GV
Sbjct: 61  GFATGKAQEVPEAIRKAVDAAKKSLIEVPIV-GTTIPHEVIGHFGAGEVLLKPAEEGSGV 119

Query: 118 IAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            AGGAIR+V E+ G+ D+ +KS+G + P N+IRAT + L        VA  RG+  S L+
Sbjct: 120 AAGGAIRSVMELAGIADITSKSLGRNTPINMIRATMDGLTQLRTREQVAELRGVSASSLE 179


>gi|313818002|gb|EFS55716.1| ribosomal protein S5 [Propionibacterium acnes HL046PA2]
 gi|314960851|gb|EFT04952.1| ribosomal protein S5 [Propionibacterium acnes HL002PA2]
 gi|315086845|gb|EFT58821.1| ribosomal protein S5 [Propionibacterium acnes HL002PA3]
          Length = 215

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 80/177 (45%), Positives = 109/177 (61%), Gaps = 1/177 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
             R    +R    N  ++R+VAINRV+  + GGRRF+F+ LVVVGD +  VG  +  A+E
Sbjct: 19  DNRRGQNDRNRNQNEYLERVVAINRVAKVVQGGRRFSFTALVVVGDGEGSVGVGYGKAKE 78

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP A+ KA E AK++   V L+ GRT+ H  +G   AG V++R A  GTGVIAGG+ RAV
Sbjct: 79  VPAAIAKAVEEAKKHFFKVPLV-GRTITHPVIGEKAAGVVMLRPASPGTGVIAGGSARAV 137

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
            E  G+HDV+AKS+GSSN  NV+ AT + L+    P  VA RRG     +    ++ 
Sbjct: 138 LECAGVHDVLAKSLGSSNAINVVHATVDALQQLEEPEAVARRRGKSVEDIAPAAMLR 194


>gi|95930505|ref|ZP_01313241.1| ribosomal protein S5 [Desulfuromonas acetoxidans DSM 684]
 gi|95133545|gb|EAT15208.1| ribosomal protein S5 [Desulfuromonas acetoxidans DSM 684]
          Length = 161

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/159 (48%), Positives = 108/159 (67%), Gaps = 1/159 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E+ +  ++DR++ INR +  + GGRRF+FS LVVVGD   +VGF H  A+EVPEA+RK
Sbjct: 3   RNEQNETEMIDRVIHINRCAKVVKGGRRFSFSALVVVGDGNGQVGFGHGKAKEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NMI V L D RT+  D +G  GAG V+++ A  GTGVIAGG  RAV E  G+ 
Sbjct: 63  GVEKAKKNMIQVPLDD-RTIPFDVLGNFGAGSVLLKPASKGTGVIAGGPARAVLEAAGVG 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIK 172
           D+++K +GS+NPHNV++AT + L+      ++  RRG+ 
Sbjct: 122 DILSKCLGSNNPHNVVKATMDALKQLKSADEIKARRGLT 160


>gi|259909982|ref|YP_002650338.1| 30S ribosomal protein S5 [Erwinia pyrifoliae Ep1/96]
 gi|224965604|emb|CAX57136.1| 30S ribosomal protein S5 [Erwinia pyrifoliae Ep1/96]
 gi|283480080|emb|CAY75996.1| 30S ribosomal protein S5 [Erwinia pyrifoliae DSM 12163]
 gi|310765581|gb|ADP10531.1| 30S ribosomal protein S5 [Erwinia sp. Ejp617]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 111/163 (68%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   ++GF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRIGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +G TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NGGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATLDGLANMNSPEMVAAKRGKSVEDILG 166


>gi|15925223|ref|NP_372757.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus Mu50]
 gi|15927813|ref|NP_375346.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus N315]
 gi|21283881|ref|NP_646969.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus MW2]
 gi|49484449|ref|YP_041673.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49487015|ref|YP_044236.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650817|ref|YP_187032.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus COL]
 gi|82751822|ref|YP_417563.1| 30S ribosomal protein S5 [Staphylococcus aureus RF122]
 gi|87159908|ref|YP_494822.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196145|ref|YP_500962.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268673|ref|YP_001247616.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394738|ref|YP_001317413.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus JH1]
 gi|156980548|ref|YP_001442807.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus Mu3]
 gi|161510437|ref|YP_001576096.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221140165|ref|ZP_03564658.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253729899|ref|ZP_04864064.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734358|ref|ZP_04868523.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255007013|ref|ZP_05145614.2| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257423718|ref|ZP_05600147.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257426396|ref|ZP_05602798.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257429035|ref|ZP_05605422.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257431681|ref|ZP_05608044.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus E1410]
 gi|257434642|ref|ZP_05610693.1| SSU ribosomal protein S5 [Staphylococcus aureus subsp. aureus M876]
 gi|257794579|ref|ZP_05643558.1| 30S ribosomal protein S5 [Staphylococcus aureus A9781]
 gi|258408819|ref|ZP_05681103.1| 30S ribosomal protein S5 [Staphylococcus aureus A9763]
 gi|258422418|ref|ZP_05685330.1| SSU ribosomal protein S5 [Staphylococcus aureus A9719]
 gi|258422680|ref|ZP_05685585.1| SSU ribosomal protein S5 [Staphylococcus aureus A9635]
 gi|258439807|ref|ZP_05690553.1| ribosomal protein S5 [Staphylococcus aureus A9299]
 gi|258442637|ref|ZP_05691197.1| ribosomal protein S5 [Staphylococcus aureus A8115]
 gi|258446664|ref|ZP_05694819.1| 30S ribosomal protein S5 [Staphylococcus aureus A6300]
 gi|258450218|ref|ZP_05698310.1| 30S ribosomal protein S5 [Staphylococcus aureus A6224]
 gi|258450771|ref|ZP_05698830.1| ribosomal protein S5 [Staphylococcus aureus A5948]
 gi|258455410|ref|ZP_05703370.1| 30S ribosomal protein S5 [Staphylococcus aureus A5937]
 gi|262048500|ref|ZP_06021384.1| 30S ribosomal protein S5 [Staphylococcus aureus D30]
 gi|262052025|ref|ZP_06024236.1| 30S ribosomal protein S5 [Staphylococcus aureus 930918-3]
 gi|269203866|ref|YP_003283135.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus ED98]
 gi|282893671|ref|ZP_06301903.1| 30S ribosomal protein S5 [Staphylococcus aureus A8117]
 gi|282902136|ref|ZP_06310029.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus C160]
 gi|282906576|ref|ZP_06314424.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909546|ref|ZP_06317357.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911793|ref|ZP_06319589.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282915082|ref|ZP_06322859.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus M899]
 gi|282917578|ref|ZP_06325330.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus D139]
 gi|282920808|ref|ZP_06328526.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus C427]
 gi|282922102|ref|ZP_06329798.1| 30S ribosomal protein S5 [Staphylococcus aureus A9765]
 gi|282925713|ref|ZP_06333361.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus C101]
 gi|282926779|ref|ZP_06334406.1| 30S ribosomal protein S5 [Staphylococcus aureus A10102]
 gi|283767325|ref|ZP_06340240.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus H19]
 gi|283959011|ref|ZP_06376452.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284025259|ref|ZP_06379657.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus 132]
 gi|293497486|ref|ZP_06665340.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293511061|ref|ZP_06669758.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus M809]
 gi|293549667|ref|ZP_06672339.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus M1015]
 gi|294848766|ref|ZP_06789511.1| 30S ribosomal protein S5 [Staphylococcus aureus A9754]
 gi|295404909|ref|ZP_06814722.1| 30S ribosomal protein S5 [Staphylococcus aureus A8819]
 gi|295428816|ref|ZP_06821440.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275976|ref|ZP_06858483.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus MR1]
 gi|297209954|ref|ZP_06926350.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297243967|ref|ZP_06927857.1| 30S ribosomal protein S5 [Staphylococcus aureus A8796]
 gi|297589698|ref|ZP_06948339.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus MN8]
 gi|300910966|ref|ZP_07128416.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304379417|ref|ZP_07362152.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|54039519|sp|P66579|RS5_STAAN RecName: Full=30S ribosomal protein S5
 gi|54039520|sp|P66580|RS5_STAAW RecName: Full=30S ribosomal protein S5
 gi|54041970|sp|P66578|RS5_STAAM RecName: Full=30S ribosomal protein S5
 gi|73919099|sp|Q5HDX5|RS5_STAAC RecName: Full=30S ribosomal protein S5
 gi|73919100|sp|Q6GEK0|RS5_STAAR RecName: Full=30S ribosomal protein S5
 gi|73919101|sp|Q6G788|RS5_STAAS RecName: Full=30S ribosomal protein S5
 gi|91207889|sp|Q2YYL4|RS5_STAAB RecName: Full=30S ribosomal protein S5
 gi|122538863|sp|Q2FW23|RS5_STAA8 RecName: Full=30S ribosomal protein S5
 gi|123484797|sp|Q2FEQ6|RS5_STAA3 RecName: Full=30S ribosomal protein S5
 gi|189045439|sp|A7X5D8|RS5_STAA1 RecName: Full=30S ribosomal protein S5
 gi|189045440|sp|A6U3V8|RS5_STAA2 RecName: Full=30S ribosomal protein S5
 gi|189045441|sp|A5IV17|RS5_STAA9 RecName: Full=30S ribosomal protein S5
 gi|189045443|sp|A8Z340|RS5_STAAT RecName: Full=30S ribosomal protein S5
 gi|13702033|dbj|BAB43325.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus N315]
 gi|14248006|dbj|BAB58395.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus Mu50]
 gi|21205323|dbj|BAB96017.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242578|emb|CAG41299.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49245458|emb|CAG43935.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285003|gb|AAW37097.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus COL]
 gi|82657353|emb|CAI81794.1| 30S ribosomal protein S5 [Staphylococcus aureus RF122]
 gi|87125882|gb|ABD20396.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203703|gb|ABD31513.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147741742|gb|ABQ50040.1| SSU ribosomal protein S5P [Staphylococcus aureus subsp. aureus JH9]
 gi|149947190|gb|ABR53126.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus JH1]
 gi|156722683|dbj|BAF79100.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus Mu3]
 gi|160369246|gb|ABX30217.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253726346|gb|EES95075.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727675|gb|EES96404.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272736|gb|EEV04838.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276027|gb|EEV07478.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257279516|gb|EEV10103.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257282560|gb|EEV12692.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus E1410]
 gi|257285238|gb|EEV15354.1| SSU ribosomal protein S5 [Staphylococcus aureus subsp. aureus M876]
 gi|257788551|gb|EEV26891.1| 30S ribosomal protein S5 [Staphylococcus aureus A9781]
 gi|257840502|gb|EEV64962.1| 30S ribosomal protein S5 [Staphylococcus aureus A9763]
 gi|257841849|gb|EEV66286.1| SSU ribosomal protein S5 [Staphylococcus aureus A9719]
 gi|257847091|gb|EEV71100.1| SSU ribosomal protein S5 [Staphylococcus aureus A9635]
 gi|257847583|gb|EEV71585.1| ribosomal protein S5 [Staphylococcus aureus A9299]
 gi|257851758|gb|EEV75692.1| ribosomal protein S5 [Staphylococcus aureus A8115]
 gi|257854732|gb|EEV77680.1| 30S ribosomal protein S5 [Staphylococcus aureus A6300]
 gi|257856310|gb|EEV79219.1| 30S ribosomal protein S5 [Staphylococcus aureus A6224]
 gi|257861554|gb|EEV84356.1| ribosomal protein S5 [Staphylococcus aureus A5948]
 gi|257862621|gb|EEV85389.1| 30S ribosomal protein S5 [Staphylococcus aureus A5937]
 gi|259160080|gb|EEW45113.1| 30S ribosomal protein S5 [Staphylococcus aureus 930918-3]
 gi|259163358|gb|EEW47916.1| 30S ribosomal protein S5 [Staphylococcus aureus D30]
 gi|262076156|gb|ACY12129.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus ED98]
 gi|269941822|emb|CBI50232.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus TW20]
 gi|282312542|gb|EFB42946.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus C101]
 gi|282315223|gb|EFB45607.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus C427]
 gi|282318540|gb|EFB48898.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus D139]
 gi|282320803|gb|EFB51137.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus M899]
 gi|282323489|gb|EFB53805.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus WBG10049]
 gi|282326525|gb|EFB56827.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329475|gb|EFB58996.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282591230|gb|EFB96303.1| 30S ribosomal protein S5 [Staphylococcus aureus A10102]
 gi|282593570|gb|EFB98563.1| 30S ribosomal protein S5 [Staphylococcus aureus A9765]
 gi|282596595|gb|EFC01554.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus C160]
 gi|282763729|gb|EFC03857.1| 30S ribosomal protein S5 [Staphylococcus aureus A8117]
 gi|283461204|gb|EFC08288.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus H19]
 gi|283471455|emb|CAQ50666.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus ST398]
 gi|283788603|gb|EFC27430.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817895|gb|ADC38382.1| 30S ribosomal protein S5 [Staphylococcus aureus 04-02981]
 gi|290918714|gb|EFD95790.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus M1015]
 gi|291096417|gb|EFE26675.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466048|gb|EFF08577.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus M809]
 gi|294824145|gb|EFG40569.1| 30S ribosomal protein S5 [Staphylococcus aureus A9754]
 gi|294969854|gb|EFG45872.1| 30S ribosomal protein S5 [Staphylococcus aureus A8819]
 gi|295127165|gb|EFG56807.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296885627|gb|EFH24564.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297178745|gb|EFH37990.1| 30S ribosomal protein S5 [Staphylococcus aureus A8796]
 gi|297578209|gb|EFH96922.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus MN8]
 gi|298695489|gb|ADI98711.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887946|gb|EFK83141.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333869|gb|ADL24062.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302752106|gb|ADL66283.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304341949|gb|EFM07853.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437356|gb|ADQ76427.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312830582|emb|CBX35424.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315129687|gb|EFT85678.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193485|gb|EFU23881.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198237|gb|EFU28568.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140229|gb|EFW32088.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143499|gb|EFW35280.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440087|gb|EGA97802.1| 30S ribosomal protein S5 [Staphylococcus aureus O11]
 gi|323442761|gb|EGB00387.1| 30S ribosomal protein S5 [Staphylococcus aureus O46]
 gi|329314916|gb|AEB89329.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723492|gb|EGG60021.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus 21172]
 gi|329730380|gb|EGG66770.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus 21193]
 gi|329732054|gb|EGG68409.1| ribosomal protein S5 [Staphylococcus aureus subsp. aureus 21189]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 72/152 (47%), Positives = 103/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT + L++  +  DVA  RG     L 
Sbjct: 134 INMVRATIDGLQNLKNAEDVAKLRGKTVEELY 165


>gi|260579240|ref|ZP_05847126.1| 30S ribosomal protein S5 [Corynebacterium jeikeium ATCC 43734]
 gi|258602629|gb|EEW15920.1| 30S ribosomal protein S5 [Corynebacterium jeikeium ATCC 43734]
          Length = 216

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 70/186 (37%), Positives = 116/186 (62%), Gaps = 1/186 (0%)

Query: 3   QKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHS 62
           + +R  R++ +N+++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD +  VG  + 
Sbjct: 29  RNDRGGRNDRRNQQDERSQFIERVVTINRVSKVVKGGRRFSFTALVIVGDGQGMVGVGYG 88

Query: 63  TAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGA 122
            A+EVP A++K  E A++N   V +++  T+ H   G   AG V+M+ A  GTGVIAGGA
Sbjct: 89  KAKEVPAAIQKGAEEARKNFFRVPMIN-GTITHPVQGEDAAGVVMMKPAAPGTGVIAGGA 147

Query: 123 IRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVV 182
           +R V E  G+ D+++KS+GS N  N++ AT   L+    P +VA RRG     +    ++
Sbjct: 148 VRPVLECAGVQDILSKSLGSDNAINIVHATVAGLKQLVRPEEVAARRGKSLDEVAPAAML 207

Query: 183 SSKSSS 188
            ++++ 
Sbjct: 208 RARAAG 213


>gi|317489913|ref|ZP_07948405.1| ribosomal protein S5 [Eggerthella sp. 1_3_56FAA]
 gi|325829960|ref|ZP_08163418.1| ribosomal protein S5 [Eggerthella sp. HGA1]
 gi|316910911|gb|EFV32528.1| ribosomal protein S5 [Eggerthella sp. 1_3_56FAA]
 gi|325488127|gb|EGC90564.1| ribosomal protein S5 [Eggerthella sp. HGA1]
          Length = 175

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/171 (43%), Positives = 107/171 (62%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +        + +R+V INRVS  + GGRRFA + LVVVGD   +VG     ++EVP A
Sbjct: 3   RNKQDNAAVPELQERVVYINRVSKVVKGGRRFALTALVVVGDGNGRVGVGMGKSQEVPIA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++K  E AK+NM SV L   +TL H+ +G +GAG+V+++ A  GTGVIAGGA RAV E+ 
Sbjct: 63  IKKGVEDAKKNMFSVPLTAEKTLPHEIIGEYGAGRVLIKPATPGTGVIAGGAARAVMELA 122

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           G+ D  AKS+G+ N  NV++AT E L++   P  V+ RRG+  S +   + 
Sbjct: 123 GVTDCFAKSLGTDNVMNVVKATAEGLKNMESPEQVSERRGMSVSKIYGWKE 173


>gi|152998254|ref|YP_001343089.1| 30S ribosomal protein S5 [Marinomonas sp. MWYL1]
 gi|150839178|gb|ABR73154.1| ribosomal protein S5 [Marinomonas sp. MWYL1]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 78/164 (47%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            +++ + + +R+V +NRV+  + GGR F+F+ L VVGD   KVGF    AREVP+A++KA
Sbjct: 4   NDQQTSDLQERLVQVNRVAKVVKGGRIFSFTALTVVGDGNGKVGFGRGKAREVPQAIQKA 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM+SV  LDG TL +     HGA KV M+ A  GTGVIAGGA+RAV E++G+H+
Sbjct: 64  MEQARRNMVSV-RLDGDTLQYPIKASHGASKVFMQPASPGTGVIAGGAMRAVLEIVGVHN 122

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK  GS+NP NV+RAT + L+    P  +A +RG     +  
Sbjct: 123 VLAKCYGSTNPVNVVRATIKGLQDMKAPEQIAAKRGKSVDQILG 166


>gi|254509490|ref|ZP_05121557.1| ribosomal protein S5 [Rhodobacteraceae bacterium KLH11]
 gi|221533201|gb|EEE36189.1| ribosomal protein S5 [Rhodobacteraceae bacterium KLH11]
          Length = 192

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 97/161 (60%), Positives = 120/161 (74%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RQMIRVQLREGRTLHHDIEGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           +GS NP+N+IRAT   L+ +  PR VA RRG K + +  +R
Sbjct: 138 LGSQNPYNMIRATINGLQKEQSPRSVAQRRGKKVADILPKR 178


>gi|254477645|ref|ZP_05091031.1| ribosomal protein S5 [Ruegeria sp. R11]
 gi|214031888|gb|EEB72723.1| ribosomal protein S5 [Ruegeria sp. R11]
          Length = 188

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 98/161 (60%), Positives = 121/161 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RQMIRVQLKEGRTLHHDMHGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           IGS NP+N+IRAT + L+ +  PR VA RRG K + +  +R
Sbjct: 138 IGSQNPYNMIRATIDGLKKEQSPRSVAQRRGKKVADILPKR 178


>gi|116749007|ref|YP_845694.1| 30S ribosomal protein S5 [Syntrophobacter fumaroxidans MPOB]
 gi|171460795|sp|A0LIK7|RS5_SYNFM RecName: Full=30S ribosomal protein S5
 gi|116698071|gb|ABK17259.1| SSU ribosomal protein S5P [Syntrophobacter fumaroxidans MPOB]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/162 (47%), Positives = 110/162 (67%), Gaps = 1/162 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E     ++D++V I+RV+  + GGRRF+FS +VVVGD   +VGF+   A EVPEA+RK  
Sbjct: 5   ESSQLQLIDKVVHISRVAKVVKGGRRFSFSAIVVVGDGNGRVGFSLGKANEVPEAIRKGM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E+AKR M  V L++  T+ H+ +GR GA  V+++ A AGTGVIAGGA+RA+ E  G+H++
Sbjct: 65  ESAKRTMFEVPLVNA-TIPHEVLGRFGAASVVLKPASAGTGVIAGGAVRAIMEAAGIHNI 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           + K IGS NPHNV++AT E LR   +   VA  RG +   ++
Sbjct: 124 LTKCIGSRNPHNVVKATLEGLRRLRNVELVAKLRGREVHEIR 165


>gi|219849870|ref|YP_002464303.1| 30S ribosomal protein S5 [Chloroflexus aggregans DSM 9485]
 gi|254765686|sp|B8G6Q8|RS5_CHLAD RecName: Full=30S ribosomal protein S5
 gi|219544129|gb|ACL25867.1| ribosomal protein S5 [Chloroflexus aggregans DSM 9485]
          Length = 179

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/179 (42%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +        + +R+V INRVS  + GGRRF+FS +VVVGD K  VG     A EVP+A
Sbjct: 2   KRERINPDTLELDERVVLINRVSKVVKGGRRFSFSTVVVVGDGKGHVGIGMGKAAEVPDA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAAKRN+I V L+   T+ H+ V +  A KV++R A  GTGVIAG  +R V E  
Sbjct: 62  IRKGAEAAKRNLIRVPLV-HSTIPHEIVTKFAATKVMLRPAAPGTGVIAGRGVRPVVEAA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
           G+ D+++K  GS+NP NV++ATF+ L   +  +++A RR +    L ARR+    + + 
Sbjct: 121 GIKDLLSKVYGSNNPVNVVKATFKALSEMTSLQEMARRRDMTPQELNARRMRRETTEAA 179


>gi|294142916|ref|YP_003558894.1| 30S ribosomal protein S5 [Shewanella violacea DSS12]
 gi|293329385|dbj|BAJ04116.1| ribosomal protein S5 [Shewanella violacea DSS12]
          Length = 167

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 113/166 (68%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +   ++ + + +++VA+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++
Sbjct: 3   KFEAQQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RN++SV L++  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNIVSVELIN-GTLHHPVKGRHTGSRVYMQPASDGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP NV+RAT + L     P  +A +RG+    ++ 
Sbjct: 122 HNVLSKAYGSTNPINVVRATVDALVHMKSPAQIAAKRGLNVKEIRG 167


>gi|331004910|ref|ZP_08328326.1| SSU ribosomal protein S5p (S2e) [gamma proteobacterium IMCC1989]
 gi|330421297|gb|EGG95547.1| SSU ribosomal protein S5p (S2e) [gamma proteobacterium IMCC1989]
          Length = 169

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 79/164 (48%), Positives = 106/164 (64%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +++V +NRV+  + GGR F F+ L VVGD   +VGF    AREVP A++
Sbjct: 5   KKDDANSEGLEEKLVQVNRVAKTVKGGRIFGFTALTVVGDGNGRVGFGRGKAREVPAAIQ 64

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +   GRHGA KV M+ A  GTGVIAGGA+RAV E+ G+
Sbjct: 65  KAMEAARRNMIQVEL-NGDTLQYATKGRHGASKVYMQPASQGTGVIAGGAMRAVLEIAGV 123

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            +V+AK  GS+NP NV+RATF  L +   P  VA +RG     +
Sbjct: 124 QNVLAKCYGSTNPVNVVRATFNALDAMKSPEQVAAKRGKSVEDI 167


>gi|304399273|ref|ZP_07381139.1| ribosomal protein S5 [Pantoea sp. aB]
 gi|308188339|ref|YP_003932470.1| 30S ribosomal protein S5 [Pantoea vagans C9-1]
 gi|304353199|gb|EFM17580.1| ribosomal protein S5 [Pantoea sp. aB]
 gi|308058849|gb|ADO11021.1| 30S ribosomal protein S5 [Pantoea vagans C9-1]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMVNVALTN-GTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLGNMKSPEMVAAKRGKSVEEILG 166


>gi|300174015|ref|YP_003773181.1| 30S ribosomal protein S5 [Leuconostoc gasicomitatum LMG 18811]
 gi|299888394|emb|CBL92362.1| 30S ribosomal protein S5 [Leuconostoc gasicomitatum LMG 18811]
          Length = 168

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/158 (48%), Positives = 102/158 (64%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + + +VAINRV+  + GGRR  F+ LVVVGD +  VGF    A+EVPEA+RKA E AKR
Sbjct: 12  ELEENVVAINRVTKVVKGGRRLRFAALVVVGDKQGHVGFGTGKAQEVPEAIRKAIEDAKR 71

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
            +I+V  +   T+ HD +G  G GK++++ A  G+GV AGGA R+V E+ G+ DV AKS+
Sbjct: 72  KLITVPTV-STTIPHDVLGVWGGGKILVKPAEEGSGVAAGGAARSVMELAGITDVTAKSL 130

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GSS P NV+RATF+ L S      VA  RG+    L  
Sbjct: 131 GSSTPVNVVRATFDALTSLKDAEQVAALRGVSLEHLAE 168


>gi|225027495|ref|ZP_03716687.1| hypothetical protein EUBHAL_01751 [Eubacterium hallii DSM 3353]
 gi|224955230|gb|EEG36439.1| hypothetical protein EUBHAL_01751 [Eubacterium hallii DSM 3353]
          Length = 180

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 59/173 (34%), Positives = 98/173 (56%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           K+       +  +     + + +V+I RV+  + GGR   F+ LVVVGD    VG     
Sbjct: 8   KQGGYNMKRELIDASQLELEETVVSIKRVTKVVKGGRNMRFAALVVVGDKNGHVGAGLGK 67

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A E+PEA+RK  E A + ++ V + +  ++ HD +G+ G+ +V+++++  GTG+IAGG  
Sbjct: 68  AIEIPEAIRKGKEDAMKKLVKVPVNEVGSIPHDFIGKFGSAEVLLKASPEGTGIIAGGPS 127

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           RAV E+ G  ++ +K++GS+N  NV+ AT   L+    P +VA  RG     L
Sbjct: 128 RAVLELAGYKNIRSKALGSNNKQNVVLATIAGLKEIKTPEEVARLRGKSVDEL 180


>gi|167759845|ref|ZP_02431972.1| hypothetical protein CLOSCI_02208 [Clostridium scindens ATCC 35704]
 gi|167662464|gb|EDS06594.1| hypothetical protein CLOSCI_02208 [Clostridium scindens ATCC 35704]
          Length = 169

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 98/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KQERIDASQLELNEKVVSIKRVTKVVKGGRNMRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+I+V+L D  ++ HD +G+ G   V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAAKNLITVALDDNESITHDFIGKFGGASVLLKKAPEGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT + LR    P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIDGLRQVKTPEEVAKLRGKSVEEILG 169


>gi|24371846|ref|NP_715888.1| 30S ribosomal protein S5 [Shewanella oneidensis MR-1]
 gi|113968561|ref|YP_732354.1| 30S ribosomal protein S5 [Shewanella sp. MR-4]
 gi|114045724|ref|YP_736274.1| 30S ribosomal protein S5 [Shewanella sp. MR-7]
 gi|117918674|ref|YP_867866.1| 30S ribosomal protein S5 [Shewanella sp. ANA-3]
 gi|26399347|sp|P59124|RS5_SHEON RecName: Full=30S ribosomal protein S5
 gi|122944220|sp|Q0HNS0|RS5_SHESM RecName: Full=30S ribosomal protein S5
 gi|123131839|sp|Q0I088|RS5_SHESR RecName: Full=30S ribosomal protein S5
 gi|171460756|sp|A0KRP1|RS5_SHESA RecName: Full=30S ribosomal protein S5
 gi|24345659|gb|AAN53333.1|AE015473_20 ribosomal protein S5 [Shewanella oneidensis MR-1]
 gi|113883245|gb|ABI37297.1| SSU ribosomal protein S5P [Shewanella sp. MR-4]
 gi|113887166|gb|ABI41217.1| SSU ribosomal protein S5P [Shewanella sp. MR-7]
 gi|117611006|gb|ABK46460.1| SSU ribosomal protein S5P [Shewanella sp. ANA-3]
          Length = 167

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/162 (45%), Positives = 111/162 (68%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           ++ + + ++++A+NRVS  + GGR F+F+ L VVGD   KVG+ +  AREVP A++KA E
Sbjct: 7   QQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGYGYGKAREVPAAIQKAME 66

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+RNM++V L +  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+H+V+
Sbjct: 67  KARRNMVTVEL-NAGTLHHPVKGRHTGSRVYMQPASQGTGIIAGGAMRAVLEVAGVHNVL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 126 SKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVDEIRG 167


>gi|313206378|ref|YP_004045555.1| SSU ribosomal protein s5p [Riemerella anatipestifer DSM 15868]
 gi|312445694|gb|ADQ82049.1| SSU ribosomal protein S5P [Riemerella anatipestifer DSM 15868]
 gi|315023681|gb|EFT36685.1| 30S ribosomal protein S5 [Riemerella anatipestifer RA-YM]
 gi|325336177|gb|ADZ12451.1| Ribosomal protein S5 [Riemerella anatipestifer RA-GD]
          Length = 173

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 108/168 (64%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           DN +  +     +VDR+VA+NRV+    GGR F FS +VVVG+    +G+    ++EV  
Sbjct: 5   DNIERVKPGGLELVDRLVAVNRVTKVTKGGRAFGFSAIVVVGNEDGVIGYGLGKSKEVAS 64

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ V +++  T+ H+   R+G   + +R A  GTG+IAGGA+RAV E 
Sbjct: 65  AISKAVEDAKKNLVKVPVVN-HTIPHETTARYGGANIFLRPASHGTGLIAGGAVRAVLES 123

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            G+HD+++KS GSSNPHNV++ATF+ L     P ++A  RG+  S + 
Sbjct: 124 AGVHDILSKSKGSSNPHNVVKATFKALLDIRRPEEIARMRGVTLSKVF 171


>gi|307694135|ref|ZP_07636372.1| 30S ribosomal protein S5 [Ruminococcaceae bacterium D16]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E   +  V+++V++NRVS  + GGR F F+ L+VVGD K +VGF    A EVPEA+RK
Sbjct: 3   RFEREPSEFVEKLVSLNRVSKTVKGGRIFKFAALMVVGDEKGRVGFGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NMI+VSL  G T+ H+ +G  GAG+V+M+ A  GTGVIAGGA+RAV E +G+ 
Sbjct: 63  GIEDAKKNMITVSLS-GTTIPHEVIGEFGAGRVLMKPAAPGTGVIAGGAVRAVLEAVGIK 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+  K + S+NP NV+ A F  L+S   P +VA  RG     +  
Sbjct: 122 DIYTKCLRSNNPQNVVSAAFVGLKSLRSPEEVARIRGKSVDEILG 166


>gi|195977225|ref|YP_002122469.1| 30S ribosomal protein S5 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225867682|ref|YP_002743630.1| 30S ribosomal protein S5 [Streptococcus equi subsp. zooepidemicus]
 gi|225869553|ref|YP_002745500.1| 30S ribosomal protein S5 [Streptococcus equi subsp. equi 4047]
 gi|195973930|gb|ACG61456.1| 30S ribosomal protein S5 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225698957|emb|CAW91998.1| 30S ribosomal protein S5 [Streptococcus equi subsp. equi 4047]
 gi|225700958|emb|CAW97673.1| 30S ribosomal protein S5 [Streptococcus equi subsp. zooepidemicus]
          Length = 164

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/157 (47%), Positives = 105/157 (66%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA EAAK+
Sbjct: 9   ELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGHVGFGTGKAQEVPEAIRKAVEAAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           +MI V ++ G T+ H+     G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  SMIEVPMV-GTTIPHEVYTNFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGIADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|152978158|ref|YP_001343787.1| 30S ribosomal protein S5 [Actinobacillus succinogenes 130Z]
 gi|171704219|sp|A6VLK5|RS5_ACTSZ RecName: Full=30S ribosomal protein S5
 gi|150839881|gb|ABR73852.1| ribosomal protein S5 [Actinobacillus succinogenes 130Z]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQTGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NDGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPETVAAKRGKTVDEILG 166


>gi|307132822|ref|YP_003884838.1| 30S ribosomal subunit protein S5 [Dickeya dadantii 3937]
 gi|306530351|gb|ADN00282.1| 30S ribosomal subunit protein S5 [Dickeya dadantii 3937]
          Length = 166

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMLNVAL-NNGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLANMKSPEMVAAKRGKSVEDILG 166


>gi|94266236|ref|ZP_01289943.1| Ribosomal protein S5:Ribosomal protein S5-like [delta
           proteobacterium MLMS-1]
 gi|93453162|gb|EAT03626.1| Ribosomal protein S5:Ribosomal protein S5-like [delta
           proteobacterium MLMS-1]
          Length = 168

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 111/163 (68%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            R+  D+ ++++IV INR +  + GGRRF FS +VVVGD K +VGF    A +VPEA+RK
Sbjct: 5   KRDNGDDQLIEKIVFINRTAKVVKGGRRFNFSAIVVVGDGKGQVGFGLGKANQVPEAIRK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A+++M  V++ +  ++ H+ VG+ GAG+V+++ A AGTGVIAGG +RAV E  G+H
Sbjct: 65  GVEKARKDMQPVAVSEV-SIPHEIVGKFGAGQVLLKPAAAGTGVIAGGPVRAVLEAAGVH 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +++ K +GS NPHN+++AT + LR    PR +A  RG     +
Sbjct: 124 NILTKCLGSHNPHNMVKATLDGLRRLRSPRRIAAMRGRSVEEI 166


>gi|256819999|ref|YP_003141278.1| 30S ribosomal protein S5 [Capnocytophaga ochracea DSM 7271]
 gi|315225418|ref|ZP_07867232.1| 30S ribosomal protein S5 [Capnocytophaga ochracea F0287]
 gi|256581582|gb|ACU92717.1| ribosomal protein S5 [Capnocytophaga ochracea DSM 7271]
 gi|314944691|gb|EFS96726.1| 30S ribosomal protein S5 [Capnocytophaga ochracea F0287]
          Length = 174

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/177 (42%), Positives = 109/177 (61%), Gaps = 5/177 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           M QK +    N +  +     + DR+V + RV+    GGR F FS +VVVGD    VG  
Sbjct: 1   MYQKYK----NVEYVKPSGLELKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGHG 56

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              ++EV EA+ KA E AK+N++ + L +G TL H+  G++G  +V ++ A  GTGVIAG
Sbjct: 57  LGKSKEVSEAIAKAVEDAKKNLVRIPL-NGTTLPHEQKGKYGGARVFLQPATEGTGVIAG 115

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           G +RAV E +G+H+V++KS GSSNPHNV++ATF+ L      + VA +RGI    L 
Sbjct: 116 GTVRAVLESVGIHNVLSKSQGSSNPHNVVKATFDALLQLRSAKTVAAQRGISLEKLF 172


>gi|317509247|ref|ZP_07966868.1| ribosomal protein S5 [Segniliparus rugosus ATCC BAA-974]
 gi|316252457|gb|EFV11906.1| ribosomal protein S5 [Segniliparus rugosus ATCC BAA-974]
          Length = 216

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/180 (40%), Positives = 108/180 (60%), Gaps = 1/180 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             ++     ++R+VA+NRV+  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A+ K
Sbjct: 36  QVDKEKKDHIERLVAVNRVAKVVKGGRRFSFTALVIVGDGKGHVGAGYGKAKEVPAAIAK 95

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+H
Sbjct: 96  GVEEARKNFFRVPLI-GSTIPHPIQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGVH 154

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           DV+AKS+G+ N  NV+ AT   L+    P +VA RRG+    +    ++ ++  +    +
Sbjct: 155 DVLAKSMGTDNAINVVHATIAALKGLKRPEEVAARRGLPLEDVAPAGLLRARERALQEAA 214


>gi|77462276|ref|YP_351780.1| 30S ribosomal protein S5 [Rhodobacter sphaeroides 2.4.1]
 gi|126461152|ref|YP_001042266.1| 30S ribosomal protein S5 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638130|ref|YP_002524392.1| 30S ribosomal protein S5 [Rhodobacter sphaeroides KD131]
 gi|91207885|sp|Q3J5Q5|RS5_RHOS4 RecName: Full=30S ribosomal protein S5
 gi|189045431|sp|A3PGM8|RS5_RHOS1 RecName: Full=30S ribosomal protein S5
 gi|254765204|sp|B9KLA8|RS5_RHOSK RecName: Full=30S ribosomal protein S5
 gi|77386694|gb|ABA77879.1| SSU ribosomal protein S5P [Rhodobacter sphaeroides 2.4.1]
 gi|126102816|gb|ABN75494.1| SSU ribosomal protein S5P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158911|gb|ACL99890.1| 30S ribosomal protein S5 [Rhodobacter sphaeroides KD131]
          Length = 187

 Score =  171 bits (434), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 102/187 (54%), Positives = 131/187 (70%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++E  +        E      DR+VAINRVS  + GG+RF F+ LVVVGD + +VGF 
Sbjct: 1   MAERENRRDRRDDRSREETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V+L DGRTLHHD  GRHGAGKV+MR+A+ GTG+IAG
Sbjct: 61  KGKAKEVPEAIRKATEQAKRQMIRVALRDGRTLHHDQEGRHGAGKVVMRAAVPGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVVAKS+GS NP+N+IRAT + L+ +S PR VA RRG K + +  + 
Sbjct: 121 GPMRAVFEMLGIQDVVAKSLGSQNPYNMIRATMDGLKRESSPRQVAQRRGKKVADILKKP 180

Query: 181 VVSSKSS 187
                 +
Sbjct: 181 EAEVAEA 187


>gi|303231208|ref|ZP_07317946.1| ribosomal protein S5 [Veillonella atypica ACS-049-V-Sch6]
 gi|302514115|gb|EFL56119.1| ribosomal protein S5 [Veillonella atypica ACS-049-V-Sch6]
          Length = 167

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 105/164 (64%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   RIDYTSLDLKERVVFINRVAKVVKGGRRFSFSALVVVGDGNGYVGVGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             + AK+N+++V++ +  T+ H   G  GAG+V ++ A  GTGVIAGG +RAV E++G+ 
Sbjct: 63  GIDDAKKNIVNVAVKN-GTIPHSVTGVFGAGRVFLKPAAEGTGVIAGGPVRAVLELVGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +++ KS+GSSNP+N++RAT E L+      +VA  RG     + 
Sbjct: 122 NILTKSLGSSNPNNMVRATIEGLKDLKRASEVAELRGKSVEEIY 165


>gi|317494325|ref|ZP_07952739.1| ribosomal protein S5 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917575|gb|EFV38920.1| ribosomal protein S5 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMMNVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L S   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLASMKSPEMVAAKRGKSVEEILG 166


>gi|32491309|ref|NP_871563.1| hypothetical protein WGLp560 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|31340382|sp|Q8D1Z5|RS5_WIGBR RecName: Full=30S ribosomal protein S5
 gi|25166516|dbj|BAC24706.1| rpsE [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E+  N + ++++++NRVS  + GGR F+F+ L VVGD + K+GF +  ++EVP A++K
Sbjct: 3   NFEKNINELQEKLISVNRVSKTVKGGRIFSFTALTVVGDCQGKIGFGYGKSKEVPLAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A + A++NMI + ++   TL H+  G H   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMDKARKNMIIIPIVCK-TLQHEINGYHTGSRVFMKPASEGTGIIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK  GS+NP NV+RAT   L+    P  +A +RG     +  
Sbjct: 122 NVLAKVYGSTNPINVVRATVNALKKMRFPMHIAEKRGKSIDDILG 166


>gi|212634846|ref|YP_002311371.1| 30S ribosomal protein S5 [Shewanella piezotolerans WP3]
 gi|212556330|gb|ACJ28784.1| Ribosomal protein S5 [Shewanella piezotolerans WP3]
          Length = 167

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 73/166 (43%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +   ++ + + +++VA+NRVS  + GGR F+F+ L VVGD   KVG+ +  AREVP A++
Sbjct: 3   KFEAQQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGYGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RN+++V L +  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNIVNVEL-NNGTLHHPVKGRHTGSRVYMQPASDGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 122 HNVLSKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVDEIRG 167


>gi|283796541|ref|ZP_06345694.1| ribosomal protein S5 [Clostridium sp. M62/1]
 gi|291075955|gb|EFE13319.1| ribosomal protein S5 [Clostridium sp. M62/1]
 gi|295092561|emb|CBK78668.1| SSU ribosomal protein S5P [Clostridium cf. saccharolyticum K10]
 gi|295115263|emb|CBL36110.1| SSU ribosomal protein S5P [butyrate-producing bacterium SM4/1]
          Length = 169

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 95/166 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KRTIIDPTQFELEDKVVAIKRVSKTVKGGRTMRFSALVVVGDKNGHVGAGLGKAAEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA +N+++V   +  ++ HD +G+ G+  V+++ A  GTG+IAGG  R+V E+ 
Sbjct: 62  IRKGKEAAAKNLVAVPFDENNSIPHDFLGKFGSANVLLKKAPEGTGIIAGGPARSVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G  ++  KS+GS+N  NV+ AT   L +   P +VA  RG     +
Sbjct: 122 GYKNIRTKSLGSNNKTNVVLATLTGLCALKTPEEVAKLRGKSVEEI 167


>gi|120597006|ref|YP_961580.1| 30S ribosomal protein S5 [Shewanella sp. W3-18-1]
 gi|146294824|ref|YP_001185248.1| 30S ribosomal protein S5 [Shewanella putrefaciens CN-32]
 gi|171704617|sp|A1RED1|RS5_SHESW RecName: Full=30S ribosomal protein S5
 gi|172046875|sp|A4YBW6|RS5_SHEPC RecName: Full=30S ribosomal protein S5
 gi|110812353|gb|ABG91709.1| ribosomal protein S5 [Shewanella putrefaciens 200]
 gi|120557099|gb|ABM23026.1| SSU ribosomal protein S5P [Shewanella sp. W3-18-1]
 gi|145566514|gb|ABP77449.1| SSU ribosomal protein S5P [Shewanella putrefaciens CN-32]
 gi|319424597|gb|ADV52671.1| ribosomal protein S5 [Shewanella putrefaciens 200]
          Length = 167

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/162 (44%), Positives = 111/162 (68%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           ++ + + ++++A+NRVS  + GGR F+F+ L VVGD   K+G+ +  AREVP A++KA E
Sbjct: 7   QQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGKIGYGYGKAREVPAAIQKAME 66

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+RNM++V L +  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+H+V+
Sbjct: 67  KARRNMVTVEL-NAGTLHHPVKGRHTGSRVYMQPASQGTGIIAGGAMRAVLEVAGVHNVL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 126 SKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVDEIRG 167


>gi|329298516|ref|ZP_08255852.1| 30S ribosomal protein S5 [Plautia stali symbiont]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGDLQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L    TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMVNVALT-HGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLGNMKSPDMVAAKRGKSVEEILG 166


>gi|325068048|ref|ZP_08126721.1| 30S ribosomal protein S5 [Actinomyces oris K20]
          Length = 235

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 1/175 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            ++R+V INRVS  + GGRRF F+ LVVVGD +  VG  +  A+EVP A+ KA E AK+N
Sbjct: 48  YIERVVTINRVSKVVKGGRRFTFTALVVVGDGEGTVGVGYGKAKEVPAAIAKAVEIAKKN 107

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
              V ++  RT+ H   G   AG V++R A  GTGVIAGG +RAV +  G+HD+++KS+G
Sbjct: 108 FFHVPMIR-RTIPHLVQGEDSAGVVLLRPASPGTGVIAGGPVRAVLDCAGVHDILSKSLG 166

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           SSN  N++ AT + L+    P  VA RRG+    +  + ++ +++   +      
Sbjct: 167 SSNAINIVHATVDALKQLEQPEAVAARRGLPLEDVAPQSMLRARAEGEADKRAQA 221


>gi|322831089|ref|YP_004211116.1| ribosomal protein S5 [Rahnella sp. Y9602]
 gi|321166290|gb|ADW71989.1| ribosomal protein S5 [Rahnella sp. Y9602]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMMNVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P+ VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDALANMKSPQMVAAKRGKSVEEILG 166


>gi|300718688|ref|YP_003743491.1| 30S ribosomal protein S5 [Erwinia billingiae Eb661]
 gi|299064524|emb|CAX61644.1| 30S ribosomal protein S5 [Erwinia billingiae Eb661]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   ++GF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRIGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M  A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMINVAL-NNGTLQHPVKGVHTGSRVFMMPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L + + P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATLDGLGNMNSPEMVAAKRGKSVEDILG 166


>gi|313884485|ref|ZP_07818246.1| ribosomal protein S5 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620269|gb|EFR31697.1| ribosomal protein S5 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 167

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 74/158 (46%), Positives = 102/158 (64%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            I DR+VAINRV+  + GGRR  FS LVVVGD    VGF    A+EVPEA+RKA E AK+
Sbjct: 11  EIEDRVVAINRVTKVVKGGRRLRFSALVVVGDKDGHVGFGTGKAQEVPEAIRKAIEDAKK 70

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           ++I+V    G T+ H+ +G    G+V+++ A+AG+GV AGG +RAV E+ G+ DV +KS+
Sbjct: 71  HLIAVPRT-GTTIPHEVIGEFCGGRVLLKPAVAGSGVAAGGPVRAVVELAGIADVTSKSL 129

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+ P N+I AT E L++      VA  RG     +  
Sbjct: 130 GSNTPINMITATIEGLKNLKEAEAVAKLRGKSVEEILG 167


>gi|300022558|ref|YP_003755169.1| ribosomal protein S5 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524379|gb|ADJ22848.1| ribosomal protein S5 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 191

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 109/181 (60%), Positives = 143/181 (79%), Gaps = 2/181 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+    QRD  ++REERD+   D++V INRV+  + GG+RF F+ LVVVGD K +VG+ 
Sbjct: 1   MAR--GPQRDRGRDREERDSEFTDKLVHINRVAKVVKGGKRFGFAALVVVGDLKGRVGYG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           H  AREVPEA+RKATE AKRN++ V L D RTLHHD VGRHG+GKV++R+A AGTG+IAG
Sbjct: 59  HGKAREVPEAIRKATEGAKRNLLRVPLRDARTLHHDSVGRHGSGKVVLRAAPAGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GA+RAV E++G+HDVVAKS+GS+NP+NV+RATF+ L++Q +PR VA RR  K S + +RR
Sbjct: 119 GAMRAVFEMVGVHDVVAKSMGSTNPYNVVRATFDALKAQENPRAVAARRNKKVSDIVSRR 178

Query: 181 V 181
            
Sbjct: 179 R 179


>gi|70725820|ref|YP_252734.1| 30S ribosomal protein S5 [Staphylococcus haemolyticus JCSC1435]
 gi|91207890|sp|Q4L897|RS5_STAHJ RecName: Full=30S ribosomal protein S5
 gi|68446544|dbj|BAE04128.1| 30S ribosomal protein S5 [Staphylococcus haemolyticus JCSC1435]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATINGLQNLKNAEDVAKLRGKSVEELY 165


>gi|210631170|ref|ZP_03296781.1| hypothetical protein COLSTE_00666 [Collinsella stercoris DSM 13279]
 gi|210160137|gb|EEA91108.1| hypothetical protein COLSTE_00666 [Collinsella stercoris DSM 13279]
          Length = 176

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 73/168 (43%), Positives = 103/168 (61%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N Q ++   +   +R+V INRV+  + GGRR +   LVVVGD K  VG     + EVP 
Sbjct: 3   RNQQKQQREASEFEERVVFINRVAKTVKGGRRMSLVALVVVGDGKGNVGLGMGKSAEVPL 62

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA+  AK+NM  V +    T+ HD  G  GA  +IMR A+ GTGVIAGGA+R + E+
Sbjct: 63  AISKASIDAKKNMFHVPVTAEGTIPHDVQGEFGAASIIMRPAVEGTGVIAGGAVRPLFEL 122

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            G+ ++++KS+GS N  N+I+A  E L+  S P DVA RRG+  S + 
Sbjct: 123 AGIKNILSKSLGSDNGLNIIKAAAEGLKQLSSPEDVAARRGLTVSEMF 170


>gi|313888828|ref|ZP_07822489.1| ribosomal protein S5 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845197|gb|EFR32597.1| ribosomal protein S5 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 168

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 72/168 (42%), Positives = 104/168 (61%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                   +  + +R+V+INRV+  + GGR F FS LVVVGD    VG     A EVPEA
Sbjct: 2   ERSLINAAELDLEERVVSINRVAKVVKGGRNFRFSALVVVGDKNGHVGVGTGKALEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKAT+ A++N++ ++LL+  ++ H   G +GAG+V ++ A  GTGVIAGGA+RAVCE+ 
Sbjct: 62  IRKATQDARKNIVRINLLN-TSIPHQVTGIYGAGRVFLKPAREGTGVIAGGAVRAVCELA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ D+  K+IG++NP NV+ AT E L+S      VA  R      +  
Sbjct: 121 GITDIRTKNIGTNNPRNVVNATMEGLKSLKTAESVARLRNKSVEEILG 168


>gi|213965036|ref|ZP_03393235.1| ribosomal protein S5 [Corynebacterium amycolatum SK46]
 gi|213952572|gb|EEB63955.1| ribosomal protein S5 [Corynebacterium amycolatum SK46]
          Length = 205

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 68/176 (38%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD +  VG  +  A+EVP A++K 
Sbjct: 31  QQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGEGMVGVGYGKAKEVPAAIQKG 90

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A++N   V ++   T+ H   G   AG V++R A  GTG+IAGGA+R V E  G+ D
Sbjct: 91  AEEARKNFFRVPMI-AGTITHPVQGETAAGIVLLRPAAPGTGLIAGGAVRPVLECAGVQD 149

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           V++KS+G++N  NV+ AT + L+    P +VA RRG     +   R++ +++   +
Sbjct: 150 VLSKSLGTNNSINVVHATVDALKQLVRPEEVAARRGKSLEEVTPARMLRARAGQGA 205


>gi|310829568|ref|YP_003961925.1| ribosomal protein S5 [Eubacterium limosum KIST612]
 gi|308741302|gb|ADO38962.1| ribosomal protein S5 [Eubacterium limosum KIST612]
          Length = 168

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 70/168 (41%), Positives = 102/168 (60%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + +R+V INRV+  + GGR F FS LV+VGD    VG     A E+P+A
Sbjct: 2   QSNKIDPNTLDLQERVVTINRVTKVVKGGRNFRFSCLVIVGDGNGYVGVGKGKAMEIPDA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E+AK+++I V L+ G T+ H   G  GAGKV+++ A  GTGVIAGGA+RAVCE+ 
Sbjct: 62  IRKGIESAKKSLIKVPLV-GTTIPHLVQGEDGAGKVLLKPAGPGTGVIAGGAVRAVCELA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ D+  KS+G++N  N++ AT E L   +   +VA +RG     +  
Sbjct: 121 GIKDIRTKSLGTNNARNMVNATMEGLARLTTLEEVAAKRGKSPEEILG 168


>gi|153816233|ref|ZP_01968901.1| hypothetical protein RUMTOR_02482 [Ruminococcus torques ATCC 27756]
 gi|317501791|ref|ZP_07959977.1| ribosomal protein S5 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331088688|ref|ZP_08337598.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145846416|gb|EDK23334.1| hypothetical protein RUMTOR_02482 [Ruminococcus torques ATCC 27756]
 gi|316896824|gb|EFV18909.1| ribosomal protein S5 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330407211|gb|EGG86714.1| 30S ribosomal protein S5 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 169

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 98/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     +++++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   RQERIDASQMELLEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + MI ++  +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAMKKMIEITFDENGSITHDVLGKFGSASVLLKKAPDGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E L+    P DVA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIEGLKDVKSPEDVARLRGKSIEEIMG 169


>gi|294675874|ref|YP_003576489.1| 30S ribosomal protein S5 [Rhodobacter capsulatus SB 1003]
 gi|294474694|gb|ADE84082.1| 30S ribosomal protein S5 [Rhodobacter capsulatus SB 1003]
          Length = 186

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 98/169 (57%), Positives = 126/169 (74%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD + +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R++I V L DGRTLHHD  GRHGAGKV+MR+A AGTG+IAGG +RAV E+LG+ DVVAKS
Sbjct: 78  RSLIRVPLRDGRTLHHDIEGRHGAGKVVMRTAPAGTGIIAGGPMRAVFEMLGVQDVVAKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           IGS NP+N+IRAT + L+ ++ PR+VA RRG K + +  +    +   +
Sbjct: 138 IGSQNPYNMIRATIDGLKLEASPRNVAARRGKKVADILPKTAADAAVEA 186


>gi|72163028|ref|YP_290685.1| 30S ribosomal protein S5 [Thermobifida fusca YX]
 gi|91207894|sp|Q47LL0|RS5_THEFY RecName: Full=30S ribosomal protein S5
 gi|71916760|gb|AAZ56662.1| SSU ribosomal protein S5P [Thermobifida fusca YX]
          Length = 200

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/170 (44%), Positives = 109/170 (64%), Gaps = 1/170 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
           S ++R+V INRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E AK+
Sbjct: 30  SYIERVVKINRVAKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAAIAKGVEEAKK 89

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N   V  + G T+ H   G   AG V++R A  GTGVIAGG +RAV E  G+HDV+ KS+
Sbjct: 90  NFFRVPRI-GGTIVHQVQGEDAAGVVLLRPAAPGTGVIAGGPVRAVLECAGIHDVLTKSL 148

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           GSSNP N++RAT   L+S S P ++A RRG+    +    ++ +++ + +
Sbjct: 149 GSSNPINIVRATVAALKSLSRPEEIAARRGLPLEDVVPAPMLRARAEAKA 198


>gi|56695416|ref|YP_165764.1| 30S ribosomal protein S5 [Ruegeria pomeroyi DSS-3]
 gi|73919098|sp|Q5LW41|RS5_SILPO RecName: Full=30S ribosomal protein S5
 gi|56677153|gb|AAV93819.1| ribosomal protein S5 [Ruegeria pomeroyi DSS-3]
          Length = 190

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 97/161 (60%), Positives = 122/161 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 19  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 78

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 79  RQMIRVQLREGRTLHHDIEGRHGAGKVVMRAAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 138

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           +GS+NP+N+IRAT + L+ +  PR VA RRG K + +  +R
Sbjct: 139 LGSANPYNMIRATIDGLKKEQSPRSVAQRRGKKVADILPKR 179


>gi|28377849|ref|NP_784741.1| 30S ribosomal protein S5 [Lactobacillus plantarum WCFS1]
 gi|254556034|ref|YP_003062451.1| 30S ribosomal protein S5 [Lactobacillus plantarum JDM1]
 gi|300767838|ref|ZP_07077748.1| 30S ribosomal protein S5 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308180028|ref|YP_003924156.1| 30S ribosomal protein S5 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|38258336|sp|Q88XW9|RS5_LACPL RecName: Full=30S ribosomal protein S5
 gi|28270682|emb|CAD63588.1| ribosomal protein S5 [Lactobacillus plantarum WCFS1]
 gi|254044961|gb|ACT61754.1| 30S ribosomal protein S5 [Lactobacillus plantarum JDM1]
 gi|300494823|gb|EFK29981.1| 30S ribosomal protein S5 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308045519|gb|ADN98062.1| 30S ribosomal protein S5 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 111/163 (68%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D +VAINR++  + GGRR  F+ LV+VGD K  VGF    A+EVPEA+RKA+
Sbjct: 5   DPSKLDLDDNVVAINRITKVVKGGRRLRFAALVIVGDHKGHVGFGTGKAQEVPEAIRKAS 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           EAAK+N+I+V ++ G T+ H+ +G +G G+++++ A+ G+GV AGGA+RAV E+ G+ DV
Sbjct: 65  EAAKKNLITVPMV-GTTIPHEALGVYGGGRIMLKPAVEGSGVAAGGAVRAVMELAGVDDV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +K +GS+ P NV+RATFE L+S      VA  RG+    L  
Sbjct: 124 TSKRLGSNTPVNVVRATFEGLKSLKTAEQVAALRGVSAEHLAE 166


>gi|261364872|ref|ZP_05977755.1| ribosomal protein S5 [Neisseria mucosa ATCC 25996]
 gi|298370574|ref|ZP_06981889.1| ribosomal protein S5 [Neisseria sp. oral taxon 014 str. F0314]
 gi|288566921|gb|EFC88481.1| ribosomal protein S5 [Neisseria mucosa ATCC 25996]
 gi|298281184|gb|EFI22674.1| ribosomal protein S5 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 172

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 109/168 (64%), Gaps = 1/168 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               EER + +++++VA+NRV+  + GGR  AFS L VVGD   ++G     ++EVP AV
Sbjct: 3   KHEIEERGDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGDGDGRIGMGKGKSKEVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+R+MI V L +  T+HH+ +GRHGA KV M+ A  G+GV AGG +R V + +G
Sbjct: 63  QKAMDQARRSMIKVPLKN-GTIHHEVIGRHGATKVFMQPAKEGSGVKAGGPMRLVFDAMG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +H++ AK  GS+NP+N++RAT + L     P D+A +RG+    +   
Sbjct: 122 IHNISAKVHGSTNPYNIVRATLDGLSKLYTPADIAAKRGLTVEDILGA 169


>gi|50122934|ref|YP_052101.1| 30S ribosomal protein S5 [Pectobacterium atrosepticum SCRI1043]
 gi|227115255|ref|ZP_03828911.1| 30S ribosomal protein S5 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328932|ref|ZP_03832956.1| 30S ribosomal protein S5 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253690166|ref|YP_003019356.1| ribosomal protein S5 [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|261823215|ref|YP_003261321.1| 30S ribosomal protein S5 [Pectobacterium wasabiae WPP163]
 gi|73919053|sp|Q6CZY7|RS5_ERWCT RecName: Full=30S ribosomal protein S5
 gi|49613460|emb|CAG76911.1| 30S ribosomal subunit protein S5 [Pectobacterium atrosepticum
           SCRI1043]
 gi|251756744|gb|ACT14820.1| ribosomal protein S5 [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|261607228|gb|ACX89714.1| ribosomal protein S5 [Pectobacterium wasabiae WPP163]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMMNVAL-NNGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLANMKSPEMVAAKRGKSVEEILG 166


>gi|184155974|ref|YP_001844314.1| 30S ribosomal protein S5 [Lactobacillus fermentum IFO 3956]
 gi|227515504|ref|ZP_03945553.1| ribosomal protein S5 [Lactobacillus fermentum ATCC 14931]
 gi|260662769|ref|ZP_05863663.1| 30S ribosomal protein S5 [Lactobacillus fermentum 28-3-CHN]
 gi|183227318|dbj|BAG27834.1| 30S ribosomal protein S5 [Lactobacillus fermentum IFO 3956]
 gi|227086117|gb|EEI21429.1| ribosomal protein S5 [Lactobacillus fermentum ATCC 14931]
 gi|260552850|gb|EEX25849.1| 30S ribosomal protein S5 [Lactobacillus fermentum 28-3-CHN]
          Length = 169

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 70/163 (42%), Positives = 108/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D++V+INR++  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA+
Sbjct: 8   DPAKLDLDDQVVSINRITKVVKGGRRLRFAALVVVGDHNGHVGFGTGKAQEVPEAIRKAS 67

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AA++N+I V  + G T+ H+ +G +G GK++++ A+ G+GV AGGA+R V E+ G++DV
Sbjct: 68  AAAQKNLIKVPTV-GTTIPHEVIGTYGGGKIMLKPAVEGSGVTAGGAVRNVMELAGVNDV 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +K +GS+ P NV+RATFE L++     +V+  RG     L  
Sbjct: 127 TSKRLGSNTPINVVRATFEGLKALKSAEEVSKLRGTSVDHLAE 169


>gi|293390667|ref|ZP_06635001.1| ribosomal protein S5 [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951201|gb|EFE01320.1| ribosomal protein S5 [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMISV+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMISVALSE-GTLQHPIKGTHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKSVDEILG 166


>gi|89893234|ref|YP_516721.1| 30S ribosomal protein S5 [Desulfitobacterium hafniense Y51]
 gi|122483921|sp|Q250L5|RS5_DESHY RecName: Full=30S ribosomal protein S5
 gi|89332682|dbj|BAE82277.1| 30S ribosomal protein S5 [Desulfitobacterium hafniense Y51]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V I RV+  + GGRRF+FS LVVVGD +  VG     A EVPEA+RK
Sbjct: 3   KIDASKLELTEKVVHIARVAKVVKGGRRFSFSALVVVGDGQGNVGAGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NM+SV L+ G T+ H  +G +GAG V+++ A  GTGVIAGGA+RAV E  G+ 
Sbjct: 63  GMEDAKKNMVSVPLI-GTTIPHAILGNYGAGSVLLKPATKGTGVIAGGAVRAVLEAAGVS 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+NPHN++ AT   L+S     DVA  RG     +  
Sbjct: 122 DILTKSLGSANPHNMVNATMAALKSLKRAEDVAKLRGKTVEEILG 166


>gi|119718108|ref|YP_925073.1| SSU ribosomal protein S5P [Nocardioides sp. JS614]
 gi|171704600|sp|A1SNK1|RS5_NOCSJ RecName: Full=30S ribosomal protein S5
 gi|119538769|gb|ABL83386.1| SSU ribosomal protein S5P [Nocardioides sp. JS614]
          Length = 205

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 73/170 (42%), Positives = 104/170 (61%), Gaps = 1/170 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
              + ++R+VAINRV+  + GGRRF+F+ LVVVGD +  VG  +  A+EVP A+ K  E 
Sbjct: 26  DKTAYIERVVAINRVAKVVKGGRRFSFTALVVVGDGEGLVGVGYGKAKEVPAAIAKGVEE 85

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           AK++   V  +   T+ H   G   AG V++R A  GTGVIAGG +RAV E  G+HDV++
Sbjct: 86  AKKHFFRVPRI-QGTIPHPVQGEKAAGVVLLRPAAPGTGVIAGGPVRAVLECAGIHDVLS 144

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSS 187
           KS+GSSN  N++ AT E LR    P  VA RRG+    +    ++ ++  
Sbjct: 145 KSLGSSNQINIVHATVEALRMLEQPEAVAARRGLPVEEVAPAALLKARVE 194


>gi|85713159|ref|ZP_01044191.1| Ribosomal protein S5 [Idiomarina baltica OS145]
 gi|85693029|gb|EAQ30995.1| Ribosomal protein S5 [Idiomarina baltica OS145]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E ++  ++++++ +NRV+  + GGR F+F+ L VVGD K KVGF +  AREVP A++K
Sbjct: 3   NVEAQNGELIEKLITVNRVAKVVKGGRIFSFTALTVVGDGKGKVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM++V L  G TL H   GRH   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEKARRNMVTVQL-KGETLQHPVKGRHSGSQVYMQPASEGTGIIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L     P  VA +RG++   +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIKALNDMKSPEQVAAKRGLRVDEILG 166


>gi|119484816|ref|ZP_01619298.1| 30S ribosomal protein S5 [Lyngbya sp. PCC 8106]
 gi|119457634|gb|EAW38758.1| 30S ribosomal protein S5 [Lyngbya sp. PCC 8106]
          Length = 179

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 66/178 (37%), Positives = 103/178 (57%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++++ +R      +E+D    +R+V I RV+  + GG++ +F  +V+VG+ + +VG  
Sbjct: 1   MAEQQQQRRKKGNRAKEKDTEWQERVVQIRRVTKVVKGGKKLSFRAIVIVGNERGQVGVG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A +V  AV+K     ++N+I V L    ++ H   G  G  KV++R A  GTGVIAG
Sbjct: 61  VGKAADVIGAVKKGVADGRKNVIEVPLTKSYSIPHLVQGEGGGAKVLIRPAAPGTGVIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GA+R V E+ G+ +++AK +GSSNP N  RA  + L S     +VA  RGI    L A
Sbjct: 121 GAVRTVLELAGVRNILAKQLGSSNPLNNARAAVDALTSLRTLSEVARERGISVEQLYA 178


>gi|330505190|ref|YP_004382059.1| 30S ribosomal protein S5 [Pseudomonas mendocina NK-01]
 gi|328919476|gb|AEB60307.1| 30S ribosomal protein S5 [Pseudomonas mendocina NK-01]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 79/164 (48%), Positives = 108/164 (65%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYPIKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            +V+AK  GS+NP NV+ ATF  L++   P  VA +RG     +
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFNGLKTMQSPESVAAKRGKSVEEI 165


>gi|304560342|gb|ADM43006.1| SSU ribosomal protein S5p (S2e) [Edwardsiella tarda FL6-60]
          Length = 166

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMINVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L     P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLECMKSPEMVAAKRGKSVEEILG 166


>gi|126739667|ref|ZP_01755359.1| 30S ribosomal protein S5 [Roseobacter sp. SK209-2-6]
 gi|126719313|gb|EBA16023.1| 30S ribosomal protein S5 [Roseobacter sp. SK209-2-6]
          Length = 189

 Score =  171 bits (434), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 97/161 (60%), Positives = 120/161 (74%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R M+ V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RQMVRVPLKEGRTLHHDIDGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           IGS NP+N+IRAT   L  ++ PR VA RRG K + +  +R
Sbjct: 138 IGSQNPYNMIRATINGLTKEASPRSVAQRRGKKVADILPKR 178


>gi|262277111|ref|ZP_06054904.1| ribosomal protein S5 [alpha proteobacterium HIMB114]
 gi|262224214|gb|EEY74673.1| ribosomal protein S5 [alpha proteobacterium HIMB114]
          Length = 165

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 83/164 (50%), Positives = 126/164 (76%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
            + +   +++VAINR++  + GGRRF F+ LVV G+ K +VGF    A++VP+A++KA+E
Sbjct: 2   SQTSEFKEKLVAINRITKVVKGGRRFGFAALVVTGNQKGQVGFGQGKAKQVPDAIKKASE 61

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
           AA+++++ V+L +GRTLHHD  GR+GAGKV++RSA AGTG+IAGG +RA+CE+ G+ DVV
Sbjct: 62  AARKSLVKVALREGRTLHHDVRGRNGAGKVLLRSAPAGTGIIAGGPVRAICEMSGIQDVV 121

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
            KSIGSSNP+N++RA+F+ L  Q  P++++  RG K   + +RR
Sbjct: 122 GKSIGSSNPYNLVRASFDALTKQKSPKEISLIRGKKIKEIVSRR 165


>gi|90020623|ref|YP_526450.1| 30S ribosomal protein S5 [Saccharophagus degradans 2-40]
 gi|89950223|gb|ABD80238.1| SSU ribosomal protein S5P [Saccharophagus degradans 2-40]
          Length = 170

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 84/169 (49%), Positives = 110/169 (65%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
              +  +     + +++V +NRV+  + GGR F F+ L VVGD   KVGF    AREVP 
Sbjct: 3   QQNKREDSNAEGLQEKLVQVNRVAKTVKGGRIFGFTALTVVGDGNGKVGFGRGKAREVPI 62

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++KA EAA+RNMI V L DG T+ +   GRHGA KV M+ A AGTGVIAGGA+RAV E+
Sbjct: 63  AIQKAMEAARRNMIQVEL-DGDTIQYPTKGRHGASKVYMQPASAGTGVIAGGAMRAVLEI 121

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G+ +V+AK  GS+NP NV+RATFE LR+ S P  VA +RG     +  
Sbjct: 122 AGVQNVLAKCYGSTNPVNVVRATFEALRAMSSPERVAAKRGKSVEEIIG 170


>gi|219666507|ref|YP_002456942.1| 30S ribosomal protein S5 [Desulfitobacterium hafniense DCB-2]
 gi|254765690|sp|B8G1Y3|RS5_DESHD RecName: Full=30S ribosomal protein S5
 gi|219536767|gb|ACL18506.1| ribosomal protein S5 [Desulfitobacterium hafniense DCB-2]
          Length = 166

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V I RV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   KIDASKLELTEKVVHIARVAKVVKGGRRFSFSALVVVGDGHGNVGAGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NM+SV L+ G T+ H  +G +GAG V+++ A  GTGVIAGGA+RAV EV G+ 
Sbjct: 63  GMEDAKKNMVSVPLI-GTTIPHAILGNYGAGSVLLKPAAKGTGVIAGGAVRAVLEVAGVS 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D++ KS+GS+NPHN++ AT   L+S     DVA  RG     +  
Sbjct: 122 DILTKSLGSANPHNMVNATMAALKSLKRAEDVARLRGKTVEEILG 166


>gi|228474613|ref|ZP_04059344.1| ribosomal protein S5 [Staphylococcus hominis SK119]
 gi|314935849|ref|ZP_07843201.1| ribosomal protein S5 [Staphylococcus hominis subsp. hominis C80]
 gi|228271276|gb|EEK12644.1| ribosomal protein S5 [Staphylococcus hominis SK119]
 gi|313656414|gb|EFS20154.1| ribosomal protein S5 [Staphylococcus hominis subsp. hominis C80]
          Length = 166

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATLNGLQNLKNAEDVAKLRGKSVEELY 165


>gi|167855333|ref|ZP_02478101.1| 30S ribosomal protein S5 [Haemophilus parasuis 29755]
 gi|219871579|ref|YP_002475954.1| 30S ribosomal protein S5 [Haemophilus parasuis SH0165]
 gi|167853591|gb|EDS24837.1| 30S ribosomal protein S5 [Haemophilus parasuis 29755]
 gi|219691783|gb|ACL33006.1| 30S ribosomal protein S5 [Haemophilus parasuis SH0165]
          Length = 166

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEKARRNMVNVAL-NEGTLQHPVKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVEEILG 166


>gi|163739459|ref|ZP_02146869.1| 30S ribosomal protein S5 [Phaeobacter gallaeciensis BS107]
 gi|163740254|ref|ZP_02147648.1| 30S ribosomal protein S5 [Phaeobacter gallaeciensis 2.10]
 gi|161386112|gb|EDQ10487.1| 30S ribosomal protein S5 [Phaeobacter gallaeciensis 2.10]
 gi|161387212|gb|EDQ11571.1| 30S ribosomal protein S5 [Phaeobacter gallaeciensis BS107]
          Length = 188

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 98/161 (60%), Positives = 121/161 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RQMIRVQLKEGRTLHHDMHGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           IGS NP+N+IRAT + L+ +  PR VA RRG K + +  +R
Sbjct: 138 IGSQNPYNMIRATMDGLKKEQSPRSVAQRRGKKVADILPKR 178


>gi|229825304|ref|ZP_04451373.1| hypothetical protein GCWU000182_00658 [Abiotrophia defectiva ATCC
           49176]
 gi|229790676|gb|EEP26790.1| hypothetical protein GCWU000182_00658 [Abiotrophia defectiva ATCC
           49176]
          Length = 168

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 67/167 (40%), Positives = 98/167 (58%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           +   +    +N + D++VAI RV   + GGR   FS LVVVGD   +VG     A E+PE
Sbjct: 2   NRSVDNNTENNELFDKVVAIKRVVKVVKGGRNMRFSALVVVGDKNGRVGAGLGKAAEIPE 61

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+RK  E A +NM+S+ + +  ++ HD +G+ G+ +V+++ A  GTGVIAGG  R V E+
Sbjct: 62  AIRKGKEDAIKNMVSLPIDENGSVPHDFIGKFGSAEVLLKRAPDGTGVIAGGPARNVLEL 121

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            G  ++  KS+GS+N  NV+ AT   L     P + A  RGI  S L
Sbjct: 122 AGYRNIRTKSLGSNNKQNVVLATINGLSKLKTPEEFARLRGISVSDL 168


>gi|329945746|ref|ZP_08293433.1| ribosomal protein S5 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328528194|gb|EGF55172.1| ribosomal protein S5 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 235

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 1/175 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            ++R+V INRVS  + GGRRF F+ LVVVGD +  VG  +  A+EVP A+ KA E AK+N
Sbjct: 48  YIERVVTINRVSKVVKGGRRFTFTALVVVGDGEGTVGVGYGKAKEVPAAIAKAVEIAKKN 107

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
              V ++  RT+ H   G   AG V++R A  GTGVIAGG +RAV +  G+HD+++KS+G
Sbjct: 108 FFHVPMIR-RTIPHLVQGEDSAGVVLLRPASPGTGVIAGGPVRAVLDCAGVHDILSKSLG 166

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           SSN  N++ AT + L+    P  VA RRG+    +  + ++ +++   +      
Sbjct: 167 SSNAINIVHATVDALKQLEQPEAVAARRGLPLEDVAPQPMLRARAEGEADKRAQA 221


>gi|153004790|ref|YP_001379115.1| ribosomal protein S5 [Anaeromyxobacter sp. Fw109-5]
 gi|171769472|sp|A7HBN5|RS5_ANADF RecName: Full=30S ribosomal protein S5
 gi|152028363|gb|ABS26131.1| ribosomal protein S5 [Anaeromyxobacter sp. Fw109-5]
          Length = 168

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/161 (45%), Positives = 99/161 (61%), Gaps = 1/161 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
              +  + D++V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 6   NANELELQDKVVHINRVAKVVKGGRRFSFSALVVVGDGNGYVGVGLGKANEVPEAIRKGG 65

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           + AK+N+  V L+ G T+ H+ +G  GAG V+++ A  GTGVIAGG +RAV E  G+ +V
Sbjct: 66  DQAKKNLFKVPLV-GTTIPHEVLGHFGAGWVLLKPAGEGTGVIAGGTVRAVLEAAGIRNV 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + K  GS NPHNV++AT   L+      D A  RG +   L
Sbjct: 125 LTKCQGSRNPHNVLKATVAGLKRLRSADDAARARGKQAGEL 165


>gi|91791556|ref|YP_561207.1| 30S ribosomal protein S5 [Shewanella denitrificans OS217]
 gi|114561353|ref|YP_748866.1| 30S ribosomal protein S5 [Shewanella frigidimarina NCIMB 400]
 gi|122301101|sp|Q089N7|RS5_SHEFN RecName: Full=30S ribosomal protein S5
 gi|122969078|sp|Q12SU2|RS5_SHEDO RecName: Full=30S ribosomal protein S5
 gi|91713558|gb|ABE53484.1| SSU ribosomal protein S5P [Shewanella denitrificans OS217]
 gi|114332646|gb|ABI70028.1| SSU ribosomal protein S5P [Shewanella frigidimarina NCIMB 400]
          Length = 167

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/162 (45%), Positives = 111/162 (68%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           ++ + + ++++A+NRVS  + GGR F+F+ L VVGD   K+G+ +  AREVP A++KA E
Sbjct: 7   QQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGKIGYGYGKAREVPAAIQKAME 66

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+RNM++V L +  TLHH   GRH   KV M+ A  GTG+IAGGA+RAV EV G+H+V+
Sbjct: 67  KARRNMVTVEL-NAGTLHHPVKGRHTGSKVYMQPASQGTGIIAGGAMRAVLEVAGVHNVL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 126 SKAYGSTNPINIVRATVDALVHMKSPAQIAAKRGLNVDEIRG 167


>gi|261492709|ref|ZP_05989257.1| ribosomal protein S5 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495676|ref|ZP_05992122.1| ribosomal protein S5 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261308783|gb|EEY10040.1| ribosomal protein S5 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311562|gb|EEY12717.1| ribosomal protein S5 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 166

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALENMKSPEMVAAKRGKTVEEILG 166


>gi|251787988|ref|YP_003002709.1| 30S ribosomal protein S5 [Dickeya zeae Ech1591]
 gi|271502229|ref|YP_003335255.1| 30S ribosomal protein S5 [Dickeya dadantii Ech586]
 gi|247536609|gb|ACT05230.1| ribosomal protein S5 [Dickeya zeae Ech1591]
 gi|270345784|gb|ACZ78549.1| ribosomal protein S5 [Dickeya dadantii Ech586]
          Length = 166

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMMNVAL-NNGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LAKAYGSTNPINVVRATIDGLANMKSPEMVAAKRGKSVEDILG 166


>gi|225076412|ref|ZP_03719611.1| hypothetical protein NEIFLAOT_01457 [Neisseria flavescens
           NRL30031/H210]
 gi|241759601|ref|ZP_04757702.1| ribosomal protein S5 [Neisseria flavescens SK114]
 gi|255067441|ref|ZP_05319296.1| ribosomal protein S5 [Neisseria sicca ATCC 29256]
 gi|261380576|ref|ZP_05985149.1| ribosomal protein S5 [Neisseria subflava NJ9703]
 gi|261400069|ref|ZP_05986194.1| ribosomal protein S5 [Neisseria lactamica ATCC 23970]
 gi|313667458|ref|YP_004047742.1| 30S ribosomal protein S5 [Neisseria lactamica ST-640]
 gi|319639566|ref|ZP_07994313.1| 30S ribosomal protein S5 [Neisseria mucosa C102]
 gi|224952260|gb|EEG33469.1| hypothetical protein NEIFLAOT_01457 [Neisseria flavescens
           NRL30031/H210]
 gi|241319973|gb|EER56354.1| ribosomal protein S5 [Neisseria flavescens SK114]
 gi|255048236|gb|EET43700.1| ribosomal protein S5 [Neisseria sicca ATCC 29256]
 gi|269210295|gb|EEZ76750.1| ribosomal protein S5 [Neisseria lactamica ATCC 23970]
 gi|284796544|gb|EFC51891.1| ribosomal protein S5 [Neisseria subflava NJ9703]
 gi|309379142|emb|CBX22273.1| 30s ribosomal protein S5 [Neisseria lactamica Y92-1009]
 gi|313004920|emb|CBN86346.1| 30S ribosomal protein S5 [Neisseria lactamica 020-06]
 gi|317399137|gb|EFV79811.1| 30S ribosomal protein S5 [Neisseria mucosa C102]
          Length = 172

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 109/168 (64%), Gaps = 1/168 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               EER + +++++VA+NRV+  + GGR  AFS L VVGD   ++G     ++EVP AV
Sbjct: 3   KHEIEERGDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGDGDGRIGMGKGKSKEVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+R+MI V L +  T+HH+ +GRHGA KV M+ A  G+GV AGG +R V + +G
Sbjct: 63  QKAMDQARRSMIKVPLKN-GTIHHEVIGRHGATKVFMQPAKEGSGVKAGGPMRLVFDAMG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +H++ AK  GS+NP+N++RAT + L     P D+A +RG+    +   
Sbjct: 122 IHNISAKVHGSTNPYNIVRATLDGLSKLYTPADIAAKRGLTVEDILGA 169


>gi|188584853|ref|YP_001916398.1| SSU ribosomal protein S5P [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|259495310|sp|B2A4F6|RS5_NATTJ RecName: Full=30S ribosomal protein S5
 gi|179349540|gb|ACB83810.1| SSU ribosomal protein S5P [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 168

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/168 (43%), Positives = 104/168 (61%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             ++ +     + +++V INRV+  + GGRRF+FS LVVVGD    VG  +  A EVPEA
Sbjct: 2   RRKDFDPNKLDLSEKVVEINRVTKVVKGGRRFSFSALVVVGDENGYVGAGNGKAVEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E AK+N+I V ++ G T+ H+ VGR G G+V+++ A  GTGVIAGG +RAV E  
Sbjct: 62  IRKGIEDAKKNLIKVPMV-GTTIPHEIVGRDGGGQVLLKPAYEGTGVIAGGPVRAVLEQA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ D++ KS+GS+N  +++ AT   L        VA  RGI    LQ 
Sbjct: 121 GIRDILTKSLGSNNAKSMVNATIAGLNQLKTAEQVARLRGISVKDLQG 168


>gi|269128499|ref|YP_003301869.1| 30S ribosomal protein S5 [Thermomonospora curvata DSM 43183]
 gi|268313457|gb|ACY99831.1| ribosomal protein S5 [Thermomonospora curvata DSM 43183]
          Length = 205

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 69/178 (38%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           ++  S ++R+VAINRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E
Sbjct: 26  DKGQSYIERVVAINRVAKVVKGGRRFSFTALVVVGDGNGTVGVGYGKAKEVPAAIAKGVE 85

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++   V  +   T+ H   G   AG V++R A  GTGVIAGG +RAV E  G+ DV+
Sbjct: 86  EAKKHFFKVPRI-QGTIPHAVQGEKAAGVVLLRPASPGTGVIAGGPVRAVLEAAGIQDVL 144

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSK 194
           +KS+GS+N  N++ AT   L+  S P ++A +RG+    +    ++ + ++      +
Sbjct: 145 SKSLGSANAINIVHATVAALKQLSRPEEIAAKRGLPLEDVVPAPMLRAWAAGTEPRVE 202


>gi|19551777|ref|NP_599779.1| 30S ribosomal protein S5 [Corynebacterium glutamicum ATCC 13032]
 gi|62389432|ref|YP_224834.1| 30S ribosomal protein S5 [Corynebacterium glutamicum ATCC 13032]
 gi|145294691|ref|YP_001137512.1| 30S ribosomal protein S5 [Corynebacterium glutamicum R]
 gi|26399383|sp|Q8NSX5|RS5_CORGL RecName: Full=30S ribosomal protein S5
 gi|189045408|sp|A4QBL3|RS5_CORGB RecName: Full=30S ribosomal protein S5
 gi|21323305|dbj|BAB97933.1| Ribosomal protein S5 [Corynebacterium glutamicum ATCC 13032]
 gi|41324766|emb|CAF19248.1| 30S RIBOSOMAL PROTEIN S5 [Corynebacterium glutamicum ATCC 13032]
 gi|140844611|dbj|BAF53610.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 211

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 69/177 (38%), Positives = 109/177 (61%), Gaps = 1/177 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A++K
Sbjct: 36  QQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQK 95

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A++N   V +++  T+ H   G   AG V+++ A  GTGVIAGGA R V E  G+ 
Sbjct: 96  GAEEARKNFFRVPMVN-GTITHPVQGEKAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQ 154

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           D+++KS+GS N  NV+ AT + L+    P +VA RRG     +   R++ +++   +
Sbjct: 155 DILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARRGKTIEEVAPARILRARAGQEA 211


>gi|113460226|ref|YP_718283.1| 30S ribosomal protein S5 [Haemophilus somnus 129PT]
 gi|170718266|ref|YP_001785284.1| 30S ribosomal protein S5 [Haemophilus somnus 2336]
 gi|123327090|sp|Q0I145|RS5_HAES1 RecName: Full=30S ribosomal protein S5
 gi|189045418|sp|B0UX31|RS5_HAES2 RecName: Full=30S ribosomal protein S5
 gi|112822269|gb|ABI24358.1| SSU ribosomal protein S5P [Haemophilus somnus 129PT]
 gi|168826395|gb|ACA31766.1| ribosomal protein S5 [Haemophilus somnus 2336]
          Length = 166

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQTGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ +V
Sbjct: 65  EKARRNMITVAL-NEGTLQHPIKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVRNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           ++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 124 LSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|32475075|ref|NP_868069.1| 30S ribosomal protein S5 [Rhodopirellula baltica SH 1]
 gi|73919092|sp|Q7UN03|RS5_RHOBA RecName: Full=30S ribosomal protein S5
 gi|32445615|emb|CAD75616.1| 30S ribosomal protein S5 [Rhodopirellula baltica SH 1]
 gi|327540595|gb|EGF27170.1| 30S ribosomal protein S5 [Rhodopirellula baltica WH47]
          Length = 177

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 64/166 (38%), Positives = 104/166 (62%), Gaps = 1/166 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +  +  ++DR+V I R +  + GGRRF+F+ +VVVG+   +VG+ +  A EVP +V+K
Sbjct: 13  EEQGLEAGLLDRVVKIKRCAAVVKGGRRFSFAAMVVVGNGSGQVGWGYGKANEVPPSVQK 72

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A + A R+MI V L++  ++ H   GR+GA +V++  A AGTG+IAG A+RAVCE  G+H
Sbjct: 73  AQKQASRSMIHVPLVE-GSIPHQVWGRYGAARVVLIPAGAGTGIIAGQAVRAVCEACGIH 131

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           D++ KS G++NP  +++AT + +        +A  RG+    L   
Sbjct: 132 DILTKSYGTNNPVTLVKATLDAMSKLRTREQIAALRGLNPDDLIEA 177


>gi|261378058|ref|ZP_05982631.1| ribosomal protein S5 [Neisseria cinerea ATCC 14685]
 gi|269145508|gb|EEZ71926.1| ribosomal protein S5 [Neisseria cinerea ATCC 14685]
          Length = 172

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 71/167 (42%), Positives = 109/167 (65%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               EER + +++++VA+NRV+  + GGR  AFS L VVGD   ++G     ++EVP AV
Sbjct: 3   KHEIEERGDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGDGDGRIGMGKGKSKEVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+R+MI V L +  T+HH+ +GRHGA KV M+ A  G+GV AGG +R V + +G
Sbjct: 63  QKAMDQARRSMIKVPLRN-GTIHHEVIGRHGATKVFMQPAKEGSGVKAGGPMRLVFDAMG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +H++ AK  GS+NP+N++RAT + L     P D+A +RG+    +  
Sbjct: 122 IHNISAKVHGSTNPYNIVRATLDGLSKLYTPADIAAKRGLTVEDILG 168


>gi|239636216|ref|ZP_04677220.1| ribosomal protein S5 [Staphylococcus warneri L37603]
 gi|239598232|gb|EEQ80725.1| ribosomal protein S5 [Staphylococcus warneri L37603]
 gi|330685125|gb|EGG96789.1| ribosomal protein S5 [Staphylococcus epidermidis VCU121]
          Length = 166

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 72/152 (47%), Positives = 102/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATLNGLQNLKNAEDVAKLRGKTVEELY 165


>gi|157960031|ref|YP_001500065.1| 30S ribosomal protein S5 [Shewanella pealeana ATCC 700345]
 gi|167626022|ref|YP_001676316.1| 30S ribosomal protein S5 [Shewanella halifaxensis HAW-EB4]
 gi|157845031|gb|ABV85530.1| ribosomal protein S5 [Shewanella pealeana ATCC 700345]
 gi|167356044|gb|ABZ78657.1| ribosomal protein S5 [Shewanella halifaxensis HAW-EB4]
          Length = 168

 Score =  171 bits (433), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 114/165 (69%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++ + + +++VA+NRVS  + GGR F+F+ L VVGD   KVG+ +  AREVP A++K
Sbjct: 5   EAQQQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGYGYGKAREVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RN+++V L +  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 65  AMEKARRNIVNVEL-NNGTLHHPVKGRHTGSRVYMQPASDGTGIIAGGAMRAVLEVAGVH 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP N++RAT + L +   P  +A +RG+  + ++ 
Sbjct: 124 NVLSKAYGSTNPINIVRATVDALVNMKSPSQIAAKRGLNVTEIRG 168


>gi|239787580|emb|CAX84048.1| 30S ribosomal protein S5 [uncultured bacterium]
          Length = 186

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 80/183 (43%), Positives = 122/183 (66%), Gaps = 7/183 (3%)

Query: 1   MAQKERSQRDNWQNREERD-------NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDT 53
           MA++  +  +N  +    +       +  ++++V I R +  + GG RF FS +VVVGD 
Sbjct: 1   MAKRRSTNTNNNSSNPPEEKVGGWQSDDFIEKLVTIKRTAKVVKGGSRFNFSAIVVVGDG 60

Query: 54  KSKVGFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMA 113
           K +VG+    A+EVPE++RKATE A++NM+ + + DGRT+ H  +G++GAG VI+R A  
Sbjct: 61  KGRVGYGLGKAKEVPESIRKATEKARKNMMDIPIKDGRTIFHQMIGQYGAGGVILRPAAE 120

Query: 114 GTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKH 173
           GTG+IAGG++R + E LG+ DV+AKS G+SNPHN+I+ATF  L+S   PRDVA +R +  
Sbjct: 121 GTGIIAGGSMRPIFEALGIRDVLAKSTGTSNPHNLIKATFAALKSIRSPRDVAAKRDLPL 180

Query: 174 SLL 176
           +  
Sbjct: 181 ARF 183


>gi|325479151|gb|EGC82248.1| ribosomal protein S5 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 169

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 100/164 (60%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E    ++ DR+VAINRV+  + GGR   FS LVVVG+    VG     A EVPEA+RK
Sbjct: 6   RSEVEKLNLEDRVVAINRVAKTVKGGRNIRFSALVVVGNGNGYVGIGTGKATEVPEAIRK 65

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A+E AK++MI+V L+ G T+ H   G  G+GKV++  A  GTGVIAGG +RA+CE+ G  
Sbjct: 66  ASEDAKKHMINVPLV-GTTIPHRIHGHKGSGKVLLMPATEGTGVIAGGPVRAICELAGYK 124

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D+ AK++GSSNP N+I A  E   +     +VA  RG       
Sbjct: 125 DIRAKNLGSSNPRNIINACMEAFANMKTVEEVAKLRGKSVEEFD 168


>gi|75675573|ref|YP_317994.1| 30S ribosomal protein S5 [Nitrobacter winogradskyi Nb-255]
 gi|91207872|sp|Q3SSU9|RS5_NITWN RecName: Full=30S ribosomal protein S5
 gi|74420443|gb|ABA04642.1| SSU ribosomal protein S5P [Nitrobacter winogradskyi Nb-255]
          Length = 191

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 1/170 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GG+RF F+ LVV+GD K +VGF H  AREVPEA+RKATE+AKRN
Sbjct: 23  FVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFGHGKAREVPEAIRKATESAKRN 82

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +  V L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKS+G
Sbjct: 83  LTRVPLREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIQDVVAKSVG 142

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSR 191
           SSNP+N++RATF+ L+ Q  PR V+ RR IK S LQ+RRV    + + + 
Sbjct: 143 SSNPYNMVRATFDALKHQDSPRSVSARRNIKVSTLQSRRV-GGDAEAVAE 191


>gi|78357283|ref|YP_388732.1| 30S ribosomal protein S5 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|91207863|sp|Q30Z59|RS5_DESDG RecName: Full=30S ribosomal protein S5
 gi|78219688|gb|ABB39037.1| SSU ribosomal protein S5P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 163

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 80/159 (50%), Positives = 113/159 (71%), Gaps = 1/159 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E+ +  ++++IV +NRV+  + GGRRF+FS LVVVGD    VGF    A+EVPEA+RKAT
Sbjct: 2   EQNEFGLIEKIVDLNRVAKVVKGGRRFSFSALVVVGDGNGSVGFGMGKAQEVPEALRKAT 61

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+ M+ V L+D  TL ++ +G  GAG+V+++ A  GTG+IAGGA+RA+ E +G+HDV
Sbjct: 62  ERAKKGMVQVPLVD-GTLPYEVLGAFGAGRVLLKPASKGTGIIAGGAVRAIMEAVGIHDV 120

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           +AK+IG++NPHNV+RAT   L S      V+  RG K  
Sbjct: 121 LAKAIGTNNPHNVLRATMAGLTSLRSAEYVSQLRGKKLE 159


>gi|314934280|ref|ZP_07841639.1| ribosomal protein S5 [Staphylococcus caprae C87]
 gi|313652210|gb|EFS15973.1| ribosomal protein S5 [Staphylococcus caprae C87]
          Length = 166

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 72/152 (47%), Positives = 103/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V+M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVLMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATINGLQNLKNAEDVAKLRGKSVEELY 165


>gi|223042351|ref|ZP_03612400.1| ribosomal protein S5 [Staphylococcus capitis SK14]
 gi|222444014|gb|EEE50110.1| ribosomal protein S5 [Staphylococcus capitis SK14]
          Length = 166

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 71/152 (46%), Positives = 103/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA E+AK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVESAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V+M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVLMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATINGLQNLKNAEDVAKLRGKSVEELY 165


>gi|58038838|ref|YP_190802.1| 30S ribosomal protein S5 [Gluconobacter oxydans 621H]
 gi|73919058|sp|Q5FU00|RS5_GLUOX RecName: Full=30S ribosomal protein S5
 gi|58001252|gb|AAW60146.1| SSU ribosomal protein S5P [Gluconobacter oxydans 621H]
          Length = 191

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 97/170 (57%), Positives = 125/170 (73%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           + +VD++V INRV+  + GGRRFAF+ LVVVGD K +VG+    AREVPEA+RKATE AK
Sbjct: 19  DDLVDKLVTINRVAKVVKGGRRFAFAALVVVGDQKGRVGYGAGKAREVPEAIRKATERAK 78

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V + +GRTLHHD  G +GAGKV++R+A AGTG+IAGG +RAV E LG++DVVAKS
Sbjct: 79  RTMIRVPMKEGRTLHHDTFGHYGAGKVVVRAAEAGTGIIAGGPMRAVFESLGVNDVVAKS 138

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
           +G+ NPHN+I+ATF  L   S PR VA+RRG K + L  +R      +  
Sbjct: 139 LGTRNPHNMIKATFAALEKASSPRHVASRRGKKAAELFGKREQGQTEAEV 188


>gi|254362780|ref|ZP_04978862.1| ribosomal protein S5 [Mannheimia haemolytica PHL213]
 gi|153094409|gb|EDN75258.1| ribosomal protein S5 [Mannheimia haemolytica PHL213]
          Length = 166

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF H  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGHGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALENMKSPEMVAAKRGKTVEEILG 166


>gi|303256467|ref|ZP_07342481.1| ribosomal protein S5 [Burkholderiales bacterium 1_1_47]
 gi|302859958|gb|EFL83035.1| ribosomal protein S5 [Burkholderiales bacterium 1_1_47]
          Length = 172

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 71/178 (39%), Positives = 110/178 (61%), Gaps = 6/178 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+  ++        EE+D+ I ++++A+NRV+  + GGR   F+ L VVGD   ++G  
Sbjct: 1   MAKNPKNA-----VAEEQDDGIREKMIAVNRVTKVVKGGRILGFAALTVVGDGDGRIGMG 55

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              +REVP +V+KA + A+R M  V L +  T+ H   G HGA +V++  A  GTGVIAG
Sbjct: 56  KGKSREVPVSVQKAMDQARRAMEKVPLRN-GTIFHAVEGHHGASRVMLHPAPEGTGVIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G +RA+ +V+G+ ++VAKS GSSNP+N++RAT + L     P ++A +RG     L  
Sbjct: 115 GPMRAIFDVMGIRNIVAKSHGSSNPYNMVRATLDALSKLRSPSEIAAKRGKTVEELIG 172


>gi|269469219|gb|EEZ80750.1| ribosomal protein S5 [uncultured SUP05 cluster bacterium]
          Length = 172

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 76/179 (42%), Positives = 110/179 (61%), Gaps = 8/179 (4%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+ +R+  ++       DN  ++++V I RV   + GGR F FS LVVVGD   KVG+ 
Sbjct: 1   MAEYKRNNNND-------DNEYIEKLVNIRRVVKVVKGGRIFGFSALVVVGDGNGKVGYG 53

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVP A++KA + AK+ M +V L+D  TL++      GA KV M+ A  GTGVIAG
Sbjct: 54  TGKAREVPAAIQKAMDKAKKAMKTVPLID-GTLYYPITSNVGAAKVYMQPASEGTGVIAG 112

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           G +R+V E +G+H+++AK  G+ NP +V+RAT E L S + P+ VA +RG     +   
Sbjct: 113 GPMRSVLEAVGVHNILAKCNGTRNPISVVRATVEGLTSMTSPQSVAAKRGKTVEQITGE 171


>gi|261867272|ref|YP_003255194.1| 30S ribosomal protein S5 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412604|gb|ACX81975.1| ribosomal protein S5 [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 166

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVALSE-GTLQHPIKGTHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKSVDEILG 166


>gi|326692221|ref|ZP_08229226.1| 30S ribosomal protein S5 [Leuconostoc argentinum KCTC 3773]
          Length = 168

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 79/158 (50%), Positives = 104/158 (65%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + + +VAINRV+  + GGRR  F+ LVVVGD +  VGF    A+EVPEA+RKA E AKR
Sbjct: 12  ELEENVVAINRVTKVVKGGRRLRFAALVVVGDKQGHVGFGTGKAQEVPEAIRKAIEDAKR 71

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
            MI+V  + G T+ HD +G  G GK++++ A  G+GV AGGA R+V E+ G+ DV AKS+
Sbjct: 72  KMITVPTV-GTTIPHDVLGVWGGGKILIKPAEEGSGVAAGGAARSVMELAGIADVTAKSL 130

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GSS P NV+RATFE L S     +VA  RG+    L  
Sbjct: 131 GSSTPVNVVRATFEALTSLKDAEEVAALRGVSLEHLAE 168


>gi|315633472|ref|ZP_07888762.1| 30S ribosomal protein S5 [Aggregatibacter segnis ATCC 33393]
 gi|315477514|gb|EFU68256.1| 30S ribosomal protein S5 [Aggregatibacter segnis ATCC 33393]
          Length = 166

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVTLTE-GTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKSVDEILG 166


>gi|293393294|ref|ZP_06637608.1| 30S ribosomal protein S5 [Serratia odorifera DSM 4582]
 gi|320540592|ref|ZP_08040242.1| 30S ribosomal subunit protein S5 [Serratia symbiotica str. Tucson]
 gi|291424204|gb|EFE97419.1| 30S ribosomal protein S5 [Serratia odorifera DSM 4582]
 gi|320029523|gb|EFW11552.1| 30S ribosomal subunit protein S5 [Serratia symbiotica str. Tucson]
          Length = 166

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 75/163 (46%), Positives = 110/163 (67%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA 
Sbjct: 5   EKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAM 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+H+V
Sbjct: 65  EKARRNMMNVAL-NSGTLQHPVKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT + L +   P  VA +RG   + +  
Sbjct: 124 LAKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKSVADILG 166


>gi|159042858|ref|YP_001531652.1| 30S ribosomal protein S5 [Dinoroseobacter shibae DFL 12]
 gi|189045409|sp|A8LM74|RS5_DINSH RecName: Full=30S ribosomal protein S5
 gi|157910618|gb|ABV92051.1| 30S ribosomal protein S5 [Dinoroseobacter shibae DFL 12]
          Length = 191

 Score =  170 bits (432), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 102/179 (56%), Positives = 128/179 (71%), Gaps = 2/179 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++  +       E       DR+VAINRVS  + GG+RF F+ LVVVGD + +VGF 
Sbjct: 1   MAERDNRRGRRDDRDET--PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAG
Sbjct: 59  KGKAKEVPEAIRKATEQAKRQMIRVPLREGRTLHHDIEGRHGAGKVMMRTAPQGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           G +RAV E+LG+ DVVAKSIGS NP+N+IRAT + LR ++ PR VA RRG K S +  +
Sbjct: 119 GPMRAVFEMLGVQDVVAKSIGSQNPYNMIRATLDGLRKETSPRMVAQRRGKKVSDILKK 177


>gi|330432107|gb|AEC17166.1| 30S ribosomal protein S5 [Gallibacterium anatis UMN179]
          Length = 166

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPIKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGIR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|299135240|ref|ZP_07028431.1| ribosomal protein S5 [Afipia sp. 1NLS2]
 gi|298590217|gb|EFI50421.1| ribosomal protein S5 [Afipia sp. 1NLS2]
          Length = 192

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 104/171 (60%), Positives = 132/171 (77%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           +  VD++V INRV+  + GG+RF F+ LVV+GD K +VGF H  AREVPEA+RKAT++AK
Sbjct: 22  SEFVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFGHGKAREVPEAIRKATDSAK 81

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RN+  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKS
Sbjct: 82  RNLTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIQDVVAKS 141

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +GSSNP+N++RATF+ L+ Q  PR VANRR IK S LQARRV     +S  
Sbjct: 142 VGSSNPYNMVRATFDALKHQDSPRSVANRRNIKVSALQARRVGGDAEASAD 192


>gi|89076307|ref|ZP_01162648.1| putative ribosomal subunit protein S5 [Photobacterium sp. SKA34]
 gi|90581695|ref|ZP_01237483.1| putative ribosomal subunit protein S5 [Vibrio angustum S14]
 gi|89048011|gb|EAR53600.1| putative ribosomal subunit protein S5 [Photobacterium sp. SKA34]
 gi|90437110|gb|EAS62313.1| putative ribosomal subunit protein S5 [Vibrio angustum S14]
          Length = 165

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 72/164 (43%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E+  + + ++++A+NRVS  + GGR F+F+ L VVGD   ++GF +  AREVP A++KA
Sbjct: 3   NEKTQSDLNEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRIGFGYGKAREVPAAIQKA 62

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM+++++ +  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+ +
Sbjct: 63  MEKARRNMVTIAI-NEGTLHHAVKGRHTGSQVYMQPASEGTGIIAGGAMRAVLEVAGIRN 121

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP NV+RAT + L   + P  +A +RG+    +  
Sbjct: 122 VLAKAYGSTNPINVVRATIDGLSGMNSPEMIAAKRGLSVKEILE 165


>gi|271962649|ref|YP_003336845.1| 30S ribosomal protein S5-like protein [Streptosporangium roseum DSM
           43021]
 gi|270505824|gb|ACZ84102.1| Ribosomal protein S5-like protein [Streptosporangium roseum DSM
           43021]
          Length = 210

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 70/163 (42%), Positives = 101/163 (61%), Gaps = 1/163 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
           S ++R+V INRV+  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E AK+
Sbjct: 33  SYIERVVKINRVAKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEAKK 92

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           +   V  +   T+ H   G   AG V +R A  GTGVIAGG +RAV E  G+HDV++KS+
Sbjct: 93  HFFRVPRI-QGTIPHIVQGEEAAGVVFLRPASPGTGVIAGGPVRAVLECAGIHDVLSKSL 151

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
           GS NP N++ AT   L+  S P ++A RRG+    +  + ++ 
Sbjct: 152 GSDNPINIVHATVAALKGLSRPEEIAARRGLPIEDVAPKAMLK 194


>gi|294789210|ref|ZP_06754449.1| ribosomal protein S5 [Simonsiella muelleri ATCC 29453]
 gi|325267159|ref|ZP_08133827.1| 30S ribosomal protein S5 [Kingella denitrificans ATCC 33394]
 gi|294482951|gb|EFG30639.1| ribosomal protein S5 [Simonsiella muelleri ATCC 29453]
 gi|324981397|gb|EGC17041.1| 30S ribosomal protein S5 [Kingella denitrificans ATCC 33394]
          Length = 171

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 71/170 (41%), Positives = 110/170 (64%), Gaps = 1/170 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               EER + +++++VA+NRV+  + GGR  AFS L VVGD   ++G     +REVP AV
Sbjct: 3   KHETEERGDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGDGDGRIGMGKGKSREVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+RNMI V L +  T+HH+ +G+HGA +V M+ A  G+GV AGG +R V + LG
Sbjct: 63  QKAMDQARRNMIKVPLKN-GTIHHEVIGKHGATRVFMQPAKEGSGVKAGGPMRLVFDALG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           +H++ AK  GS+NP+N++RAT + L     P ++A +RG+    +   + 
Sbjct: 122 VHNISAKVHGSTNPYNIVRATLDGLSKLYTPAEIAAKRGLTVEDILGSKE 171


>gi|83949771|ref|ZP_00958504.1| 30S ribosomal protein S5 [Roseovarius nubinhibens ISM]
 gi|83837670|gb|EAP76966.1| 30S ribosomal protein S5 [Roseovarius nubinhibens ISM]
          Length = 193

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 102/178 (57%), Positives = 124/178 (69%), Gaps = 1/178 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 17  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 76

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVVAKS
Sbjct: 77  RQMIRVPLREGRTLHHDVKGRHGAGKVVMRTAPQGTGIIAGGPMRAVFEMLGVQDVVAKS 136

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNKG 197
           IGS NP+N+IRAT   L  +S PR VA RRG K + +  R+  + K S        + 
Sbjct: 137 IGSQNPYNMIRATLNGLTQESSPRMVAQRRGKKVADIL-RKEDAPKVSGEQAPVVEEA 193


>gi|94500976|ref|ZP_01307501.1| ribosomal protein S5 [Oceanobacter sp. RED65]
 gi|94426916|gb|EAT11899.1| ribosomal protein S5 [Oceanobacter sp. RED65]
          Length = 169

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 79/168 (47%), Positives = 105/168 (62%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           N +     D  + +++V +NRV+  + GGR F F+ L VVGD K KVGF    AREVP A
Sbjct: 3   NERVDRNNDGELQEKLVQVNRVAKVVKGGRVFGFTALTVVGDGKGKVGFGRGKAREVPTA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA E AKRNMI V L DG TL +     H   K+ M+ A  GTG+IAGGA+RAV E++
Sbjct: 63  IQKAMEQAKRNMIDVQL-DGDTLQYPVKATHSGSKIFMQPASQGTGIIAGGAMRAVLEMV 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+H+V+AK  GS+NP NV+RAT + LR    P  VA +RG     +  
Sbjct: 122 GVHNVLAKCYGSTNPINVVRATVKGLREMRSPEQVAAKRGKSVEEILG 169


>gi|21672753|ref|NP_660820.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25009195|sp|Q8K966|RS5_BUCAP RecName: Full=30S ribosomal protein S5
 gi|21623399|gb|AAM68031.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 167

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 68/164 (41%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            ++ ++ + ++++ +NRVS  + GGR F+F+ L VVG+ + +VGF +  AREVP A++KA
Sbjct: 5   EKKNNSELQEKLITVNRVSKTVKGGRIFSFTALTVVGNGEGRVGFGYGKAREVPAAIQKA 64

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM+++ L++  TL H   G H    + M+ A  GTG+IAGGA+RAV EV G+H+
Sbjct: 65  MEKARRNMVTIPLVNK-TLQHSLKGSHTGSNIFMKPASDGTGIIAGGAMRAVLEVAGIHN 123

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP NV+RAT   L +   P  +A +R      +  
Sbjct: 124 VLAKTYGSTNPINVVRATMNGLTNMKSPEMIAAKRNKLIEDILG 167


>gi|242371880|ref|ZP_04817454.1| 30S ribosomal protein S5 [Staphylococcus epidermidis M23864:W1]
 gi|242350387|gb|EES41988.1| 30S ribosomal protein S5 [Staphylococcus epidermidis M23864:W1]
          Length = 166

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 73/152 (48%), Positives = 103/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD K +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKKGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATINGLQNLKNAEDVAKLRGKSVEELY 165


>gi|126176338|ref|YP_001052487.1| 30S ribosomal protein S5 [Shewanella baltica OS155]
 gi|152998766|ref|YP_001364447.1| 30S ribosomal protein S5 [Shewanella baltica OS185]
 gi|160873343|ref|YP_001552659.1| 30S ribosomal protein S5 [Shewanella baltica OS195]
 gi|217975184|ref|YP_002359935.1| 30S ribosomal protein S5 [Shewanella baltica OS223]
 gi|304412782|ref|ZP_07394384.1| ribosomal protein S5 [Shewanella baltica OS183]
 gi|307307446|ref|ZP_07587181.1| ribosomal protein S5 [Shewanella baltica BA175]
 gi|171704510|sp|A6WHU5|RS5_SHEB8 RecName: Full=30S ribosomal protein S5
 gi|171769981|sp|A3DA55|RS5_SHEB5 RecName: Full=30S ribosomal protein S5
 gi|226703383|sp|A9KWB9|RS5_SHEB9 RecName: Full=30S ribosomal protein S5
 gi|254765205|sp|B8EBI8|RS5_SHEB2 RecName: Full=30S ribosomal protein S5
 gi|125999543|gb|ABN63618.1| SSU ribosomal protein S5P [Shewanella baltica OS155]
 gi|151363384|gb|ABS06384.1| ribosomal protein S5 [Shewanella baltica OS185]
 gi|160858865|gb|ABX47399.1| ribosomal protein S5 [Shewanella baltica OS195]
 gi|217500319|gb|ACK48512.1| ribosomal protein S5 [Shewanella baltica OS223]
 gi|304348862|gb|EFM13278.1| ribosomal protein S5 [Shewanella baltica OS183]
 gi|306910234|gb|EFN40667.1| ribosomal protein S5 [Shewanella baltica BA175]
 gi|315265570|gb|ADT92423.1| ribosomal protein S5 [Shewanella baltica OS678]
          Length = 167

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 71/162 (43%), Positives = 110/162 (67%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           ++ + + ++++A+NRVS  + GGR F+F+ L VVGD   K+G+ +  AREVP A++KA E
Sbjct: 7   QQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGKIGYGYGKAREVPAAIQKAME 66

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+RN+++V L +  TLHH   GRH    V M+ A  GTG+IAGGA+RAV EV G+H+V+
Sbjct: 67  KARRNIVTVEL-NAGTLHHPVKGRHTGSLVYMQPASQGTGIIAGGAMRAVLEVAGVHNVL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +K+ GS+NP N++RAT + L     P  +A +RG+    ++ 
Sbjct: 126 SKAYGSTNPINIVRATVDALVHMKSPSQIAAKRGLNVDEIRG 167


>gi|325577144|ref|ZP_08147628.1| 30S ribosomal protein S5 [Haemophilus parainfluenzae ATCC 33392]
 gi|301155347|emb|CBW14813.1| 30S ribosomal subunit protein S5 [Haemophilus parainfluenzae T3T1]
 gi|325160726|gb|EGC72847.1| 30S ribosomal protein S5 [Haemophilus parainfluenzae ATCC 33392]
          Length = 166

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+R+V EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRSVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|254427755|ref|ZP_05041462.1| ribosomal protein S5 [Alcanivorax sp. DG881]
 gi|196193924|gb|EDX88883.1| ribosomal protein S5 [Alcanivorax sp. DG881]
          Length = 165

 Score =  170 bits (432), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 82/160 (51%), Positives = 108/160 (67%), Gaps = 1/160 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           + +  + +++V +NRV+  + GGR F F+ L VVGD K KVGF    AREVP A++KA E
Sbjct: 5   DPNEGLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGKGKVGFGRGKAREVPAAIQKALE 64

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
           AA+RNMI V L +G T+ H    RHGA KV M+ A  GTGVIAGGA+RAV EV G+ +V+
Sbjct: 65  AARRNMIQVEL-NGSTIQHPMKARHGASKVYMQPADEGTGVIAGGAMRAVLEVAGVQNVL 123

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           AK  GS+NP NV+RATF  L+S + P  VA +RG     +
Sbjct: 124 AKCYGSTNPVNVVRATFNGLKSMASPESVAAKRGKSVEEI 163


>gi|52426086|ref|YP_089223.1| 30S ribosomal protein S5 [Mannheimia succiniciproducens MBEL55E]
 gi|73919070|sp|Q65QX2|RS5_MANSM RecName: Full=30S ribosomal protein S5
 gi|52308138|gb|AAU38638.1| RpsE protein [Mannheimia succiniciproducens MBEL55E]
          Length = 166

 Score =  170 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVALHE-GTLQHPVKGIHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|260914663|ref|ZP_05921129.1| 30S ribosomal protein S5 [Pasteurella dagmatis ATCC 43325]
 gi|260631262|gb|EEX49447.1| 30S ribosomal protein S5 [Pasteurella dagmatis ATCC 43325]
          Length = 166

 Score =  170 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPIKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|146278551|ref|YP_001168710.1| 30S ribosomal protein S5 [Rhodobacter sphaeroides ATCC 17025]
 gi|189045432|sp|A4WVJ1|RS5_RHOS5 RecName: Full=30S ribosomal protein S5
 gi|145556792|gb|ABP71405.1| SSU ribosomal protein S5P [Rhodobacter sphaeroides ATCC 17025]
          Length = 187

 Score =  170 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 102/187 (54%), Positives = 131/187 (70%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA++E  +        E      DR+VAINRVS  + GG+RF F+ LVVVGD + +VGF 
Sbjct: 1   MAERENRRDRRDDRSREETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V+L DGRTLHHD  GRHGAGKV+MR+A+ GTG+IAG
Sbjct: 61  KGKAKEVPEAIRKATEQAKRQMIRVALRDGRTLHHDQEGRHGAGKVVMRAAVPGTGIIAG 120

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E+LG+ DVVAKS+GS NP+N+IRAT + L+ +S PR VA RRG K + +  + 
Sbjct: 121 GPMRAVFEMLGIQDVVAKSMGSQNPYNMIRATMDGLKRESSPRQVAQRRGKKVAEILKKP 180

Query: 181 VVSSKSS 187
                 +
Sbjct: 181 EAEVAEA 187


>gi|262197171|ref|YP_003268380.1| ribosomal protein S5 [Haliangium ochraceum DSM 14365]
 gi|262080518|gb|ACY16487.1| ribosomal protein S5 [Haliangium ochraceum DSM 14365]
          Length = 166

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 77/162 (47%), Positives = 102/162 (62%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           E    +VDR+V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  E
Sbjct: 6   EEVGELVDRVVYINRVAKVVKGGRRFSFSALVVVGDQNGYVGAGLGKANEVPEAIRKGNE 65

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AKRN+  + +++  T+ H+ +G  GA +V+++ A  GTGVIAGGA+R V EV G+ DV+
Sbjct: 66  QAKRNLFRIPMIE-GTIPHEVMGVFGAARVLLKPASPGTGVIAGGAVRPVLEVAGITDVL 124

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            KSIGS+N HNVI AT   L+       VA  RG     ++ 
Sbjct: 125 TKSIGSANKHNVIHATVVALKDLRSAEQVARVRGKSVEQIRG 166


>gi|213962851|ref|ZP_03391111.1| ribosomal protein S5 [Capnocytophaga sputigena Capno]
 gi|213954508|gb|EEB65830.1| ribosomal protein S5 [Capnocytophaga sputigena Capno]
          Length = 174

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 77/177 (43%), Positives = 110/177 (62%), Gaps = 5/177 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           M QK +    N +  +     + DR+V + RV+    GGR F FS +VVVGD    VG  
Sbjct: 1   MYQKYK----NVEYVKPSGLELKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGHG 56

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              ++EV EA+ KA E AK+N++ + L +G TL H+  G++G  +V ++ A  GTGVIAG
Sbjct: 57  LGKSKEVSEAIAKAVEDAKKNLVRIPL-NGTTLPHEQKGKYGGARVFLQPATDGTGVIAG 115

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GA+RAV E +G+H+V++KS GSSNPHNV++ATF+ L      + VA +RGI    L 
Sbjct: 116 GAVRAVLESVGIHNVLSKSQGSSNPHNVVKATFDALLQLRSAKTVAAQRGISLEKLF 172


>gi|197303829|ref|ZP_03168865.1| hypothetical protein RUMLAC_02568 [Ruminococcus lactaris ATCC
           29176]
 gi|197297122|gb|EDY31686.1| hypothetical protein RUMLAC_02568 [Ruminococcus lactaris ATCC
           29176]
          Length = 169

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 70/168 (41%), Positives = 100/168 (59%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     ++D++V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   RQERIDASQLELLDKLVSIKRVTKVVKGGRNMRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA E A + MISVSL +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKAKEDAMKKMISVSLDENASVTHDVIGKFGSASVLLKKAPEGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E LR    P DVA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIEGLRGVKTPEDVARLRGKSVEEILG 169


>gi|146308906|ref|YP_001189371.1| 30S ribosomal protein S5 [Pseudomonas mendocina ymp]
 gi|172046041|sp|A4XZ73|RS5_PSEMY RecName: Full=30S ribosomal protein S5
 gi|145577107|gb|ABP86639.1| SSU ribosomal protein S5P [Pseudomonas mendocina ymp]
          Length = 166

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 79/164 (48%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYPIKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            +V+AK  GS+NP NV+ ATF+ L++   P  VA +RG     +
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKTMQSPESVAAKRGKSVEEI 165


>gi|291549402|emb|CBL25664.1| SSU ribosomal protein S5P [Ruminococcus torques L2-14]
          Length = 169

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 69/168 (41%), Positives = 100/168 (59%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     +V+++V+I RV+  + GGR F F+ LVVVGD    VG     A E+PEA
Sbjct: 2   RQERIDASQMELVEKVVSIKRVTKVVKGGRNFRFTALVVVGDGNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + MISVSL +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E  
Sbjct: 62  IRKGKEDAMKKMISVSLDENSSVTHDVIGKFGSASVLLKKAPEGTGVIAGGPARAVIEAA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E L++   P DVA  RG     +  
Sbjct: 122 GVKNIRTKSLGSNNKQNVVLATIEGLKAVKTPEDVARLRGKSIEEILG 169


>gi|46143638|ref|ZP_00204534.1| COG0098: Ribosomal protein S5 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209240|ref|YP_001054465.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae L20]
 gi|165977213|ref|YP_001652806.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190151131|ref|YP_001969656.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|303250029|ref|ZP_07336231.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|303253203|ref|ZP_07339352.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307246706|ref|ZP_07528776.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307248847|ref|ZP_07530860.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|307251075|ref|ZP_07532999.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307253461|ref|ZP_07535332.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307255691|ref|ZP_07537495.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307257875|ref|ZP_07539631.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260143|ref|ZP_07541853.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262271|ref|ZP_07543920.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307264480|ref|ZP_07546065.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|171855099|sp|A3N374|RS5_ACTP2 RecName: Full=30S ribosomal protein S5
 gi|126098032|gb|ABN74860.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165877314|gb|ABY70362.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|189916262|gb|ACE62514.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|302647885|gb|EFL78092.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302651092|gb|EFL81246.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306852406|gb|EFM84641.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306854774|gb|EFM86964.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|306856905|gb|EFM89037.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306859140|gb|EFM91182.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306861368|gb|EFM93358.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306863605|gb|EFM95532.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306865789|gb|EFM97667.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868034|gb|EFM99861.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870177|gb|EFN01936.1| 30S ribosomal protein S5 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 166

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGSHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVEEILG 166


>gi|91977635|ref|YP_570294.1| 30S ribosomal protein S5 [Rhodopseudomonas palustris BisB5]
 gi|123735292|sp|Q134U6|RS5_RHOPS RecName: Full=30S ribosomal protein S5
 gi|91684091|gb|ABE40393.1| SSU ribosomal protein S5P [Rhodopseudomonas palustris BisB5]
          Length = 191

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 103/160 (64%), Positives = 127/160 (79%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GG+RF F+ LVV+GD K +VGF H  AREVPEA+RKATEAAKRN
Sbjct: 23  FVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFGHGKAREVPEAIRKATEAAKRN 82

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKSIG
Sbjct: 83  LTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIQDVVAKSIG 142

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           SSNP+N++RATF+ L+    PR VA RR IK S LQ+RRV
Sbjct: 143 SSNPYNMVRATFDALKHLDSPRAVAARRNIKVSTLQSRRV 182


>gi|295398305|ref|ZP_06808347.1| 30S ribosomal protein S5 [Aerococcus viridans ATCC 11563]
 gi|294973444|gb|EFG49229.1| 30S ribosomal protein S5 [Aerococcus viridans ATCC 11563]
          Length = 170

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 71/169 (42%), Positives = 106/169 (62%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           + +Q     +N + +R+VAINRV+  + GGRR  F  +VVVGD    VG     A EVPE
Sbjct: 3   NTFQELNINENDLEERVVAINRVAKTVKGGRRMNFGAVVVVGDRNGHVGLGTGKAAEVPE 62

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+RKA E  K+N+I++    G T+ H+ +G+   G V+++ A AG+G+ AGG +RAV E+
Sbjct: 63  AIRKAVEDGKKNLITIPRA-GSTVPHEVIGKFNGGHVLLKPAQAGSGIAAGGPVRAVVEL 121

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G+ D+ +KS+GS++P N++RAT E ++S   P DVA  RG     L  
Sbjct: 122 GGIADITSKSLGSNSPINIVRATLEAIKSLKSPEDVAALRGKSVEELLG 170


>gi|15676086|ref|NP_273217.1| 30S ribosomal protein S5 [Neisseria meningitidis MC58]
 gi|59802143|ref|YP_208855.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae FA 1090]
 gi|121634033|ref|YP_974278.1| 30S ribosomal protein S5 [Neisseria meningitidis FAM18]
 gi|161870900|ref|YP_001600078.1| 30S ribosomal protein S5 [Neisseria meningitidis 053442]
 gi|218767151|ref|YP_002341663.1| 30S ribosomal protein S5 [Neisseria meningitidis Z2491]
 gi|239997943|ref|ZP_04717867.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae 35/02]
 gi|240015079|ref|ZP_04721992.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae DGI18]
 gi|240017528|ref|ZP_04724068.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae FA6140]
 gi|240081671|ref|ZP_04726214.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae FA19]
 gi|240113949|ref|ZP_04728439.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae MS11]
 gi|240116683|ref|ZP_04730745.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae PID18]
 gi|240118905|ref|ZP_04732967.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae PID1]
 gi|240122151|ref|ZP_04735113.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae PID24-1]
 gi|240124443|ref|ZP_04737399.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae PID332]
 gi|240124688|ref|ZP_04737574.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae SK-92-679]
 gi|240129119|ref|ZP_04741780.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494704|ref|ZP_05107875.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae 1291]
 gi|254805797|ref|YP_003084018.1| 30S ribosomal protein S5 [Neisseria meningitidis alpha14]
 gi|260439558|ref|ZP_05793374.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae DGI2]
 gi|268593793|ref|ZP_06127960.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae 35/02]
 gi|268597768|ref|ZP_06131935.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae FA19]
 gi|268600013|ref|ZP_06134180.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae MS11]
 gi|268602351|ref|ZP_06136518.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae PID18]
 gi|268604614|ref|ZP_06138781.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae PID1]
 gi|268683072|ref|ZP_06149934.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae PID332]
 gi|268683262|ref|ZP_06150124.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae SK-92-679]
 gi|268687502|ref|ZP_06154364.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042794|ref|ZP_06568535.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae DGI2]
 gi|293398185|ref|ZP_06642390.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae F62]
 gi|296313382|ref|ZP_06863323.1| ribosomal protein S5 [Neisseria polysaccharea ATCC 43768]
 gi|304388960|ref|ZP_07371007.1| 30S ribosomal protein S5 [Neisseria meningitidis ATCC 13091]
 gi|54039518|sp|P66577|RS5_NEIMB RecName: Full=30S ribosomal protein S5
 gi|54041969|sp|P66576|RS5_NEIMA RecName: Full=30S ribosomal protein S5
 gi|73919078|sp|Q5F5U4|RS5_NEIG1 RecName: Full=30S ribosomal protein S5
 gi|171704467|sp|A1KRJ0|RS5_NEIMF RecName: Full=30S ribosomal protein S5
 gi|226703365|sp|A9M3U9|RS5_NEIM0 RecName: Full=30S ribosomal protein S5
 gi|7225377|gb|AAF40617.1| 30s ribosomal protein S5 [Neisseria meningitidis MC58]
 gi|59719038|gb|AAW90443.1| putative 30S ribosomal protein S5 [Neisseria gonorrhoeae FA 1090]
 gi|120865739|emb|CAM09468.1| 30S ribosomal protein S5 [Neisseria meningitidis FAM18]
 gi|121051159|emb|CAM07430.1| 30S ribosomal protein S5 [Neisseria meningitidis Z2491]
 gi|161596453|gb|ABX74113.1| 30S ribosomal protein S5 [Neisseria meningitidis 053442]
 gi|226513744|gb|EEH63089.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae 1291]
 gi|254669339|emb|CBA08396.1| 30S ribosomal protein S5 [Neisseria meningitidis alpha14]
 gi|254670757|emb|CBA07020.1| 30S ribosomal protein S5 [Neisseria meningitidis alpha153]
 gi|254672687|emb|CBA06573.1| 30S ribosomal protein S5 [Neisseria meningitidis alpha275]
 gi|261391695|emb|CAX49144.1| 30S ribosomal protein S5 [Neisseria meningitidis 8013]
 gi|268547182|gb|EEZ42600.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae 35/02]
 gi|268551556|gb|EEZ46575.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae FA19]
 gi|268584144|gb|EEZ48820.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae MS11]
 gi|268586482|gb|EEZ51158.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae PID18]
 gi|268588745|gb|EEZ53421.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae PID1]
 gi|268623356|gb|EEZ55756.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae PID332]
 gi|268623546|gb|EEZ55946.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae SK-92-679]
 gi|268627786|gb|EEZ60186.1| 30s ribosomal protein S5 [Neisseria gonorrhoeae SK-93-1035]
 gi|291013228|gb|EFE05194.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae DGI2]
 gi|291611448|gb|EFF40518.1| 30S ribosomal protein S5 [Neisseria gonorrhoeae F62]
 gi|296840093|gb|EFH24031.1| ribosomal protein S5 [Neisseria polysaccharea ATCC 43768]
 gi|304337094|gb|EFM03281.1| 30S ribosomal protein S5 [Neisseria meningitidis ATCC 13091]
 gi|308388375|gb|ADO30695.1| 30S ribosomal protein S5 [Neisseria meningitidis alpha710]
 gi|312205711|gb|ADQ48072.1| 30S subunit ribosomal protein S5 [Neisseria gonorrhoeae]
 gi|312205715|gb|ADQ48074.1| 30S subunit ribosomal protein S5 [Neisseria gonorrhoeae]
 gi|319411357|emb|CBY91768.1| 30S ribosomal protein S5 [Neisseria meningitidis WUE 2594]
 gi|325129078|gb|EGC51927.1| ribosomal protein S5 [Neisseria meningitidis N1568]
 gi|325133071|gb|EGC55743.1| ribosomal protein S5 [Neisseria meningitidis M6190]
 gi|325135165|gb|EGC57791.1| ribosomal protein S5 [Neisseria meningitidis M13399]
 gi|325137217|gb|EGC59812.1| ribosomal protein S5 [Neisseria meningitidis M0579]
 gi|325139049|gb|EGC61595.1| ribosomal protein S5 [Neisseria meningitidis ES14902]
 gi|325143249|gb|EGC65588.1| ribosomal protein S5 [Neisseria meningitidis 961-5945]
 gi|325145356|gb|EGC67633.1| ribosomal protein S5 [Neisseria meningitidis M01-240013]
 gi|325197446|gb|ADY92902.1| ribosomal protein S5 [Neisseria meningitidis G2136]
 gi|325199372|gb|ADY94827.1| ribosomal protein S5 [Neisseria meningitidis H44/76]
 gi|325203006|gb|ADY98460.1| ribosomal protein S5 [Neisseria meningitidis M01-240149]
 gi|325203279|gb|ADY98732.1| ribosomal protein S5 [Neisseria meningitidis M01-240355]
 gi|325205252|gb|ADZ00705.1| ribosomal protein S5 [Neisseria meningitidis M04-240196]
 gi|325207196|gb|ADZ02648.1| ribosomal protein S5 [Neisseria meningitidis NZ-05/33]
          Length = 172

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 71/167 (42%), Positives = 109/167 (65%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               EER + +++++VA+NRV+  + GGR  AFS L VVGD   ++G     ++EVP AV
Sbjct: 3   KHEIEERGDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGDGDGRIGMGKGKSKEVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+R+MI V L +  T+HH+ +GRHGA KV M+ A  G+GV AGG +R V + +G
Sbjct: 63  QKAMDQARRSMIKVPLKN-GTIHHEVIGRHGATKVFMQPAKEGSGVKAGGPMRLVFDAMG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +H++ AK  GS+NP+N++RAT + L     P D+A +RG+    +  
Sbjct: 122 IHNISAKVHGSTNPYNIVRATLDGLSKLHTPADIAAKRGLTVEDILG 168


>gi|289550160|ref|YP_003471064.1| SSU ribosomal protein S5p (S2e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315659210|ref|ZP_07912074.1| 30S ribosomal protein S5 [Staphylococcus lugdunensis M23590]
 gi|289179692|gb|ADC86937.1| SSU ribosomal protein S5p (S2e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315495635|gb|EFU83966.1| 30S ribosomal protein S5 [Staphylococcus lugdunensis M23590]
          Length = 166

 Score =  170 bits (431), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 73/152 (48%), Positives = 103/152 (67%), Gaps = 1/152 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD K +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKKGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            N++RAT   L++  +  DVA  RG     L 
Sbjct: 134 INMVRATINGLQNLKNAEDVAKLRGKTVEELY 165


>gi|308272962|emb|CBX29566.1| 30S ribosomal protein S5 [uncultured Desulfobacterium sp.]
          Length = 174

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 80/176 (45%), Positives = 118/176 (67%), Gaps = 2/176 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           M+ K    R  ++ RE  +N ++D++V INRV+  + GGRRF+FS +VVVGD +  VG+ 
Sbjct: 1   MSNKNYGGRALFK-REVGENQLIDKVVYINRVAKVVKGGRRFSFSAIVVVGDGEGSVGYG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A EVPEA+RK  + AK+NM++VSL+D  T+  + +G+ GAG+V+++ A  GTG+IAG
Sbjct: 60  LGKAGEVPEAIRKGVDQAKKNMVNVSLVD-GTIPFEVIGKFGAGRVLLKPASKGTGLIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           GA+RAV E +G+ +V+ K +GS NPHNV++AT   L+       VA RRG     L
Sbjct: 119 GAVRAVLEAVGVQNVLTKCMGSHNPHNVVKATISGLKKLQSREQVAERRGKTVEEL 174


>gi|238021608|ref|ZP_04602034.1| hypothetical protein GCWU000324_01508 [Kingella oralis ATCC 51147]
 gi|237866222|gb|EEP67264.1| hypothetical protein GCWU000324_01508 [Kingella oralis ATCC 51147]
          Length = 170

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 66/167 (39%), Positives = 110/167 (65%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               EER++ +++++VA+NRV+  + GGR  AFS L VVG+   ++G     +REVP AV
Sbjct: 3   KHEIEERNDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGNGDGQIGMGKGKSREVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+R+M+ + L +  T++H+ +G+HGA KV ++ A  G+G+ AGG +R V EV+G
Sbjct: 63  QKAMDQARRSMVKIPLKN-GTIYHEVLGKHGATKVFIQPAKEGSGIKAGGPMRLVFEVMG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +H++ AK  GS+NP+N++RAT   L     P ++A +RG+    +  
Sbjct: 122 VHNISAKVHGSTNPYNIVRATLNGLAQLYTPSEIAAKRGLTVEEILG 168


>gi|304315957|ref|YP_003851102.1| ribosomal protein S5 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302777459|gb|ADL68018.1| ribosomal protein S5 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 167

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 105/166 (63%), Gaps = 2/166 (1%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGD-TKSKVGFAHSTAREVPEAVR 72
             +  +  + +++V++NRV+  + GGR F FS  VVVGD  K  VG     + E+PEA+R
Sbjct: 3   RIDISNLDLKEKVVSLNRVAKVVKGGRNFRFSATVVVGDPEKGYVGVGTGKSAEIPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+++I V ++ G T+ HD +G  GAGKV+++ A  GTGVIAGG +RAV E  G+
Sbjct: 63  KAVEDAKKHLIKVPVV-GTTIPHDTIGVFGAGKVLLKPAKEGTGVIAGGPVRAVLESAGI 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GS+N  N++ AT E L+S     +VA  RGI    L  
Sbjct: 122 KDILTKSLGSANSTNMVYATIEGLKSLKTAEEVAKLRGIPVEQLLG 167


>gi|300742041|ref|ZP_07072062.1| ribosomal protein S5 [Rothia dentocariosa M567]
 gi|311111955|ref|YP_003983177.1| 30S ribosomal protein S5 [Rothia dentocariosa ATCC 17931]
 gi|300381226|gb|EFJ77788.1| ribosomal protein S5 [Rothia dentocariosa M567]
 gi|310943449|gb|ADP39743.1| 30S ribosomal protein S5 [Rothia dentocariosa ATCC 17931]
          Length = 223

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 77/169 (45%), Positives = 105/169 (62%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
              + REE  +  ++R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  A+EVP 
Sbjct: 42  RKNRAREEEKDKYIERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPA 101

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ K  E AK+N   V  ++ RT+ H   G   AG V++R A AGTGVIAGG +RAV E 
Sbjct: 102 AIAKGVEEAKKNFFRVPRIENRTIPHRVQGEEAAGVVMLRPATAGTGVIAGGPVRAVLEA 161

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G+HDV++KS+GSSN  N++ AT   L+    P  VA RRG+ +  +  
Sbjct: 162 AGIHDVLSKSLGSSNQINIVHATVAALKQLEEPLAVAARRGLPNDEVIP 210


>gi|169830453|ref|YP_001716435.1| ribosomal protein S5 [Candidatus Desulforudis audaxviator MP104C]
 gi|169637297|gb|ACA58803.1| ribosomal protein S5 [Candidatus Desulforudis audaxviator MP104C]
          Length = 168

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 76/164 (46%), Positives = 106/164 (64%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     I +++V INR +  + GGRRF+FS LVVVGD    VGF    A EVPEA+RK
Sbjct: 3   RIDASKMEISEKVVFINRCAKVVKGGRRFSFSALVVVGDGAGHVGFGLGKATEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E  K+N+I V L  G T+ H+ +GR+GAGKV++R A  GTGVIAGG +RAV E+ G+ 
Sbjct: 63  GIEDGKKNLIQVPLA-GTTITHEVLGRYGAGKVLLRPASPGTGVIAGGPVRAVLELAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D++ KS+GS+N +N++RAT + L+      +VA  RG     L+
Sbjct: 122 DILTKSLGSNNANNMVRATIDALKQLKTRDEVARNRGKDVKELR 165


>gi|158520742|ref|YP_001528612.1| ribosomal protein S5 [Desulfococcus oleovorans Hxd3]
 gi|158509568|gb|ABW66535.1| ribosomal protein S5 [Desulfococcus oleovorans Hxd3]
          Length = 165

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 72/164 (43%), Positives = 103/164 (62%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +   + ++  +D +V I RVS  + GGR+F FS +VVVGD    VG     A EVPEA+R
Sbjct: 3   KETNKEESQFIDNVVHIRRVSKVVKGGRKFRFSAVVVVGDGNGNVGCGLGKAHEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AKR+M+SV L++  T+    +GR GAG+V+++ A  GTG+IAGGA+RAV E  G+
Sbjct: 63  KGAEKAKRDMVSVPLVE-GTIPFKIIGRFGAGRVMLKPAARGTGLIAGGAVRAVLEAAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            D++ K +G+ N HNV++AT   L+       +A RRGI    L
Sbjct: 122 TDILTKCMGTHNSHNVVKATIRGLQQLQTRDQIAARRGIPVEEL 165


>gi|227497198|ref|ZP_03927446.1| ribosomal protein S5 [Actinomyces urogenitalis DSM 15434]
 gi|226833329|gb|EEH65712.1| ribosomal protein S5 [Actinomyces urogenitalis DSM 15434]
          Length = 237

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 72/172 (41%), Positives = 106/172 (61%), Gaps = 1/172 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            ++R+V INRVS  + GGRRF F+ LVVVGD +  VG  +  A+EVP A+ KA E AK+N
Sbjct: 50  YIERVVTINRVSKVVKGGRRFTFTALVVVGDGEGTVGVGYGKAKEVPAAIAKAVEIAKKN 109

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
              V ++  RT+ H   G   AG V++R A  GTGVIAGG +RAV +  G+HD+++KS+G
Sbjct: 110 FFHVPMIR-RTIPHLVQGEDSAGVVLLRPASPGTGVIAGGPVRAVLDCAGVHDILSKSLG 168

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           SSN  N++ AT   L+    P  VA RRG+    +  + ++ +++   +   
Sbjct: 169 SSNAINIVHATVTALKQLEQPEGVAARRGLPLEDVAPQSMLRARAEGEADKR 220


>gi|226305359|ref|YP_002765317.1| 30S ribosomal protein S5 [Rhodococcus erythropolis PR4]
 gi|229489361|ref|ZP_04383224.1| ribosomal protein S5 [Rhodococcus erythropolis SK121]
 gi|259495313|sp|C0ZW43|RS5_RHOE4 RecName: Full=30S ribosomal protein S5
 gi|226184474|dbj|BAH32578.1| 30S ribosomal protein S5 [Rhodococcus erythropolis PR4]
 gi|229323458|gb|EEN89216.1| ribosomal protein S5 [Rhodococcus erythropolis SK121]
          Length = 223

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 68/173 (39%), Positives = 105/173 (60%), Gaps = 1/173 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             +  ++R+V INRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A++K  E 
Sbjct: 49  EKSQFIERVVTINRVSKVVKGGRRFSFTALVIVGDGNGLVGVGYGKAKEVPAAIQKGVEE 108

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A+++   V ++   T+ H   G   AG V++R A  GTGVIAGGA+RAV E  G+ D+++
Sbjct: 109 ARKSFFRVPMI-ANTITHPVQGEAAAGIVMLRPASPGTGVIAGGAVRAVLECAGIADILS 167

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           KS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ +++ +  
Sbjct: 168 KSLGSDNAINVVHATVAALKGLQRPEEVAARRGLTLEEVAPAGMLRARAQAAG 220


>gi|163752649|ref|ZP_02159821.1| ribosomal protein S5 [Shewanella benthica KT99]
 gi|161327463|gb|EDP98677.1| ribosomal protein S5 [Shewanella benthica KT99]
          Length = 167

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +   ++ + + +++VA+NRVS  + GGR F+F+ L VVGD   KVGF +  AREVP A++
Sbjct: 3   KFEAQQKDDLQEKLVAVNRVSKVVKGGRIFSFTALTVVGDGNGKVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RN++SV L++  TLHH   GRH   +V M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNIVSVELIN-GTLHHPVKGRHTGSRVYMQPASDGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +V++K+ GS+NP NV+RAT   L     P  +A +RG+  + ++ 
Sbjct: 122 RNVLSKTYGSTNPINVVRATVNALVLMKSPAQIAAKRGLNVNEIRG 167


>gi|170017927|ref|YP_001728846.1| ribosomal protein S5 [Leuconostoc citreum KM20]
 gi|169804784|gb|ACA83402.1| Ribosomal protein S5 [Leuconostoc citreum KM20]
          Length = 168

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 102/158 (64%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + + +VAINRV+  + GGRR  F+ LVVVGD +  VGF    A+EVPEA+RKA E AKR
Sbjct: 12  ELEENVVAINRVTKVVKGGRRLRFAALVVVGDKQGHVGFGTGKAQEVPEAIRKAIEDAKR 71

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
            +I+V  +   T+ HD +G  G GK++++ A  G+GV AGGA R+V E+ G+ DV AKS+
Sbjct: 72  KLITVPTV-STTIPHDVLGVWGGGKILIKPAEEGSGVAAGGAARSVMELAGIADVTAKSL 130

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+ P NV+RATF+ L S      VA  RG+    L  
Sbjct: 131 GSATPVNVVRATFDALTSLKDAEQVAALRGVSLEHLAE 168


>gi|254281893|ref|ZP_04956861.1| ribosomal protein S5 [gamma proteobacterium NOR51-B]
 gi|219678096|gb|EED34445.1| ribosomal protein S5 [gamma proteobacterium NOR51-B]
          Length = 171

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 76/169 (44%), Positives = 112/169 (66%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           ++ +  ++ +  + +++V +NRV+  + GGR  +F+ L VVGD K +VG+    AREVP 
Sbjct: 4   NDQKRGQQTEGDLQEKLVQVNRVAKTVKGGRIMSFTALTVVGDGKGRVGYGRGKAREVPV 63

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++KA EAA+RNMI V L+D  TL +     HGA KV M+ A  GTGVIAGGA+R+V E+
Sbjct: 64  AIQKAMEAARRNMIKVELVD-GTLQYPVRANHGASKVYMQPASEGTGVIAGGAMRSVLEL 122

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G+H+V+AK  GS+NP NV+RAT+  LR  + P  VA +RG     + +
Sbjct: 123 AGVHNVLAKCYGSTNPVNVVRATYNGLRDMTSPDAVAAKRGKTVEEILS 171


>gi|297717890|gb|ADI50088.1| SSU ribosomal protein S5p [Candidatus Odyssella thessalonicensis
           L13]
          Length = 180

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 86/175 (49%), Positives = 125/175 (71%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           ++    ++  +   ++++V++ RV+  + GG+   FS LVVVGD K +VGF    AREVP
Sbjct: 3   KNTNTEKQREEVEYIEKLVSVRRVTKVVKGGKNLRFSALVVVGDGKGRVGFGSGKAREVP 62

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           +AVRKA+E A+R+MI V L +GRT+HHD  G  GAG+V +R+A AGTG+IAGG +RAV E
Sbjct: 63  DAVRKASEQARRSMIRVPLREGRTIHHDLTGHFGAGRVYLRAAPAGTGIIAGGPMRAVFE 122

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
            LG+ DVV+KS+G+SN +N++RATF+ L + + PRDVA++ G K   + ARR  S
Sbjct: 123 SLGIQDVVSKSVGTSNYYNMVRATFDALTNVASPRDVASKLGRKIPEIVARRDAS 177


>gi|291518030|emb|CBK73251.1| SSU ribosomal protein S5P [Butyrivibrio fibrisolvens 16/4]
          Length = 169

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 67/168 (39%), Positives = 97/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   KREIIDASQLELTEQVVEIKRVTKVVKGGRNMRFTALVVVGDKNGHVGAGLGKAAEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +I+V L D  ++ HD  G+H    V+++ A  GTG+IAGG  RAVCE+ 
Sbjct: 62  IRKGKEDAMKKLITVKLDDNHSITHDIQGKHTGASVLLKKAPEGTGIIAGGPARAVCELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GSSN  NV+ AT E L+    P +VA  RG K   + A
Sbjct: 122 GIGNIRTKSLGSSNKQNVVLATIEGLKLLKSPEEVAKARGKKVEDILA 169


>gi|110833275|ref|YP_692134.1| 30S ribosomal protein S5 [Alcanivorax borkumensis SK2]
 gi|123050730|sp|Q0VSI6|RS5_ALCBS RecName: Full=30S ribosomal protein S5
 gi|110646386|emb|CAL15862.1| 30S ribosomal protein S5 [Alcanivorax borkumensis SK2]
          Length = 167

 Score =  170 bits (431), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 82/160 (51%), Positives = 108/160 (67%), Gaps = 1/160 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           + +  + +++V +NRV+  + GGR F F+ L VVGD K KVGF    AREVP A++KA E
Sbjct: 7   DPNEGLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGKGKVGFGRGKAREVPAAIQKALE 66

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
           AA+RNMI V L +G T+ H    RHGA KV M+ A  GTGVIAGGA+RAV EV G+ +V+
Sbjct: 67  AARRNMIQVEL-NGTTIQHPMKARHGASKVYMQPADEGTGVIAGGAMRAVLEVAGVQNVL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           AK  GS+NP NV+RATF  L+S + P  VA +RG     +
Sbjct: 126 AKCYGSTNPVNVVRATFNGLKSMASPESVAAKRGKSVDEI 165


>gi|27904925|ref|NP_778051.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|27904323|gb|AAO27156.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 185

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 102/163 (62%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
                 + ++++++NRVS  + GGR F+FS L VVGD   KVGF +  AREVP A++KA 
Sbjct: 20  RNVSGDLKEKLISVNRVSKTVKGGRIFSFSALTVVGDGHGKVGFGYGKAREVPSAIQKAM 79

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI V L +  TL +   G +    + M+ A  GTG+IAGGA+R+V EV G+H+V
Sbjct: 80  EKARRNMIQVPL-NNGTLQYSVTGSYTGSYIFMKPASNGTGIIAGGAMRSVLEVAGVHNV 138

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT  VL S   P  +A +R      +  
Sbjct: 139 LAKTYGSTNPINVVRATMLVLESMKSPEMIALKRNKLVKEILE 181


>gi|282882493|ref|ZP_06291114.1| ribosomal protein S5 [Peptoniphilus lacrimalis 315-B]
 gi|300814676|ref|ZP_07094927.1| ribosomal protein S5 [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|281297635|gb|EFA90110.1| ribosomal protein S5 [Peptoniphilus lacrimalis 315-B]
 gi|300511295|gb|EFK38544.1| ribosomal protein S5 [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 168

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 99/168 (58%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                   +  + D++V+INRV+  + GGR F FS LVVVGD    VG     A EVPEA
Sbjct: 2   ERSLINAAELDLEDKVVSINRVAKVVKGGRNFRFSALVVVGDHNGHVGVGTGKALEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKAT+ AK+++I V+LL   ++ H  +G  GAG+V ++ A  GTGVIAGGA+RAVCE+ 
Sbjct: 62  IRKATQDAKKHIIKVNLLK-TSIPHMVIGEFGAGRVFLKPAHEGTGVIAGGAVRAVCELC 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ D+  K+ GS+N  N + AT E L+       VA  R      +  
Sbjct: 121 GITDIRTKNQGSNNARNTVNATIEALKKLKTAESVAKLRNKSVDEILG 168


>gi|167771250|ref|ZP_02443303.1| hypothetical protein ANACOL_02608 [Anaerotruncus colihominis DSM
           17241]
 gi|167666501|gb|EDS10631.1| hypothetical protein ANACOL_02608 [Anaerotruncus colihominis DSM
           17241]
          Length = 179

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 70/163 (42%), Positives = 100/163 (61%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +  +  + +R+V+INRVS  + GGR F F+ LVVVGD    VGF    A EVP+A+RK  
Sbjct: 18  DAANLELKERVVSINRVSKTVKGGRIFKFAALVVVGDGNGTVGFGLGKAGEVPDAIRKGI 77

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N+  ++L  G T+ H+ +G +GAG+V+M+ A  GTGVIAGG +RAV E  G+ D+
Sbjct: 78  EDAKKNLHKIAL-KGTTIPHEIIGAYGAGRVLMKPAPEGTGVIAGGPVRAVLETAGIKDI 136

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
             K + S+NP NV+ AT + L +      VA  RG     +  
Sbjct: 137 RTKCLRSNNPCNVVSATIQGLCALRDAEKVAAIRGKSVKDIIG 179


>gi|83648835|ref|YP_437270.1| 30S ribosomal protein S5 [Hahella chejuensis KCTC 2396]
 gi|123530601|sp|Q2S929|RS5_HAHCH RecName: Full=30S ribosomal protein S5
 gi|83636878|gb|ABC32845.1| ribosomal protein S5 [Hahella chejuensis KCTC 2396]
          Length = 167

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N +++   + +++V +NRV+  + GGR F F+ L VVGD   KVGF    AREVP A++
Sbjct: 3   NNEQQKGAELQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGNGKVGFGRGKAREVPVAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA +AA++NMI+V+L +G TL +    RHG+ KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMDAARKNMITVTL-NGNTLQYPVKARHGSAKVFMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +V+AK  GS+NP NV+RATFE L++   P ++A +RG     +  
Sbjct: 122 QNVLAKCYGSTNPVNVVRATFEGLKAMQAPEEIAAKRGKTVEEILG 167


>gi|88861477|ref|ZP_01136103.1| 30S ribosomal subunit protein S5 [Pseudoalteromonas tunicata D2]
 gi|88816525|gb|EAR26354.1| 30S ribosomal subunit protein S5 [Pseudoalteromonas tunicata D2]
          Length = 168

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 110/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++ + + +++VA+NRVS  + GGR F+F+ L VVGD   KVGF +  A EVP A++K
Sbjct: 5   EAKQQQSDLAEKLVAVNRVSKVVKGGRIFSFTALTVVGDGAGKVGFGYGKALEVPAAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V L +G TL H   GRH    V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 65  AMEKARRNMINVDL-NGNTLQHPVKGRHAGSLVFMKPASEGTGIIAGGAMRAVLEVAGVH 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K  GS+NP NV+RAT   L + + P  VA +RG+    ++ 
Sbjct: 124 NVLSKCYGSTNPINVVRATISALENMTSPAKVAAKRGLSVEQIKG 168


>gi|197122356|ref|YP_002134307.1| 30S ribosomal protein S5 [Anaeromyxobacter sp. K]
 gi|220917138|ref|YP_002492442.1| ribosomal protein S5 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196172205|gb|ACG73178.1| ribosomal protein S5 [Anaeromyxobacter sp. K]
 gi|219954992|gb|ACL65376.1| ribosomal protein S5 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 169

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 103/164 (62%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
              +  + DR+V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 7   NANELELQDRVVHINRVAKVVKGGRRFSFSALVVVGDGAGHVGVGLGKANEVPEAIRKGG 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           + AK+N+  V L+ G T+ H+ +G  G+G+V+++ A  GTGVIAGGA+RAV E  G+ +V
Sbjct: 67  DQAKKNLFKVPLV-GTTIPHEVLGHFGSGRVLLKPAGEGTGVIAGGAVRAVLEAAGVRNV 125

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           + KS GS NPHNV++AT   L+      D A  RG + + +   
Sbjct: 126 LTKSQGSRNPHNVLKATVAGLKRLRSIEDSARLRGKQAAEITGA 169


>gi|143575|gb|AAB59115.1| spc ORF1; S5 [Bacillus subtilis]
          Length = 165

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 106/166 (63%), Gaps = 4/166 (2%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + +R+V +NRV+    GGRRF F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 4   RRIDPSKLELEERLVTVNRVAK---GGRRFRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 60

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I V ++ G T+ H+ +GR GAG ++++ A  GTGVIAGG +RAV E+ G+
Sbjct: 61  KAVEDAKKNLIEVPMV-GTTIPHEIIGRFGAGNILLKPASEGTGVIAGGPVRAVLELAGV 119

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D+++KS+GS+ P N+IRAT + L       DVA  RG     L  
Sbjct: 120 ADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVEELLG 165


>gi|197117340|ref|YP_002137767.1| 30S ribosomal protein S5 [Geobacter bemidjiensis Bem]
 gi|253701905|ref|YP_003023094.1| 30S ribosomal protein S5 [Geobacter sp. M21]
 gi|197086700|gb|ACH37971.1| ribosomal protein S5 [Geobacter bemidjiensis Bem]
 gi|251776755|gb|ACT19336.1| ribosomal protein S5 [Geobacter sp. M21]
          Length = 162

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/159 (47%), Positives = 105/159 (66%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                + ++ DR+V I+RV+  + GGRRF+FS LVVVGD    VG+    A EVPEA+RK
Sbjct: 3   KINASEMNLTDRVVHISRVAKVVKGGRRFSFSALVVVGDGNGCVGYGLGKANEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V ++ G+T+  + +G  GAGKV+M  A  GTGVIAGGA RAV E  G+H
Sbjct: 63  GVEQAKKNLIKVPIVAGQTIPFEILGCFGAGKVLMMPASPGTGVIAGGAARAVFESAGLH 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIK 172
           +++AK +GS+NPHNV++A F  L       ++  RRGI 
Sbjct: 123 NILAKCLGSNNPHNVVKAAFAGLSRLKTAEELMARRGIT 161


>gi|319897711|ref|YP_004135908.1| 30S ribosomal subunit protein s5 [Haemophilus influenzae F3031]
 gi|317433217|emb|CBY81592.1| 30S ribosomal subunit protein S5 [Haemophilus influenzae F3031]
          Length = 166

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQVGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+I+GGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGVHTGSRVFMQPASEGTGIISGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|225016268|ref|ZP_03705460.1| hypothetical protein CLOSTMETH_00171 [Clostridium methylpentosum
           DSM 5476]
 gi|224950943|gb|EEG32152.1| hypothetical protein CLOSTMETH_00171 [Clostridium methylpentosum
           DSM 5476]
          Length = 166

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +R+V+INRVS  + GGR F F+ LVVVGD    +GF    + EVP+A+RK
Sbjct: 3   RIDGSTLELQERVVSINRVSKTVKGGRIFKFAALVVVGDGNGTIGFGLGKSGEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ +SL  G ++ H+ VG +GAG+V+++ A  GTGVIAGG +RAV EV G+ 
Sbjct: 63  GIEDAKKNLVKISL-KGTSIPHEIVGAYGAGRVLLKPAPEGTGVIAGGPVRAVVEVAGIK 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+  K+I S+NP NV++AT + L S  + + VA  RG     +  
Sbjct: 122 DIRTKAIRSNNPCNVVKATIQGLTSLRNAQQVAELRGKTVKEILG 166


>gi|148554257|ref|YP_001261839.1| 30S ribosomal protein S5 [Sphingomonas wittichii RW1]
 gi|172048253|sp|A5V5Y5|RS5_SPHWW RecName: Full=30S ribosomal protein S5
 gi|148499447|gb|ABQ67701.1| SSU ribosomal protein S5P [Sphingomonas wittichii RW1]
          Length = 239

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 92/165 (55%), Positives = 122/165 (73%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           EE+   +++++V INRVS  + GG+RF F+ LVVVGD K + GF H  AREVPEA+ KAT
Sbjct: 59  EEQGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAREVPEAISKAT 118

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AAK+ M+ V L +GRTLHHDG G  GAG+V +R+A  GTG+IAGG +RA+ E LG+ DV
Sbjct: 119 AAAKKAMVRVPLREGRTLHHDGNGHFGAGRVTVRTAPPGTGIIAGGPMRAIFESLGVADV 178

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           V KS+G+SNP+N+IRATFE L+ Q+ P+ V+ RRG K + L  R 
Sbjct: 179 VTKSVGTSNPYNMIRATFEALKDQTSPKSVSQRRGKKIADLLGRG 223


>gi|258646035|ref|ZP_05733504.1| ribosomal protein S5 [Dialister invisus DSM 15470]
 gi|260403406|gb|EEW96953.1| ribosomal protein S5 [Dialister invisus DSM 15470]
          Length = 166

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/164 (44%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E++++ + + +V INRV+  + GGRRF+F+ +VVVGD K +VG     A EVPEA+RK
Sbjct: 3   RFEKQESDLQENVVFINRVAKVVKGGRRFSFAAVVVVGDGKGRVGAGLGKAAEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+NMI+V+L +  T+ H+ +G +GAGKVIMR A  GTG+ AGG +RAV  + G+ 
Sbjct: 63  GVEDAKKNMINVALKN-GTIPHESLGIYGAGKVIMRPAAEGTGIKAGGPVRAVLALAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +V+ KS+GSSNP N+++AT + +    + + VA  RG     + 
Sbjct: 122 NVLTKSLGSSNPINMVKATLDGMAKLENVQTVAALRGKTVDEIY 165


>gi|291533610|emb|CBL06723.1| SSU ribosomal protein S5P [Megamonas hypermegale ART12/1]
          Length = 166

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 104/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +     + +++V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK
Sbjct: 3   KIDANALELEEKVVYINRVAKVVKGGRRFSFSALVVVGDKNGHVGAGLGKASEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ VSL+D  T+ H+ +G  GAG+V+++ A  GTGVIAGG  RAV E+ G+ 
Sbjct: 63  GIEDAKKNLVEVSLVDK-TIPHESLGVFGAGRVLLKPAAKGTGVIAGGPARAVLELAGVG 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +++ KS+GSSNP+N++RAT + L        VA  RG     L  
Sbjct: 122 NILTKSLGSSNPNNMVRATIKGLEQLKKAELVAELRGKSVQELLG 166


>gi|254466509|ref|ZP_05079920.1| ribosomal protein S5 [Rhodobacterales bacterium Y4I]
 gi|206687417|gb|EDZ47899.1| ribosomal protein S5 [Rhodobacterales bacterium Y4I]
          Length = 189

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 98/161 (60%), Positives = 121/161 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RQMIRVPLKEGRTLHHDMAGRHGAGKVVMRTAPEGTGIIAGGPMRAVFEMLGIKDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           IGS NP+N+IRAT   L+ +  PR VA RRG K + + ++R
Sbjct: 138 IGSQNPYNMIRATLNGLQKEQSPRAVAQRRGKKVADILSKR 178


>gi|119947109|ref|YP_944789.1| 30S ribosomal protein S5 [Psychromonas ingrahamii 37]
 gi|171769181|sp|A1T0C5|RS5_PSYIN RecName: Full=30S ribosomal protein S5
 gi|119865713|gb|ABM05190.1| SSU ribosomal protein S5P [Psychromonas ingrahamii 37]
          Length = 167

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E +   + ++++A+NRV+  + GGR F+F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 4   KVESQTGDLNEKLIAVNRVAKVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 63

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RN+  V L  G TL H   GRH   KV M+ A  GTG+IAGGA+RAV EV+G+ 
Sbjct: 64  AMEKARRNIRDVQL-KGNTLQHPIKGRHSGSKVYMQPASEGTGIIAGGAMRAVLEVVGVQ 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L + + P  +A +RG+  + L  
Sbjct: 123 NVLSKAYGSTNPINVVRATLDALENMNSPEQIAAKRGLSVNELLG 167


>gi|154505152|ref|ZP_02041890.1| hypothetical protein RUMGNA_02665 [Ruminococcus gnavus ATCC 29149]
 gi|153794631|gb|EDN77051.1| hypothetical protein RUMGNA_02665 [Ruminococcus gnavus ATCC 29149]
          Length = 169

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 100/168 (59%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +  +  + +++V+I RV+  + GGR F F+ LVVVGD K  VG     A E+PEA
Sbjct: 2   RQERIDASNLELTEKVVSIKRVTKVVKGGRNFRFTALVVVGDGKGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+I V+L +  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAAKNLIKVALDENESITHDVIGKFGSASVLLKKAPEGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L+    P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIAGLKDVKTPEEVAKLRGKSVEEIVG 169


>gi|116617345|ref|YP_817716.1| SSU ribosomal protein S5P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227431325|ref|ZP_03913378.1| ribosomal protein S5 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|122272454|sp|Q03ZM9|RS5_LEUMM RecName: Full=30S ribosomal protein S5
 gi|116096192|gb|ABJ61343.1| SSU ribosomal protein S5P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227352918|gb|EEJ43091.1| ribosomal protein S5 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 168

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/158 (48%), Positives = 103/158 (65%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + + +VAINRV+  + GGRR  F+ LVVVGD +  VGF    A+EVPEA+RKA E AKR
Sbjct: 12  ELEENVVAINRVTKVVKGGRRLRFAALVVVGDKQGHVGFGTGKAQEVPEAIRKAIEDAKR 71

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
            +I+V  +   T+ HD +G  G GK++++ A  G+GV AGGA R+V E+ G+ DV AKS+
Sbjct: 72  KLITVPTV-STTIPHDVLGEWGGGKILVKPAEEGSGVAAGGAARSVMELAGIADVTAKSL 130

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+ P NVIRATF+ L S     +VA  RG+    L  
Sbjct: 131 GSATPINVIRATFDALTSLKDAEEVAKLRGVSLEHLAE 168


>gi|315652337|ref|ZP_07905329.1| 30S ribosomal protein S5 [Eubacterium saburreum DSM 3986]
 gi|315485460|gb|EFU75850.1| 30S ribosomal protein S5 [Eubacterium saburreum DSM 3986]
          Length = 169

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 66/168 (39%), Positives = 95/168 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             Q  +     + DR+V I RVS  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KRQIIDPSKLELNDRVVNIKRVSKTVKGGRTMKFSALVVVGDGNGHVGIGLGKAGEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA ++++ V + +  ++ HD  G+ G+  V+++ A  GTG+IAGG  RAV E+ 
Sbjct: 62  IRKGKEAATKSLVEVRIDENSSVPHDYTGKFGSASVLLKRAPEGTGIIAGGPARAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G  ++ +KS+GS+N  NV  AT   L +   P ++A  RG     + A
Sbjct: 122 GYKNIRSKSLGSNNKTNVCLATLAGLTALKTPEEIAKLRGKSVEEILA 169


>gi|92112571|ref|YP_572499.1| 30S ribosomal protein S5 [Chromohalobacter salexigens DSM 3043]
 gi|122420783|sp|Q1R0F8|RS5_CHRSD RecName: Full=30S ribosomal protein S5
 gi|91795661|gb|ABE57800.1| SSU ribosomal protein S5P [Chromohalobacter salexigens DSM 3043]
          Length = 166

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + +++V +NRV+  + GGR F F+ L VVGD   +VGF    AREVP A++K
Sbjct: 3   NNEQKGGDLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGSGRVGFGRGKAREVPVAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A + A+RNM+ VSL  G TL +    RHGA KV M+ A  GTG+IAGGA+R+V E+ G+H
Sbjct: 63  AMDQARRNMVKVSLS-GATLQYPVKARHGASKVFMQPASEGTGIIAGGAMRSVLELAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV+AK  GS+NP NV+RAT + L S   P D+A +RG+    +  
Sbjct: 122 DVLAKCYGSTNPVNVVRATIKGLASMQSPEDIAAKRGMSVEEIAG 166


>gi|15603263|ref|NP_246337.1| 30S ribosomal protein S5 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|26399486|sp|Q9CL47|RS5_PASMU RecName: Full=30S ribosomal protein S5
 gi|12721773|gb|AAK03482.1| RpS5 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 166

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPIKGAHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|259502548|ref|ZP_05745450.1| 30S ribosomal protein S5 [Lactobacillus antri DSM 16041]
 gi|312870487|ref|ZP_07730606.1| ribosomal protein S5 [Lactobacillus oris PB013-T2-3]
 gi|259169500|gb|EEW53995.1| 30S ribosomal protein S5 [Lactobacillus antri DSM 16041]
 gi|311093949|gb|EFQ52274.1| ribosomal protein S5 [Lactobacillus oris PB013-T2-3]
          Length = 167

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 70/163 (42%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D++VAINR++  + GGRR  F+ LV+VGD K  VGF    A+EVPEA+RKA 
Sbjct: 6   DPAKLDLDDQVVAINRITKVVKGGRRMRFAALVIVGDRKGHVGFGTGKAQEVPEAIRKAQ 65

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AA++N+I+V ++ G T+ H+ +G +G GK++++ A+ G+GV AGGA+R V ++ G+ DV
Sbjct: 66  AAAEKNLITVPIV-GTTIPHEVIGTYGGGKIMLKPAVEGSGVAAGGAVRNVMDLAGVADV 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +K +GS+ P +V+RATFE L+      +VA  RG+    L  
Sbjct: 125 TSKRLGSNTPISVVRATFEGLKQLKSADEVAKLRGVSVDHLAE 167


>gi|183981074|ref|YP_001849365.1| 30S ribosomal protein S5, RpsE [Mycobacterium marinum M]
 gi|226703364|sp|B2HCT8|RS5_MYCMM RecName: Full=30S ribosomal protein S5
 gi|183174400|gb|ACC39510.1| 30S ribosomal protein S5, RpsE [Mycobacterium marinum M]
          Length = 224

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/188 (40%), Positives = 111/188 (59%), Gaps = 7/188 (3%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
              ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E
Sbjct: 36  SDKSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVE 95

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A++    V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HD++
Sbjct: 96  EARKGFFRVPLI-GGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVHDIL 154

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS------ 190
           AKS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S +      
Sbjct: 155 AKSLGSDNAINVVHATVAALKMLQRPEEVAARRGLPIEDVAPAGMLKARRESEALAAAAV 214

Query: 191 RDSKNKGG 198
           R+++  G 
Sbjct: 215 REAQTSGA 222


>gi|90409405|ref|ZP_01217480.1| Ribosomal protein S5 [Psychromonas sp. CNPT3]
 gi|90309488|gb|EAS37698.1| Ribosomal protein S5 [Psychromonas sp. CNPT3]
          Length = 166

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E +   + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   KVESQAGDLNEKLIAVNRVSKVVKGGRIFSFTALTVVGDGSGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RN+  + L  G TL H   GRH   KV M+ A  GTG+IAGGA+RAV EV+G+ 
Sbjct: 63  AMEKARRNISEIQL-KGNTLQHPIKGRHSGSKVYMQPASEGTGIIAGGAMRAVLEVVGVQ 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK+ GS+NP NV+RAT + L   + P+ +A +RG+  + L  
Sbjct: 122 NVLAKAYGSTNPINVVRATLDALEKMNSPQQIAAKRGLSVNELLG 166


>gi|226226296|ref|YP_002760402.1| 30S ribosomal protein S5 [Gemmatimonas aurantiaca T-27]
 gi|226089487|dbj|BAH37932.1| 30S ribosomal protein S5 [Gemmatimonas aurantiaca T-27]
          Length = 272

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 80/174 (45%), Positives = 117/174 (67%), Gaps = 1/174 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            ++   + +V+ ++AINRV+  + GGRRF+F+ LV VGD + KVGFA   A EV EAVRK
Sbjct: 75  QQDREQSDLVENVIAINRVAKVVKGGRRFSFNALVAVGDGQGKVGFATGKANEVSEAVRK 134

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A +AA+R+M+S+ L  G T+ H+ VG+HGAGKV+M+ A  G GVIAGGA+RAV E  G+H
Sbjct: 135 AVDAARRSMVSIPLT-GSTIPHEVVGKHGAGKVLMKPAAPGAGVIAGGAVRAVLECAGIH 193

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSS 187
           D++ KS+GS+NPHN++RA  + L         A  RG+  S +  +    +++ 
Sbjct: 194 DILTKSLGSTNPHNMVRAAIDGLTHLITVEQAAKERGLDVSQIGYKSRAKARTE 247


>gi|94498493|ref|ZP_01305049.1| ribosomal protein S5 [Sphingomonas sp. SKA58]
 gi|94422036|gb|EAT07081.1| ribosomal protein S5 [Sphingomonas sp. SKA58]
          Length = 242

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 96/178 (53%), Positives = 126/178 (70%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E++   +++++V INRVS  + GG+RF F+ LVVVGD K + GF H  AREVPEA+ KAT
Sbjct: 62  EDQGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAREVPEAISKAT 121

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AAK+ M+ V L +GRTLHHDG+G  GAGKV +RSA AGTG+IAGG +RAV E LG+ DV
Sbjct: 122 AAAKKAMVRVPLKEGRTLHHDGLGHFGAGKVTVRSAPAGTGIIAGGPMRAVFESLGVADV 181

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDS 193
           V KS G+SNP+N+IRATF  L  Q+ P+ VA RRG K + L  R   S+  +    ++
Sbjct: 182 VTKSNGTSNPYNMIRATFAALGEQTSPKSVAQRRGKKVADLLRRGGASADVAQADAEA 239


>gi|291460735|ref|ZP_06600125.1| ribosomal protein S5 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291416694|gb|EFE90413.1| ribosomal protein S5 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 169

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 66/168 (39%), Positives = 97/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + D +VAI RV+  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KREKIDANQLELNDNVVAIKRVAKTVKGGRTMRFSALVVVGDGNGHVGCGKGKATEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA EAA ++++ + + D +++ HD  G+ GA  V+++ A  GTG+IAGG  R VCE+ 
Sbjct: 62  IRKAREAAVKSLVEIPVNDEKSVPHDYTGKFGASTVLLKKAPEGTGIIAGGPARMVCELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT + L S   P   A  RG   + +  
Sbjct: 122 GIRNIRTKSLGSNNKTNVVLATLQGLTSMKTPEQFAALRGKTVAEITG 169


>gi|86141157|ref|ZP_01059703.1| 30S ribosomal protein S5 [Leeuwenhoekiella blandensis MED217]
 gi|85831716|gb|EAQ50171.1| 30S ribosomal protein S5 [Leeuwenhoekiella blandensis MED217]
          Length = 174

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 70/171 (40%), Positives = 102/171 (59%), Gaps = 1/171 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
               N +  +     + DR+V + RV+    GGR F FS +VVVGD    VG     +++
Sbjct: 3   QNYKNVELVKPSGLDLKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGQGLGKSKD 62

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           V  A+ KA E AK+N++ + L    T+ H+  G++G  +V++  A  GTGVIAGGAIR+V
Sbjct: 63  VASAIAKAVEDAKKNLVRIPLTKS-TIPHEQKGKYGGARVLLMPAAPGTGVIAGGAIRSV 121

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            E +G+HDV++K+ GSSNPHNV++ATF+ L        VA +RGI    L 
Sbjct: 122 LESVGIHDVLSKNQGSSNPHNVVKATFDALLQLRSAETVAKQRGISLEKLF 172


>gi|297569405|ref|YP_003690749.1| ribosomal protein S5 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925320|gb|ADH86130.1| ribosomal protein S5 [Desulfurivibrio alkaliphilus AHT2]
          Length = 165

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                D+ ++++IV INR +  + GGRRF FS +VVVGD   KVG+    A +VPEA+RK
Sbjct: 2   RNSSSDDQLIEKIVFINRTAKVVKGGRRFHFSAIVVVGDGNGKVGYGLGKANQVPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A+++M SV+L +  ++ H+ +G+ GAG+V+++ A AGTGVIAGG +RAV E  G++
Sbjct: 62  GVEKARKDMQSVALNEV-SIPHEIMGKFGAGQVMLKPAAAGTGVIAGGPVRAVLEAAGIN 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +++ K IGS NPHN+++AT + LR   +P  VA  RG     +
Sbjct: 121 NILTKCIGSHNPHNMVKATLDGLRRLRNPAKVARMRGKSVEEI 163


>gi|262273362|ref|ZP_06051176.1| SSU ribosomal protein S5p (S2e) [Grimontia hollisae CIP 101886]
 gi|262222340|gb|EEY73651.1| SSU ribosomal protein S5p (S2e) [Grimontia hollisae CIP 101886]
          Length = 165

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 112/164 (68%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            +++ + + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++K+
Sbjct: 3   NDKQQSDLHEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKS 62

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM++V+L +  TLHH   GRH   KV M+ A  GTG+IAGGA+RAV EV G+ +
Sbjct: 63  MEKARRNMVTVAL-NDGTLHHAVKGRHTGSKVYMQPASEGTGIIAGGAMRAVLEVAGVRN 121

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP N++RAT + L     P  VA +RG+  + +  
Sbjct: 122 VLAKAYGSTNPINIVRATIDGLGGMKSPEMVAAKRGLPVNEILG 165


>gi|256847780|ref|ZP_05553225.1| ribosomal protein S5 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715469|gb|EEU30445.1| ribosomal protein S5 [Lactobacillus coleohominis 101-4-CHN]
          Length = 169

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 107/163 (65%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D++VAINR++  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA+
Sbjct: 8   DPAKLDLDDQVVAINRITKVVKGGRRMRFAALVVVGDRNGHVGFGTGKAQEVPEAIRKAS 67

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AA++N+I V  + G T+ H+ +G  G GK++++ A+ G+GV AGGA+R V E+ G+ DV
Sbjct: 68  AAAQKNLIEVPKV-GTTIPHEVIGTFGGGKIMLKPAVEGSGVAAGGAVRNVMELAGIDDV 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +K +GS+ P NV+RATFE L+S     +VA  RG+    L  
Sbjct: 127 TSKRLGSNTPINVVRATFEGLKSLKSADEVAKLRGVSAEHLAE 169


>gi|296111445|ref|YP_003621827.1| ribosomal protein S5 [Leuconostoc kimchii IMSNU 11154]
 gi|295832977|gb|ADG40858.1| ribosomal protein S5 [Leuconostoc kimchii IMSNU 11154]
          Length = 168

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 102/158 (64%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + + +VAINRV+  + GGRR  F+ LVVVGD +  VGF    A+EVPEA+RKA E AKR
Sbjct: 12  ELEENVVAINRVTKVVKGGRRLRFAALVVVGDKQGHVGFGTGKAQEVPEAIRKAIEDAKR 71

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
            +I+V  +   T+ HD +G  G GK++++ A  G+GV AGGA R+V E+ G+ DV AKS+
Sbjct: 72  KLITVPTV-STTIPHDVLGVWGGGKILIKPAEEGSGVAAGGAARSVMELAGIADVTAKSL 130

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+ P NV+RATF+ L S      VA  RG+    L  
Sbjct: 131 GSATPVNVVRATFDALTSLKDAEQVAALRGVSLEHLAE 168


>gi|225850752|ref|YP_002730986.1| 30S ribosomal protein S5 [Persephonella marina EX-H1]
 gi|254765201|sp|C0QQP0|RS5_PERMH RecName: Full=30S ribosomal protein S5
 gi|225644786|gb|ACO02972.1| ribosomal protein S5 [Persephonella marina EX-H1]
          Length = 194

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/182 (35%), Positives = 108/182 (59%), Gaps = 2/182 (1%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
            +R   +     + ++ +++V I R +  + GGRRF+FS L VVGD    VGF H  A E
Sbjct: 11  EERQKIEPINPAELTLEEKVVEIRRTTRVVEGGRRFSFSTLAVVGDRNGHVGFGHGKANE 70

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP ++ KA   AK+++I V L++  T+ HD +G++ +  V+++ A  GTGV+AGG +R V
Sbjct: 71  VPPSIAKAIADAKKHLIRVPLIE-GTIPHDVIGKYESAVVLLKPARKGTGVVAGGPVRPV 129

Query: 127 CEVLGMHDVVAKSIG-SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSK 185
            E+LG+ D++ K IG ++NP+N +RA F+ L     P  VA  RG+    ++    + + 
Sbjct: 130 LELLGVTDILTKIIGRTTNPNNTVRAVFDALLQIRSPEQVAAIRGVDEEKIRKNYRIYAS 189

Query: 186 SS 187
           + 
Sbjct: 190 AP 191


>gi|251781534|ref|YP_002995835.1| 30S ribosomal protein S5 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390162|dbj|BAH80621.1| 30S ribosomal protein S5 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|322410875|gb|EFY01783.1| 30S ribosomal protein S5 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
 gi|323126328|gb|ADX23625.1| 30S ribosomal protein S5 [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 164

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VAINRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA EAAK+
Sbjct: 9   ELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRVGFGTGKAQEVPEAIRKAVEAAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           NMI V ++ G T+ H+     G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NMIEVPMV-GTTIPHEVYTNFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGIADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|15617101|ref|NP_240314.1| 30S ribosomal protein S5 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681853|ref|YP_002468239.1| 30S ribosomal protein S5 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682408|ref|YP_002468792.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471558|ref|ZP_05635557.1| 30S ribosomal protein S5 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11387059|sp|P57574|RS5_BUCAI RecName: Full=30S ribosomal protein S5
 gi|25294517|pir||H84988 30S ribosomal protein S5 [imported] - Buchnera sp. (strain APS)
 gi|10039166|dbj|BAB13200.1| 30S ribosomal protein S5 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622141|gb|ACL30297.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624696|gb|ACL30851.1| 30S ribosomal protein S5 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086229|gb|ADP66311.1| 30S ribosomal protein S5 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086806|gb|ADP66887.1| 30S ribosomal protein S5 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087393|gb|ADP67473.1| 30S ribosomal protein S5 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087889|gb|ADP67968.1| 30S ribosomal protein S5 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 167

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/164 (43%), Positives = 106/164 (64%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            ++  N + ++++ +NRVS  + GGR F+F+ L VVG+   KVGF +  AREVP A++KA
Sbjct: 5   EKKNHNDLQEKLITVNRVSKTVKGGRIFSFTALTVVGNGDGKVGFGYGKAREVPAAIQKA 64

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNMI++ L++  TL H   G H    V M+ A  GTG+IAGGA+RAV EV G+H+
Sbjct: 65  MEQARRNMITIPLVNK-TLQHSLKGSHTGSNVFMKPASDGTGIIAGGAMRAVLEVAGIHN 123

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP NV+RAT   L +   P  +A +R  +   +  
Sbjct: 124 VLAKTYGSTNPINVVRATMNGLVNMKSPEMIAAKRNKRIKDILG 167


>gi|225011664|ref|ZP_03702102.1| ribosomal protein S5 [Flavobacteria bacterium MS024-2A]
 gi|225004167|gb|EEG42139.1| ribosomal protein S5 [Flavobacteria bacterium MS024-2A]
          Length = 174

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 107/168 (63%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N +  +     + DR+V + RV+    GGR F FS +VVVGD    VG     ++EV E
Sbjct: 6   KNVELVKPAGLDLKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGQGLGKSKEVSE 65

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ + + +  TL H+  G++G  +V ++ A  GTGVIAGGA+RAV E 
Sbjct: 66  AIAKAVEDAKKNLVRIPI-NKGTLPHEQKGKYGGARVFLKPASEGTGVIAGGAVRAVLEA 124

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +G+H+V++KS GSSNPHNV++ATF+ L    +P+ +A +RGI    + 
Sbjct: 125 VGVHNVLSKSQGSSNPHNVVKATFDALLQLRNPQRIAEQRGISLDKVF 172


>gi|148544679|ref|YP_001272049.1| 30S ribosomal protein S5 [Lactobacillus reuteri DSM 20016]
 gi|184154032|ref|YP_001842373.1| 30S ribosomal protein S5 [Lactobacillus reuteri JCM 1112]
 gi|194466936|ref|ZP_03072923.1| ribosomal protein S5 [Lactobacillus reuteri 100-23]
 gi|227363802|ref|ZP_03847909.1| 30S ribosomal protein S5 [Lactobacillus reuteri MM2-3]
 gi|227543606|ref|ZP_03973655.1| 30S ribosomal protein S5 [Lactobacillus reuteri CF48-3A]
 gi|300909365|ref|ZP_07126826.1| 30S ribosomal protein S5 [Lactobacillus reuteri SD2112]
 gi|325683013|ref|ZP_08162529.1| 30S ribosomal protein S5 [Lactobacillus reuteri MM4-1A]
 gi|172048238|sp|A5VLI8|RS5_LACRD RecName: Full=30S ribosomal protein S5
 gi|148531713|gb|ABQ83712.1| SSU ribosomal protein S5P [Lactobacillus reuteri DSM 20016]
 gi|154705534|gb|ABS84193.1| ribosomal protein S5 [Lactobacillus reuteri]
 gi|183225376|dbj|BAG25893.1| 30S ribosomal protein S5 [Lactobacillus reuteri JCM 1112]
 gi|194453972|gb|EDX42869.1| ribosomal protein S5 [Lactobacillus reuteri 100-23]
 gi|227071159|gb|EEI09475.1| 30S ribosomal protein S5 [Lactobacillus reuteri MM2-3]
 gi|227186446|gb|EEI66517.1| 30S ribosomal protein S5 [Lactobacillus reuteri CF48-3A]
 gi|300893230|gb|EFK86589.1| 30S ribosomal protein S5 [Lactobacillus reuteri SD2112]
 gi|324977363|gb|EGC14314.1| 30S ribosomal protein S5 [Lactobacillus reuteri MM4-1A]
          Length = 169

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 71/166 (42%), Positives = 111/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + D++VAINR++  + GGRR  F+ LV+VGD K  VGF    A+EVPEA+R
Sbjct: 5   EFIDPAKLDLDDQVVAINRITKVVKGGRRMRFAALVIVGDRKGHVGFGTGKAQEVPEAIR 64

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA  AA++N+I+V ++ G T+ H+ +G +G GK++++ A+ G+GV AGGA+R V ++ G+
Sbjct: 65  KAQAAAEKNLITVPIV-GTTIPHEVIGVYGGGKIMLKPAVEGSGVAAGGAVRNVMDLAGV 123

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +K +GS+ P NV+RATFE L+   +  +VA  RG+    L  
Sbjct: 124 ADVTSKRLGSNTPVNVVRATFEGLKQLKNAEEVAKLRGVSVDHLAE 169


>gi|16272736|ref|NP_438954.1| 30S ribosomal protein S5 [Haemophilus influenzae Rd KW20]
 gi|68249391|ref|YP_248503.1| 30S ribosomal protein S5 [Haemophilus influenzae 86-028NP]
 gi|145628312|ref|ZP_01784113.1| 30S ribosomal protein S5 [Haemophilus influenzae 22.1-21]
 gi|145630541|ref|ZP_01786321.1| 30S ribosomal protein S5 [Haemophilus influenzae R3021]
 gi|145632153|ref|ZP_01787888.1| 30S ribosomal protein S5 [Haemophilus influenzae 3655]
 gi|145634794|ref|ZP_01790502.1| 30S ribosomal protein S5 [Haemophilus influenzae PittAA]
 gi|145636647|ref|ZP_01792314.1| 30S ribosomal protein S5 [Haemophilus influenzae PittHH]
 gi|145638404|ref|ZP_01794014.1| 30S ribosomal protein S5 [Haemophilus influenzae PittII]
 gi|145640892|ref|ZP_01796474.1| 30S ribosomal protein S5 [Haemophilus influenzae R3021]
 gi|148826561|ref|YP_001291314.1| 30S ribosomal protein S5 [Haemophilus influenzae PittEE]
 gi|148827984|ref|YP_001292737.1| 30S ribosomal protein S5 [Haemophilus influenzae PittGG]
 gi|229844662|ref|ZP_04464801.1| 30S ribosomal protein S5 [Haemophilus influenzae 6P18H1]
 gi|229845845|ref|ZP_04465957.1| 30S ribosomal protein S5 [Haemophilus influenzae 7P49H1]
 gi|260579886|ref|ZP_05847716.1| ribosomal protein S5 [Haemophilus influenzae RdAW]
 gi|260581612|ref|ZP_05849409.1| ribosomal protein S5 [Haemophilus influenzae NT127]
 gi|319775271|ref|YP_004137759.1| 30S ribosomal subunit protein S5 [Haemophilus influenzae F3047]
 gi|329122801|ref|ZP_08251373.1| 30S ribosomal protein S5 [Haemophilus aegyptius ATCC 11116]
 gi|1173266|sp|P44374|RS5_HAEIN RecName: Full=30S ribosomal protein S5
 gi|81336182|sp|Q4QMA4|RS5_HAEI8 RecName: Full=30S ribosomal protein S5
 gi|189045417|sp|A5UHU8|RS5_HAEIG RecName: Full=30S ribosomal protein S5
 gi|189045483|sp|A5UDT0|RS5_HAEIE RecName: Full=30S ribosomal protein S5
 gi|1573805|gb|AAC22453.1| ribosomal protein S5 (rpS5) [Haemophilus influenzae Rd KW20]
 gi|68057590|gb|AAX87843.1| 30S ribosomal protein S5 [Haemophilus influenzae 86-028NP]
 gi|144980087|gb|EDJ89746.1| 30S ribosomal protein S5 [Haemophilus influenzae 22.1-21]
 gi|144983931|gb|EDJ91373.1| 30S ribosomal protein S5 [Haemophilus influenzae R3021]
 gi|144987060|gb|EDJ93590.1| 30S ribosomal protein S5 [Haemophilus influenzae 3655]
 gi|145267960|gb|EDK07956.1| 30S ribosomal protein S5 [Haemophilus influenzae PittAA]
 gi|145270173|gb|EDK10109.1| 30S ribosomal protein S5 [Haemophilus influenzae PittHH]
 gi|145272733|gb|EDK12640.1| 30S ribosomal protein S5 [Haemophilus influenzae PittII]
 gi|145274406|gb|EDK14270.1| 30S ribosomal protein S5 [Haemophilus influenzae 22.4-21]
 gi|148716721|gb|ABQ98931.1| 30S ribosomal protein S5 [Haemophilus influenzae PittEE]
 gi|148719226|gb|ABR00354.1| 30S ribosomal protein S5 [Haemophilus influenzae PittGG]
 gi|229810849|gb|EEP46566.1| 30S ribosomal protein S5 [Haemophilus influenzae 7P49H1]
 gi|229812376|gb|EEP48066.1| 30S ribosomal protein S5 [Haemophilus influenzae 6P18H1]
 gi|260093170|gb|EEW77103.1| ribosomal protein S5 [Haemophilus influenzae RdAW]
 gi|260095205|gb|EEW79096.1| ribosomal protein S5 [Haemophilus influenzae NT127]
 gi|301169513|emb|CBW29114.1| 30S ribosomal subunit protein S5 [Haemophilus influenzae 10810]
 gi|309751544|gb|ADO81528.1| 30S ribosomal protein S5 [Haemophilus influenzae R2866]
 gi|309973714|gb|ADO96915.1| 30S ribosomal protein S5 [Haemophilus influenzae R2846]
 gi|317449862|emb|CBY86073.1| 30S ribosomal subunit protein S5 [Haemophilus influenzae F3047]
 gi|327472065|gb|EGF17503.1| 30S ribosomal protein S5 [Haemophilus aegyptius ATCC 11116]
          Length = 166

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQVGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNMI+V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMINVAL-NEGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDEILG 166


>gi|45644713|gb|AAS73101.1| predicted ribosomal protein S5 [uncultured marine gamma
           proteobacterium EBAC20E09]
          Length = 169

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 74/168 (44%), Positives = 109/168 (64%), Gaps = 1/168 (0%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           ++N     ++ +++ +++V +NRV+  + GGR F F+ L VVGD K +VGF    A+EVP
Sbjct: 2   KENNAMNAQQVDALEEKLVQVNRVAKVVKGGRIFGFTALTVVGDGKGRVGFGRGKAKEVP 61

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
            A++KA E A+R+M+ V L +  TL +    +HG+ KV M+ A  GTG+IAGGA+RAV E
Sbjct: 62  IAIQKAMENARRSMVEVEL-NNTTLWYPVKAKHGSAKVYMQPASEGTGIIAGGAMRAVLE 120

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + G+ +V+AK  GS+NP NV+RAT   L +   P  VA RRG K   L
Sbjct: 121 LAGVQNVLAKCYGSTNPVNVVRATINALSAMESPEKVATRRGKKVEEL 168


>gi|301057492|ref|ZP_07198588.1| ribosomal protein S5 [delta proteobacterium NaphS2]
 gi|300448420|gb|EFK12089.1| ribosomal protein S5 [delta proteobacterium NaphS2]
          Length = 173

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 67/158 (42%), Positives = 106/158 (67%), Gaps = 1/158 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           + +  +++++V INRV+  + GGRRF+FS +VVVGD    VGF    A +VPEA+RK  E
Sbjct: 5   DDEVQLIEKVVHINRVAKVVKGGRRFSFSAIVVVGDGNGAVGFGLGKANQVPEAIRKGIE 64

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A+++M  VSL +  ++ ++ VG+ GAG+V+++ A  GTG+IAGG +RAV E  G+ +++
Sbjct: 65  RARKDMTPVSLHES-SIPYEVVGKWGAGRVLLKPAGPGTGLIAGGGVRAVLEAAGVQNIL 123

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
            K +GS N HN+++AT + LRS   P ++  RRG    
Sbjct: 124 TKCLGSHNAHNIVKATIKGLRSLRDPAEIMARRGKVLE 161


>gi|209527125|ref|ZP_03275639.1| ribosomal protein S5 [Arthrospira maxima CS-328]
 gi|284053319|ref|ZP_06383529.1| 30S ribosomal protein S5 [Arthrospira platensis str. Paraca]
 gi|209492465|gb|EDZ92806.1| ribosomal protein S5 [Arthrospira maxima CS-328]
 gi|291567800|dbj|BAI90072.1| 30S ribosomal protein S5 [Arthrospira platensis NIES-39]
          Length = 176

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/178 (37%), Positives = 104/178 (58%), Gaps = 2/178 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++R +++     +E+++   +R+V I RV+  + GG++ +F  +V+VG+ K +VG  
Sbjct: 1   MAEQQRRKKNTR--TKEKESEWQERVVQIRRVTKVVKGGKKLSFRAIVIVGNEKGQVGVG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A +V  AV+K     ++N++ + L    +L H   G  G  +VI+R A  GTGVIAG
Sbjct: 59  VGKAADVIGAVKKGVADGRKNVVEIPLTKSNSLPHPANGVGGGAQVIVRPAAPGTGVIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GA+R V E+ G+ +V+AK +GSSNP N  RAT   L       DVA  RGI    L A
Sbjct: 119 GAVRTVLELAGVKNVLAKQLGSSNPLNNARATINALSGLRTLSDVAKERGIPIEQLYA 176


>gi|118616590|ref|YP_904922.1| 30S ribosomal protein S5 [Mycobacterium ulcerans Agy99]
 gi|189045425|sp|A0PM82|RS5_MYCUA RecName: Full=30S ribosomal protein S5
 gi|118568700|gb|ABL03451.1| 30S ribosomal protein S5, RpsE [Mycobacterium ulcerans Agy99]
          Length = 224

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/188 (40%), Positives = 111/188 (59%), Gaps = 7/188 (3%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
              ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E
Sbjct: 36  SDKSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVE 95

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A++    V L+ G T+ H   G   AG V++R A  GTGV+AGGA RAV E  G+HD++
Sbjct: 96  EARKGFFRVPLI-GGTITHPVQGEAAAGVVLLRPASPGTGVLAGGAARAVLECAGVHDIL 154

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA------RRVVSSKSSSYS 190
           AKS+GS N  NV+ AT   L+    P +VA RRG+    +        RR   + +++  
Sbjct: 155 AKSLGSDNAINVVHATVAALKMLQRPEEVAARRGLPIEDVAPAGMLKARRESEALAAAAV 214

Query: 191 RDSKNKGG 198
           R+++  G 
Sbjct: 215 REAQTSGA 222


>gi|227487089|ref|ZP_03917405.1| 30S ribosomal protein S5 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227541743|ref|ZP_03971792.1| 30S ribosomal protein S5 [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227093163|gb|EEI28475.1| 30S ribosomal protein S5 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227182449|gb|EEI63421.1| 30S ribosomal protein S5 [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 207

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 81/189 (42%), Positives = 118/189 (62%), Gaps = 3/189 (1%)

Query: 3   QKERSQRDNWQNREERDN--SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           Q+  ++RDN +++  +D     ++R+V INRVS  + GGRRF+F+ LVVVGD K  VG  
Sbjct: 18  QRRGNRRDNRKDKNAQDERNQYIERVVTINRVSKVVKGGRRFSFTALVVVGDGKGMVGVG 77

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           +  A+EVP A++K  E A++N   V L+ G T+ H   GR  AGKV++R A  GTGVIAG
Sbjct: 78  YGKAKEVPAAIQKGAEEARKNFFRVPLV-GGTIPHRVEGRAAAGKVMLRPASEGTGVIAG 136

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           GA R V E  G+ D+++KS+GS N  NV+ AT   L+S + P +VA RRG     +    
Sbjct: 137 GAARPVLECAGVQDILSKSLGSDNAINVVHATVAGLKSLARPEEVAARRGKSLDEVAPPH 196

Query: 181 VVSSKSSSY 189
           ++ ++S   
Sbjct: 197 ILRARSGQE 205


>gi|146281187|ref|YP_001171340.1| 30S ribosomal protein S5 [Pseudomonas stutzeri A1501]
 gi|172045578|sp|A4VHP7|RS5_PSEU5 RecName: Full=30S ribosomal protein S5
 gi|145569392|gb|ABP78498.1| ribosomal protein S5 [Pseudomonas stutzeri A1501]
 gi|327479340|gb|AEA82650.1| 30S ribosomal protein S5 [Pseudomonas stutzeri DSM 4166]
          Length = 166

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/164 (47%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNEQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA K+ M+ A  GTGVIAGGA+RA+ EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYATKAAHGASKIYMQPASEGTGVIAGGAMRAILEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           H+V+AK  GS+NP NV+ ATF+ L++   P  +A +RG     +
Sbjct: 122 HNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGKSVEEI 165


>gi|323706467|ref|ZP_08118028.1| ribosomal protein S5 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534187|gb|EGB23977.1| ribosomal protein S5 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 167

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 105/166 (63%), Gaps = 2/166 (1%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGD-TKSKVGFAHSTAREVPEAVR 72
             +  +  + +R+V++NRV+  + GGR F FS  VVVGD  K  VG     + E+PEA+R
Sbjct: 3   RIDISNLDLKERVVSLNRVAKVVKGGRNFRFSATVVVGDPDKGYVGVGTGKSAEIPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+++I V ++ G T+ HD VG  GAGKV+++ A  GTGVIAGG +RAV E  G+
Sbjct: 63  KAVEDAKKHLIKVPIV-GTTIPHDAVGVFGAGKVLLKPAKEGTGVIAGGPVRAVLESAGI 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            D++ KS+GS+N  N++ AT E L+S     +VA  RGI    L  
Sbjct: 122 KDILTKSLGSANSTNMVYATIEGLKSLKTAEEVAKLRGIPVEQLLG 167


>gi|119964099|ref|YP_948641.1| 30S ribosomal protein S5 [Arthrobacter aurescens TC1]
 gi|171704614|sp|A1R8S9|RS5_ARTAT RecName: Full=30S ribosomal protein S5
 gi|119950958|gb|ABM09869.1| ribosomal protein S5 [Arthrobacter aurescens TC1]
          Length = 223

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/175 (42%), Positives = 106/175 (60%), Gaps = 1/175 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E   +  V+R+V INRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  
Sbjct: 48  EAEKSQFVERVVTINRVAKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAAIAKGV 107

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK++   V  + G T+ H   G   AG V++R A AGTGVIAGG +RAV E +G+HD+
Sbjct: 108 EEAKKSFFRVPRV-GSTIPHRVQGEAAAGVVLLRPASAGTGVIAGGPVRAVLECVGIHDI 166

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           ++KS+GSSN  N++ AT   L+    P  VA RRG+    +    +V +  +  +
Sbjct: 167 LSKSLGSSNAINIVHATVAALKQLEEPASVAARRGLPLDEVAPAALVRALQNQKA 221


>gi|110678745|ref|YP_681752.1| 30S ribosomal protein S5 [Roseobacter denitrificans OCh 114]
 gi|123065749|sp|Q16AC7|RS5_ROSDO RecName: Full=30S ribosomal protein S5
 gi|109454861|gb|ABG31066.1| ribosomal protein S5 [Roseobacter denitrificans OCh 114]
          Length = 191

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 106/179 (59%), Positives = 135/179 (75%), Gaps = 1/179 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+++ ++R N ++R+E      DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF 
Sbjct: 1   MAERDNNRRGNRRDRDEA-PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A+EVPEA+RKATE AKR MI V L +GRTLHHD  GRHGAGKV+MRSA  GTG+IAG
Sbjct: 60  KGKAKEVPEAIRKATEQAKRQMIRVQLREGRTLHHDMEGRHGAGKVVMRSAPEGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           G +RAV E+LG+ DVV+KSIGS NP+N+IRAT + LR +S PR VA RRG K + +  +
Sbjct: 120 GPMRAVFEMLGVKDVVSKSIGSQNPYNMIRATMDGLRKESSPRSVAQRRGKKVADILPK 178


>gi|251793845|ref|YP_003008577.1| 30S ribosomal protein S5 [Aggregatibacter aphrophilus NJ8700]
 gi|247535244|gb|ACS98490.1| ribosomal protein S5 [Aggregatibacter aphrophilus NJ8700]
          Length = 166

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E++   + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   NIEKQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM++V+L +  TL H   G H   +V M+ A  GTG+IAGGA+RAV EV G+ 
Sbjct: 63  AMEKARRNMVNVALTE-GTLQHPVKGTHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVR 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L +   P  VA +RG     +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKSVDEILG 166


>gi|126666796|ref|ZP_01737773.1| 30S ribosomal protein S5 [Marinobacter sp. ELB17]
 gi|126628841|gb|EAZ99461.1| 30S ribosomal protein S5 [Marinobacter sp. ELB17]
          Length = 166

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E++   + +++V +NRV+  + GGR FAF+ L VVGD K +VGF    AREVP A++KA
Sbjct: 4   NEQKAPELQEKLVQVNRVAKVVKGGRIFAFTALTVVGDGKGRVGFGRGKAREVPVAIQKA 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            EAA++NM+ V L DG TL +    +HG  +V M  A  GTG+IAGGA+RAV EV G+H+
Sbjct: 64  MEAARKNMVDVPL-DGTTLQYPVRAQHGGSRVFMMPASDGTGIIAGGAMRAVLEVAGVHN 122

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V++K  GS+NP NV+R+T + L++   P D+A +RG     +  
Sbjct: 123 VLSKCYGSTNPVNVVRSTIKGLQAMQAPEDIAAKRGKSVEDILG 166


>gi|148652255|ref|YP_001279348.1| 30S ribosomal protein S5 [Psychrobacter sp. PRwf-1]
 gi|226703377|sp|A5WCK7|RS5_PSYWF RecName: Full=30S ribosomal protein S5
 gi|148571339|gb|ABQ93398.1| SSU ribosomal protein S5P [Psychrobacter sp. PRwf-1]
          Length = 165

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 83/162 (51%), Positives = 110/162 (67%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           E+++ +V+++V+++RVS  + GGR F+F+ L VVGD   +VGF    AREVP A++KA E
Sbjct: 5   EQNDGLVEKLVSVDRVSKVVKGGRIFSFTALTVVGDGNGRVGFGRGKAREVPAAIQKALE 64

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
           AAKRNMI+V L DG TL H  + RHGA KV M+ A  GTGVIAGGA+RAV E  G+ +V+
Sbjct: 65  AAKRNMITVDL-DGATLQHPIIARHGASKVYMQPANEGTGVIAGGAVRAVLESAGVENVL 123

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            K  GS+NP NV+RATF  LR  S P   A +RG     +  
Sbjct: 124 TKCYGSTNPTNVVRATFNGLRDMSSPEKAAAKRGKSVDEILG 165


>gi|56460999|ref|YP_156280.1| 30S ribosomal protein S5 [Idiomarina loihiensis L2TR]
 gi|73919062|sp|Q5QXW2|RS5_IDILO RecName: Full=30S ribosomal protein S5
 gi|56180009|gb|AAV82731.1| Ribosomal protein S5 [Idiomarina loihiensis L2TR]
          Length = 166

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E +   ++++++ +NRV+  + GGR F+F+ L VVGD K KVGF +  AREVP A++K
Sbjct: 3   NVEAQTGELIEKLITVNRVAKVVKGGRIFSFTALTVVGDGKGKVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM++V L  G TL H   GRH   +V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEKARRNMVTVQL-KGDTLQHPVKGRHSGSQVYMQPASEGTGIIAGGAMRAVLEVSGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP NV+RAT + L     P  VA +RG++   +  
Sbjct: 122 NVLSKAYGSTNPINVVRATIKALNGMKSPEQVAAKRGLRVDEILG 166


>gi|296168580|ref|ZP_06850384.1| 30S ribosomal protein S5 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295896643|gb|EFG76282.1| 30S ribosomal protein S5 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 226

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/178 (41%), Positives = 108/178 (60%), Gaps = 1/178 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
            ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E A
Sbjct: 43  KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEA 102

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           ++    V L+ G T+ H   G   AG V++R A  GTGVIAGGA+RAV E  G+HD++AK
Sbjct: 103 RKGFFRVPLI-GGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAVRAVLECAGVHDILAK 161

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           S+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S +  +   
Sbjct: 162 SLGSDNAINVVHATVTALKLLQRPEEVAARRGLPIEDVAPAGMLKARRESDALAASAA 219


>gi|302388729|ref|YP_003824550.1| SSU ribosomal protein S5P [Thermosediminibacter oceani DSM 16646]
 gi|302199357|gb|ADL06927.1| SSU ribosomal protein S5P [Thermosediminibacter oceani DSM 16646]
          Length = 166

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q   + ++   +++V INRVS    GG+ F FS LVVVG+   KVG     A E+P+A+R
Sbjct: 2   QRERDIEHEFSEKVVTINRVSKVTKGGKNFRFSALVVVGNKNGKVGVGTGKAHEIPDAIR 61

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+N+I+V +++  T+ H+ +G  GAG+V+++ A+ GTGVIAGG +RAV E+ G+
Sbjct: 62  KAIEDAKKNLINVPVIN-GTIPHEAIGESGAGRVLVKPAVEGTGVIAGGPVRAVLELAGI 120

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +VV+KS+GSSN  N++ AT E L+      +VA  RG     L  
Sbjct: 121 RNVVSKSLGSSNAKNMVDATIEALKQLKSIEEVAKMRGKTVQELLG 166


>gi|313904935|ref|ZP_07838306.1| ribosomal protein S5 [Eubacterium cellulosolvens 6]
 gi|313470192|gb|EFR65523.1| ribosomal protein S5 [Eubacterium cellulosolvens 6]
          Length = 169

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 63/163 (38%), Positives = 98/163 (60%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D +V+I RVS  + GGR   F+ LV+VGD    VG     A E+PEA+RK  
Sbjct: 7   DASQLELEDNVVSIKRVSKTVKGGRTSRFTALVIVGDHNGHVGAGLGKAVEIPEAIRKGK 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A +++ISV+  +  ++ HD +G++G+  V+++ A  GTG+IAGG  RAV E+ G+ ++
Sbjct: 67  EDAMKHLISVARDENNSITHDFIGKYGSASVLLKRAPEGTGIIAGGTARAVVELAGIQNI 126

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
             K +GS+N  NV+ AT E L++   P +VA  RG     + A
Sbjct: 127 RTKCLGSNNKQNVVLATLEGLKALKTPEEVARLRGKSVDEILA 169


>gi|116493146|ref|YP_804881.1| 30S ribosomal protein S5 [Pediococcus pentosaceus ATCC 25745]
 gi|122265390|sp|Q03ED3|RS5_PEDPA RecName: Full=30S ribosomal protein S5
 gi|116103296|gb|ABJ68439.1| SSU ribosomal protein S5P [Pediococcus pentosaceus ATCC 25745]
          Length = 167

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 110/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     I DR+VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+R
Sbjct: 3   KFIDPEKLEIEDRVVAINRVTKVVKGGRRLRFAALVVVGDKNGHVGFGTGKAQEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A++++I V ++ G TL H+ VG +G G+++M+ A+ G+GV AGGA+RAV E+ G+
Sbjct: 63  KAVETARKSLIEVPIV-GTTLPHEAVGVYGGGRILMKPALEGSGVAAGGAVRAVMELAGI 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +K +GS+   NV+RATFE L+S  +  +VA  RG+    L  
Sbjct: 122 DDVTSKRLGSNTAVNVVRATFEGLKSMRNAEEVAALRGVSVDHLAE 167


>gi|325964143|ref|YP_004242049.1| 30S ribosomal protein S5P [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470230|gb|ADX73915.1| SSU ribosomal protein S5P [Arthrobacter phenanthrenivorans Sphe3]
          Length = 242

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 106/173 (61%), Gaps = 1/173 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             +  V+R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E 
Sbjct: 69  EKSQFVERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAAIAKGVEE 128

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           AK++   V  + G T+ H   G   AG V++R A AGTGVIAGG +RAV E +G+HD+++
Sbjct: 129 AKKSFFRVPRV-GNTIPHRVQGEAAAGVVMLRPASAGTGVIAGGPVRAVLECVGIHDILS 187

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           KS+GSSN  N++ AT + L+    P  VA RRG+    +    +V +  S  +
Sbjct: 188 KSLGSSNAINIVHATVDALKRLEEPAAVAARRGLPLDEIAPAALVKALLSPKA 240


>gi|294786428|ref|ZP_06751682.1| ribosomal protein S5 [Parascardovia denticolens F0305]
 gi|315225990|ref|ZP_07867778.1| 30S ribosomal protein S5 [Parascardovia denticolens DSM 10105]
 gi|294485261|gb|EFG32895.1| ribosomal protein S5 [Parascardovia denticolens F0305]
 gi|315120122|gb|EFT83254.1| 30S ribosomal protein S5 [Parascardovia denticolens DSM 10105]
          Length = 245

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/175 (39%), Positives = 104/175 (59%), Gaps = 1/175 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
           +++R+V I RVS    GGR  +F+ LVVVGD K  VG  +  + EVP A+ K    AK++
Sbjct: 59  MLERVVTIRRVSKTTKGGRTMSFAALVVVGDGKGNVGVGYGKSHEVPAAIAKGNLDAKKH 118

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           M +V  L   T+ H  +G   AG V +R A  GTGVIAGGA+RAV E  G+ D++ K++G
Sbjct: 119 MFTVPRLR-GTIPHPVIGHESAGTVFLRPAAPGTGVIAGGAVRAVLECAGISDILTKTMG 177

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           S N  N +RAT + L+S   P++VA RR +    +   R++  +++    + K +
Sbjct: 178 SGNAINTVRATVQALKSLEEPQEVAARRDLSLQEVAPDRLLREQAAGIDEERKAR 232


>gi|151222347|ref|YP_001333169.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|189045442|sp|A6QJ75|RS5_STAAE RecName: Full=30S ribosomal protein S5
 gi|150375147|dbj|BAF68407.1| 30S ribosomal protein S5 [Staphylococcus aureus subsp. aureus str.
           Newman]
          Length = 163

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/150 (47%), Positives = 102/150 (68%), Gaps = 1/150 (0%)

Query: 26  IVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMISV 85
           +V INRV+  + GGRRF F+ LVVVGD   +VGF    A+EVPEA++KA EAAK++++ V
Sbjct: 15  VVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVV 74

Query: 86  SLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSSNP 145
             ++  T  H   GR+G+G V M+ A  GTGVIAGG +RAV E+ G+ D+++KS+GS+ P
Sbjct: 75  PRVE-GTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTP 133

Query: 146 HNVIRATFEVLRSQSHPRDVANRRGIKHSL 175
            N++RAT + L++  +  DVA  RG     
Sbjct: 134 INMVRATIDGLQNLKNAEDVAKLRGKTVEE 163


>gi|239623364|ref|ZP_04666395.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522330|gb|EEQ62196.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 169

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KRTIIDASQMELNDKVVAIKRVSKTVKGGRTMRFSALVVVGDGNGHVGAGLGKAGEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA +N++ + + + +++ HD +G+ G+  V+++ A  GTGVIAGG  R+V E+ 
Sbjct: 62  IRKGKEAAIKNLVEIPVDENKSIPHDFIGKFGSAAVLLKKAPEGTGVIAGGPARSVLEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L S   P + A  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKTNVVLATLAGLTSLKTPEEFARLRGKSVEEIVG 169


>gi|297826847|ref|XP_002881306.1| ribosomal protein S5 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297327145|gb|EFH57565.1| ribosomal protein S5 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 304

 Score =  169 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 95/163 (58%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +++  +   +R+V + RV+  + GG++  F  +VVVGD +  VG   + A+EV  AV+K
Sbjct: 140 KKDKIRDGFEERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQGNVGVGCAKAKEVVAAVQK 199

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           +   A+RN++ V +    T  H   G +GA KV++R A  GTGVIAGGA+R V E+ G+ 
Sbjct: 200 SAIDARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPASPGTGVIAGGAVRIVLEMAGVE 259

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + + K +GS+N  N  RAT   ++     RDVA  RGI    L
Sbjct: 260 NALGKQLGSNNALNNARATLAAVQQMRQFRDVAQERGIPMEEL 302


>gi|269104029|ref|ZP_06156726.1| SSU ribosomal protein S5p (S2e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163927|gb|EEZ42423.1| SSU ribosomal protein S5p (S2e) [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 165

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E+  + + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A++KA
Sbjct: 3   NEKTQSDLHEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKA 62

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM +V+L +  TLHH   GRH   KV M+ A  GTG+IAGGA+RAV EV G+ +
Sbjct: 63  MEKARRNMTNVAL-NEGTLHHAVKGRHTGSKVYMQPASEGTGIIAGGAMRAVLEVAGVRN 121

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP N++RAT + L   + P  +A +RG+    +  
Sbjct: 122 VLAKAYGSTNPINIVRATIDGLSGMNSPEMIAAKRGLSVKEILE 165


>gi|86158352|ref|YP_465137.1| SSU ribosomal protein S5P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497983|sp|Q2IJ66|RS5_ANADE RecName: Full=30S ribosomal protein S5
 gi|85774863|gb|ABC81700.1| SSU ribosomal protein S5P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 169

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 103/164 (62%), Gaps = 1/164 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
              +  + DR+V INRV+  + GGRRF+FS LVVVGD    VG     A EVPEA+RK  
Sbjct: 7   NANELELQDRVVHINRVAKVVKGGRRFSFSALVVVGDGAGHVGVGLGKANEVPEAIRKGG 66

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           + AK+N+  V L+ G T+ H+ +G  G+G+V+++ A  GTGVIAGGA+RAV E  G+ +V
Sbjct: 67  DQAKKNLFRVPLV-GTTIPHEVLGHFGSGRVLLKPAGEGTGVIAGGAVRAVLEAAGVRNV 125

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           + KS GS NPHNV++AT   L+      D A  RG + + +   
Sbjct: 126 LTKSQGSRNPHNVLKATVAGLKRLRSVEDSARLRGKQAAEITGA 169


>gi|149192386|ref|ZP_01870587.1| 30S ribosomal protein S5 [Vibrio shilonii AK1]
 gi|148833777|gb|EDL50813.1| 30S ribosomal protein S5 [Vibrio shilonii AK1]
          Length = 166

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +++ + + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++K
Sbjct: 3   KEQQQASDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+RNM++V+L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+H
Sbjct: 63  AMEKARRNMVTVAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V++K+ GS+NP N++RAT + L S   P  VA +RG+    +  
Sbjct: 122 NVLSKAYGSTNPINIVRATIDALDSMKSPEMVAAKRGLTVEAISE 166


>gi|270157893|ref|ZP_06186550.1| ribosomal protein S5 [Legionella longbeachae D-4968]
 gi|289163847|ref|YP_003453985.1| 30S ribosomal subunit protein S5 [Legionella longbeachae NSW150]
 gi|269989918|gb|EEZ96172.1| ribosomal protein S5 [Legionella longbeachae D-4968]
 gi|288857020|emb|CBJ10834.1| 30S ribosomal subunit protein S5 [Legionella longbeachae NSW150]
          Length = 169

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 109/166 (65%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
                + +   +++V++NR +  + GGR F F+VLVVVGD K KVGF    AREVP A++
Sbjct: 4   DESSPKSDGYQEKLVSVNRTAKVVKGGRVFGFAVLVVVGDGKGKVGFGRGKAREVPIAIQ 63

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+NM+ + L  G T++H+    +GA KV M+ A  GTG+IAGGA+RAV EVLG+
Sbjct: 64  KAMEQAKKNMVYIPLS-GSTIYHEITWNYGASKVFMKPASEGTGIIAGGAMRAVLEVLGV 122

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            +++AK+IGS+NP N++RAT   L +   P  VA +RG     + A
Sbjct: 123 QNILAKNIGSTNPSNIVRATIAALTNIGTPDYVAAKRGKTVEEVMA 168


>gi|218779745|ref|YP_002431063.1| ribosomal protein S5 [Desulfatibacillum alkenivorans AK-01]
 gi|218761129|gb|ACL03595.1| ribosomal protein S5 [Desulfatibacillum alkenivorans AK-01]
          Length = 167

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/167 (45%), Positives = 112/167 (67%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            + ++  +   +D++V I+RV+  + GGRRF+FS +VVVGD + +VG     A EVPEA+
Sbjct: 2   QKQQDRDEKEFIDKVVHISRVAKVVKGGRRFSFSAVVVVGDGEGRVGSGLGKAGEVPEAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  EAAKR+M+ + +++  T+  + VGR GAGKV+++ A  GTGVIAGGA+RAV E +G
Sbjct: 62  RKGVEAAKRSMVRIPVVNQ-TIPFEVVGRFGAGKVLLKPARPGTGVIAGGAVRAVLEAVG 120

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + +++ K  GS NPHNV++AT E L+S      VA RRG+    L  
Sbjct: 121 IGNILTKCQGSHNPHNVVKATIEGLKSLETREAVAARRGVSPETLMP 167


>gi|85715114|ref|ZP_01046098.1| 30S ribosomal protein S5 [Nitrobacter sp. Nb-311A]
 gi|85698029|gb|EAQ35902.1| 30S ribosomal protein S5 [Nitrobacter sp. Nb-311A]
          Length = 191

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 1/170 (0%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GG+RF F+ LVV+GD K +VGF H  AREVPEA+RKATE+AKRN
Sbjct: 23  FVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFGHGKAREVPEAIRKATESAKRN 82

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKSIG
Sbjct: 83  LTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIQDVVAKSIG 142

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSR 191
           SSNP+N++RATF+ L+ Q  PR V+ RR IK S LQ+RRV    + + + 
Sbjct: 143 SSNPYNMVRATFDALKHQDSPRSVSARRNIKVSTLQSRRV-GGDAEAVAE 191


>gi|145225606|ref|YP_001136284.1| 30S ribosomal protein S5 [Mycobacterium gilvum PYR-GCK]
 gi|189045423|sp|A4TED4|RS5_MYCGI RecName: Full=30S ribosomal protein S5
 gi|145218092|gb|ABP47496.1| SSU ribosomal protein S5P [Mycobacterium gilvum PYR-GCK]
          Length = 222

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 107/173 (61%), Gaps = 1/173 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             ++ ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A+ K  E 
Sbjct: 40  EKSNYLERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEE 99

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HDV+A
Sbjct: 100 ARKNFFRVPLI-GGTVTHPVQGEAAAGVVMLRPASPGTGVIAGGACRAVLECAGVHDVLA 158

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           KS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  + +
Sbjct: 159 KSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLRARREAEA 211


>gi|158319560|ref|YP_001512067.1| ribosomal protein S5 [Alkaliphilus oremlandii OhILAs]
 gi|172048247|sp|A8MLF7|RS5_ALKOO RecName: Full=30S ribosomal protein S5
 gi|158139759|gb|ABW18071.1| ribosomal protein S5 [Alkaliphilus oremlandii OhILAs]
          Length = 168

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 64/167 (38%), Positives = 94/167 (56%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  +     + +++V I RV+  + GGR F FS LV+VGD    VG     A E+P+A+
Sbjct: 3   NKRIDASQLELKEQVVDIKRVTKVVKGGRNFRFSALVIVGDENGYVGVGSGKAMEIPDAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  E AK+N+I V ++ G T+ H+ +G  GAG V++  A  GTG+IAGG +R V E+ G
Sbjct: 63  RKGIEDAKKNLIHVPIV-GTTVPHETIGIFGAGNVLIMPAKEGTGIIAGGPVRTVLELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
             DV AKS+G++N  N++ A    L       +VA  RG     L  
Sbjct: 122 FKDVRAKSLGTNNAKNMVNAAINGLSQLKRAEEVAKLRGKSVEELLG 168


>gi|326793575|ref|YP_004311395.1| ribosomal protein S5 [Marinomonas mediterranea MMB-1]
 gi|326544339|gb|ADZ89559.1| ribosomal protein S5 [Marinomonas mediterranea MMB-1]
          Length = 166

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 79/164 (48%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E++ + + +++V +NRV+  + GGR F+F+ L VVGD   KVGF    AREVP+A++KA
Sbjct: 4   NEQQTSDLQEKLVQVNRVAKVVKGGRIFSFTALTVVGDGNGKVGFGRGKAREVPQAIQKA 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM+SV  LDG TL +     HGA KV M+ A  GTGVIAGGA+RAV E+ G+H+
Sbjct: 64  MEQARRNMVSV-RLDGDTLQYPVKAAHGASKVYMQPASQGTGVIAGGAMRAVLEIAGVHN 122

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK  GS+NP NV+RAT + L+    P  VA +RG     +  
Sbjct: 123 VLAKCYGSTNPVNVVRATIKGLQDMKAPEQVAAKRGKSVDQILG 166


>gi|319948706|ref|ZP_08022827.1| 30S ribosomal protein S5 [Dietzia cinnamea P4]
 gi|319437608|gb|EFV92607.1| 30S ribosomal protein S5 [Dietzia cinnamea P4]
          Length = 219

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/173 (40%), Positives = 105/173 (60%), Gaps = 1/173 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             +  ++R+V INRVS  + GGRRF+F+ LV++GD    VG  +  A+EVP A++K  E 
Sbjct: 48  EKSQYIERVVTINRVSKVVKGGRRFSFTALVILGDGNGMVGVGYGKAKEVPAAIQKGNEE 107

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G++D++ 
Sbjct: 108 ARKNFFRVPLI-GSTIPHPIQGEAAAGVVMLRPASPGTGVIAGGAARAVLEAAGVNDILC 166

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           KS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ +++   +
Sbjct: 167 KSLGSDNAINVVHATVAALKGLHRPEEVAARRGLPIEDVAPAGMLRARAGQGA 219


>gi|15226167|ref|NP_180936.1| ribosomal protein S5 family protein [Arabidopsis thaliana]
 gi|75101015|sp|P93014|RR5_ARATH RecName: Full=30S ribosomal protein S5, chloroplastic; Flags:
           Precursor
 gi|1707008|gb|AAC69132.1| 30S ribosomal protein S5 [Arabidopsis thaliana]
 gi|15450886|gb|AAK96714.1| 30S ribosomal protein S5 [Arabidopsis thaliana]
 gi|20259882|gb|AAM13288.1| 30S ribosomal protein S5 [Arabidopsis thaliana]
 gi|21593322|gb|AAM65271.1| 30S ribosomal protein S5 [Arabidopsis thaliana]
 gi|330253794|gb|AEC08888.1| 30S ribosomal protein S5 [Arabidopsis thaliana]
          Length = 303

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/165 (37%), Positives = 95/165 (57%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
              +++  +   +R+V + RV+  + GG++  F  +VVVGD +  VG   + A+EV  AV
Sbjct: 137 KPKKDKIRDGFEERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQGNVGVGCAKAKEVVAAV 196

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +K+   A+RN++ V +    T  H   G +GA KV++R A  GTGVIAGGA+R V E+ G
Sbjct: 197 QKSAIDARRNIVQVPMTKYSTFPHRSEGDYGAAKVMLRPASPGTGVIAGGAVRIVLEMAG 256

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + + + K +GS+N  N  RAT   ++     RDVA  RGI    L
Sbjct: 257 VENALGKQLGSNNALNNARATLAAVQQMRQFRDVAQERGIPMEEL 301


>gi|75313851|sp|Q9ST69|RR5_SPIOL RecName: Full=30S ribosomal protein S5, chloroplastic; Flags:
           Precursor
 gi|188036206|pdb|3BBN|E Chain E, Homology Model For The Spinach Chloroplast 30s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome.
 gi|5725342|emb|CAA63650.1| ribosomal protein S5 [Spinacia oleracea]
          Length = 308

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 94/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +   +E+  +   + +V + RV+  + GG+   F  +VVVGD K +VG     A+EV  A
Sbjct: 141 SKSKKEKIRDGFEENVVQVRRVTKVVKGGKHMRFRAIVVVGDKKGQVGVGVGKAKEVVSA 200

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           V+KA   A+RN+I+V +    T  H     +GA +V++R A  GTGVIAGGA+R V E+ 
Sbjct: 201 VQKAAVDARRNIITVPMTKYLTFPHRNEADYGAARVMLRPAAPGTGVIAGGAVRTVLEMA 260

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G+ + + K +GS+N  N  RAT   +++     DVA  RGI    L
Sbjct: 261 GVENALGKQLGSNNALNNARATIVAVQTMRQFSDVARDRGIPMEEL 306


>gi|312205713|gb|ADQ48073.1| 30S subunit ribosomal protein S5 [Neisseria gonorrhoeae]
 gi|312205717|gb|ADQ48075.1| 30S subunit ribosomal protein S5 [Neisseria gonorrhoeae]
          Length = 172

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/167 (42%), Positives = 108/167 (64%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               EER + +++++VA+NRV   + GGR  AFS L VVGD   ++G     ++EVP AV
Sbjct: 3   KHEIEERGDGLIEKMVAVNRVPKVVKGGRIMAFSALTVVGDGDGRIGMGKGKSKEVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+R+MI V L +  T+HH+ +GRHGA KV M+ A  G+GV AGG +R V + +G
Sbjct: 63  QKAMDQARRSMIKVPLKN-GTIHHEVIGRHGATKVFMQPAKEGSGVKAGGPMRLVFDAMG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +H++ AK  GS+NP+N++RAT + L     P D+A +RG+    +  
Sbjct: 122 IHNISAKVHGSTNPYNIVRATLDGLSKLHTPADIAAKRGLTVEDILG 168


>gi|323483284|ref|ZP_08088674.1| hypothetical protein HMPREF9474_00423 [Clostridium symbiosum
           WAL-14163]
 gi|323691218|ref|ZP_08105494.1| small subunit ribosomal protein S5 [Clostridium symbiosum
           WAL-14673]
 gi|323403382|gb|EGA95690.1| hypothetical protein HMPREF9474_00423 [Clostridium symbiosum
           WAL-14163]
 gi|323504737|gb|EGB20523.1| small subunit ribosomal protein S5 [Clostridium symbiosum
           WAL-14673]
          Length = 169

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/166 (40%), Positives = 94/166 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KRTKIDASQFELEDKVVAIKRVSKTVKGGRTMRFSALVVVGDKNGHVGAGMGKAAEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA RN+++V   D  ++ HD +G+ G+  V+++ A  GTG+IAGG  R+V E+ 
Sbjct: 62  IRKGKEAAARNLVAVPFDDNNSIPHDFIGKFGSANVLLKKAPEGTGIIAGGPARSVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G  ++  KS+GS+N  NV+ AT   L     P +VA  RG     +
Sbjct: 122 GYKNIRTKSLGSNNKTNVVLATLAGLCEIKTPEEVAKLRGKSVEEI 167


>gi|225387221|ref|ZP_03756985.1| hypothetical protein CLOSTASPAR_00973 [Clostridium asparagiforme
           DSM 15981]
 gi|225046700|gb|EEG56946.1| hypothetical protein CLOSTASPAR_00973 [Clostridium asparagiforme
           DSM 15981]
          Length = 169

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 95/168 (56%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                E     + D++VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KRTIIEASQLELNDKVVAIKRVSKTVKGGRTMRFSALVVVGDGNGHVGVGTGKAGEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA +N++ + + + +++ HD +G+ G+  V+++ A  GTG+IAGG  RAV E+ 
Sbjct: 62  IRKGKEAAVKNLVEIPIDENKSIPHDFIGKFGSASVLLKRAPEGTGIIAGGPARAVVELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L     P + A  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKTNVVLATLAGLTELKTPEEFARLRGKSVDEILG 169


>gi|108798005|ref|YP_638202.1| 30S ribosomal protein S5 [Mycobacterium sp. MCS]
 gi|119867101|ref|YP_937053.1| 30S ribosomal protein S5 [Mycobacterium sp. KMS]
 gi|126433669|ref|YP_001069360.1| 30S ribosomal protein S5 [Mycobacterium sp. JLS]
 gi|108768424|gb|ABG07146.1| SSU ribosomal protein S5P [Mycobacterium sp. MCS]
 gi|119693190|gb|ABL90263.1| SSU ribosomal protein S5P [Mycobacterium sp. KMS]
 gi|126233469|gb|ABN96869.1| SSU ribosomal protein S5P [Mycobacterium sp. JLS]
          Length = 223

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/178 (40%), Positives = 108/178 (60%), Gaps = 1/178 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
            ++ ++R+V+INRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E A
Sbjct: 42  KSNYLERVVSINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEA 101

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           ++    V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HD++AK
Sbjct: 102 RKGFFRVPLI-GGTIVHPVQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGVHDILAK 160

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           S+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  + +  + + 
Sbjct: 161 SLGSDNAINVVHATVAALKQIQRPEEVAARRGLPLEDVAPASMLKARREADALAASSS 218


>gi|15674304|ref|NP_268477.1| 30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS]
 gi|19745258|ref|NP_606394.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS8232]
 gi|21909593|ref|NP_663861.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS315]
 gi|28894971|ref|NP_801321.1| 30S ribosomal protein S5 [Streptococcus pyogenes SSI-1]
 gi|50913456|ref|YP_059428.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS10394]
 gi|56807861|ref|ZP_00365697.1| COG0098: Ribosomal protein S5 [Streptococcus pyogenes M49 591]
 gi|71902726|ref|YP_279529.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS6180]
 gi|71909875|ref|YP_281425.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS5005]
 gi|94987692|ref|YP_595793.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS9429]
 gi|94989572|ref|YP_597672.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS10270]
 gi|94991561|ref|YP_599660.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS2096]
 gi|94993461|ref|YP_601559.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS10750]
 gi|139472944|ref|YP_001127659.1| 30S ribosomal protein S5 [Streptococcus pyogenes str. Manfredo]
 gi|306828243|ref|ZP_07461503.1| 30S ribosomal protein S5 [Streptococcus pyogenes ATCC 10782]
 gi|54039522|sp|P66584|RS5_STRP3 RecName: Full=30S ribosomal protein S5
 gi|54039523|sp|P66585|RS5_STRP8 RecName: Full=30S ribosomal protein S5
 gi|54041972|sp|P66583|RS5_STRP1 RecName: Full=30S ribosomal protein S5
 gi|73919106|sp|Q5XEB8|RS5_STRP6 RecName: Full=30S ribosomal protein S5
 gi|91207893|sp|Q48VT2|RS5_STRPM RecName: Full=30S ribosomal protein S5
 gi|171769759|sp|A2RC31|RS5_STRPG RecName: Full=30S ribosomal protein S5
 gi|172046191|sp|Q1JJ45|RS5_STRPD RecName: Full=30S ribosomal protein S5
 gi|172046192|sp|Q1JP00|RS5_STRPC RecName: Full=30S ribosomal protein S5
 gi|172046735|sp|Q1J8Z6|RS5_STRPF RecName: Full=30S ribosomal protein S5
 gi|172046736|sp|Q1JE42|RS5_STRPB RecName: Full=30S ribosomal protein S5
 gi|13621385|gb|AAK33199.1| 30S ribosomal protein S5 [Streptococcus pyogenes M1 GAS]
 gi|19747353|gb|AAL96893.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS8232]
 gi|21903774|gb|AAM78664.1| 30S ribosomal protein S5 [Streptococcus pyogenes MGAS315]
 gi|28810216|dbj|BAC63154.1| 30S ribosomal protein S5 [Streptococcus pyogenes SSI-1]
 gi|50902530|gb|AAT86245.1| SSU ribosomal protein S5P [Streptococcus pyogenes MGAS10394]
 gi|71801821|gb|AAX71174.1| SSU ribosomal protein S5P [Streptococcus pyogenes MGAS6180]
 gi|71852657|gb|AAZ50680.1| SSU ribosomal protein S5P [Streptococcus pyogenes MGAS5005]
 gi|94541200|gb|ABF31249.1| SSU ribosomal protein S5P [Streptococcus pyogenes MGAS9429]
 gi|94543080|gb|ABF33128.1| SSU ribosomal protein S5P [Streptococcus pyogenes MGAS10270]
 gi|94545069|gb|ABF35116.1| SSU ribosomal protein S5P [Streptococcus pyogenes MGAS2096]
 gi|94546969|gb|ABF37015.1| SSU ribosomal protein S5P [Streptococcus pyogenes MGAS10750]
 gi|134271190|emb|CAM29403.1| 30S ribosomal protein S5 [Streptococcus pyogenes str. Manfredo]
 gi|304429554|gb|EFM32603.1| 30S ribosomal protein S5 [Streptococcus pyogenes ATCC 10782]
          Length = 164

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VAINRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA EAAK+
Sbjct: 9   ELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRVGFGTGKAQEVPEAIRKAVEAAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           NMI V ++ G T+ H+     G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NMIEVPMV-GTTIPHEVYTNFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGVADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|25027108|ref|NP_737162.1| 30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
 gi|259506762|ref|ZP_05749662.1| 30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
 gi|73919048|sp|Q8FS52|RS5_COREF RecName: Full=30S ribosomal protein S5
 gi|23492388|dbj|BAC17362.1| putative 30S ribosomal protein S5 [Corynebacterium efficiens
           YS-314]
 gi|259165633|gb|EEW50187.1| 30S ribosomal protein S5 [Corynebacterium efficiens YS-314]
          Length = 211

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 69/177 (38%), Positives = 109/177 (61%), Gaps = 1/177 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD +  VG  +  A+EVP A++K
Sbjct: 36  QQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGQGMVGVGYGKAKEVPAAIQK 95

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E A++N   V ++ G T+ H   G   AG V+++ A  GTGVIAGGA R V E  G+ 
Sbjct: 96  GAEEARKNFFRVPMV-GGTITHPVQGEAAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQ 154

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           D+++KS+GS N  NV+ AT + L+    P +VA RRG     +   R++ +++   +
Sbjct: 155 DILSKSLGSDNAINVVHATVDGLKQLVRPEEVAARRGKTVEEVAPARILRARAGQEA 211


>gi|226942795|ref|YP_002797868.1| 30S ribosomal protein S5 [Azotobacter vinelandii DJ]
 gi|259495304|sp|C1DKN0|RS5_AZOVD RecName: Full=30S ribosomal protein S5
 gi|226717722|gb|ACO76893.1| 30S ribosomal protein S5 [Azotobacter vinelandii DJ]
          Length = 166

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 78/164 (47%), Positives = 107/164 (65%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNEQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L  G TL +     HGA +V M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDLS-GTTLQYPVKSAHGASRVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            +V+AK  GS+NP NV+ ATF+ L+    P  VA +RG     +
Sbjct: 122 QNVLAKCYGSTNPVNVVYATFKGLKEMQSPESVAAKRGKSVEEI 165


>gi|116671505|ref|YP_832438.1| 30S ribosomal protein S5 [Arthrobacter sp. FB24]
 gi|171855201|sp|A0JZ68|RS5_ARTS2 RecName: Full=30S ribosomal protein S5
 gi|116611614|gb|ABK04338.1| SSU ribosomal protein S5P [Arthrobacter sp. FB24]
          Length = 236

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/175 (42%), Positives = 107/175 (61%), Gaps = 1/175 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E   +  V+R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  
Sbjct: 61  EAEKSQFVERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAAIAKGV 120

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK++   V  + G T+ H   G   AG V++R A AGTGVIAGG +RAV E +G+HD+
Sbjct: 121 EEAKKSFFRVPRI-GSTIPHRVQGEAAAGVVMLRPASAGTGVIAGGPVRAVLECVGIHDI 179

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           ++KS+GSSN  N++ AT + L+    P  VA RRG+    +    +V +  +  +
Sbjct: 180 LSKSLGSSNAINIVHATVDALKRLEEPAAVAARRGLPLDEIAPAAMVKALMNQKA 234


>gi|39936296|ref|NP_948572.1| 30S ribosomal protein S5 [Rhodopseudomonas palustris CGA009]
 gi|192292020|ref|YP_001992625.1| 30S ribosomal protein S5 [Rhodopseudomonas palustris TIE-1]
 gi|73919093|sp|Q6N4V0|RS5_RHOPA RecName: Full=30S ribosomal protein S5; AltName: Full=RRP-S5
 gi|226703381|sp|B3QBW3|RS5_RHOPT RecName: Full=30S ribosomal protein S5
 gi|39650151|emb|CAE28674.1| ribosomal protein S5 [Rhodopseudomonas palustris CGA009]
 gi|192285769|gb|ACF02150.1| ribosomal protein S5 [Rhodopseudomonas palustris TIE-1]
          Length = 191

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 103/160 (64%), Positives = 127/160 (79%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GG+RF F+ LVVVGD K +VGF H  AREVPEA+RKATE+AKRN
Sbjct: 23  FVDKLVHINRVAKVVKGGKRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATESAKRN 82

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKS+G
Sbjct: 83  LTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIADVVAKSVG 142

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           SSNP+N++RATF+ L+    PR VA RR IK S LQARRV
Sbjct: 143 SSNPYNMVRATFDALKHLDSPRSVAARRNIKVSTLQARRV 182


>gi|90414973|ref|ZP_01222935.1| putative ribosomal subunit protein S5 [Photobacterium profundum
           3TCK]
 gi|90323912|gb|EAS40512.1| putative ribosomal subunit protein S5 [Photobacterium profundum
           3TCK]
          Length = 165

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E+  + + ++++A+NRVS  + GGR F+F+ L VVGD   ++GF +  AREVP A++K+
Sbjct: 3   NEKTQSDLNEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRIGFGYGKAREVPAAIQKS 62

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNMI+V+L +  TLHH   GRH   KV M+ A  GTG+IAGGA+RAV EV G+ +
Sbjct: 63  MEKARRNMITVAL-NDGTLHHAVKGRHTGSKVYMQPASEGTGIIAGGAMRAVLEVAGIRN 121

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP NV+RAT + L   + P  +A +RG+    +  
Sbjct: 122 VLAKAYGSTNPINVVRATIDGLGGMNSPEMIAAKRGLSVKEILG 165


>gi|291320489|ref|YP_003515753.1| 30S ribosomal protein S5 [Mycoplasma agalactiae]
 gi|290752824|emb|CBH40799.1| 30S ribosomal protein S5 [Mycoplasma agalactiae]
          Length = 231

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 68/181 (37%), Positives = 106/181 (58%), Gaps = 3/181 (1%)

Query: 1   MAQKERSQRDNWQNRE---ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKV 57
           M +K   + +  +NR    E +N   +R+V I+RV+  + GGRRF+FS  VVVGD K KV
Sbjct: 51  MPRKSADRANKVKNRTRFGEANNEFSERVVNISRVTKVVKGGRRFSFSAFVVVGDKKGKV 110

Query: 58  GFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGV 117
           GF H  A EVP+A++KA + A+ ++ISV + +  T+ H+   +  A KV+++ A  G G+
Sbjct: 111 GFGHGKANEVPDAIKKAVKDARNHLISVPIQNKITVPHEIHAKFLASKVMLKPAPKGKGI 170

Query: 118 IAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +A G +RAV E+ G  D+  K+ GS +  N++RAT + L+    P  +A  R      L 
Sbjct: 171 VASGTVRAVVELAGYTDIYTKTYGSRSKANIVRATLKALQQLRTPEQIAEIRDKDVKDLL 230

Query: 178 A 178
            
Sbjct: 231 G 231


>gi|329117816|ref|ZP_08246533.1| ribosomal protein S5 [Streptococcus parauberis NCFD 2020]
 gi|326908221|gb|EGE55135.1| ribosomal protein S5 [Streptococcus parauberis NCFD 2020]
          Length = 164

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/157 (47%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+V+INRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA EAAK+
Sbjct: 9   ELEERVVSINRVTKVVKGGRRLRFAALVVVGDGNGRVGFGTGKAQEVPEAIRKAVEAAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           NMI V ++ G T+ H+     G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NMIEVPMV-GTTIPHEVFTNFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGIADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      DVA  RG+  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEDVAALRGVSVSDLA 164


>gi|227501151|ref|ZP_03931200.1| ribosomal protein S5 [Anaerococcus tetradius ATCC 35098]
 gi|227216736|gb|EEI82137.1| ribosomal protein S5 [Anaerococcus tetradius ATCC 35098]
          Length = 169

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/164 (43%), Positives = 99/164 (60%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E    ++ DR+VAINRV+  + GGR   FS LVVVG+    VG     A EVPEA+RK
Sbjct: 6   RSEVEKLNLEDRVVAINRVAKTVKGGRNIRFSALVVVGNGNGYVGIGTGKATEVPEAIRK 65

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A+E AK++MI+V ++ G T+ H   G   +G+V++  A  GTG+IAGG +RAVCE+ G  
Sbjct: 66  ASEDAKKHMINVPIV-GTTIPHRIHGSKASGRVLLMPAKEGTGIIAGGPVRAVCELAGYK 124

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D+ AK++G+SNP N+I A  E   S     +VA  RG       
Sbjct: 125 DIRAKNLGTSNPRNIINACIEAFSSMKTVEEVARLRGKSVEEFD 168


>gi|38233136|ref|NP_938903.1| 30S ribosomal protein S5 [Corynebacterium diphtheriae NCTC 13129]
 gi|73919047|sp|Q6NJ85|RS5_CORDI RecName: Full=30S ribosomal protein S5
 gi|38199395|emb|CAE49038.1| 30S ribosomal protein S5 [Corynebacterium diphtheriae]
          Length = 208

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/178 (39%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
             +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A++
Sbjct: 32  NQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQ 91

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E A++N   V ++   T+ H   G   AG V+MR A  GTGVIAGGA R V E  G+
Sbjct: 92  KGAEEARKNFFRVPMV-AGTITHPVQGEAAAGIVMMRPAAPGTGVIAGGAARPVLECAGV 150

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
            D++ KS+GS N  NV+ AT   L+  + P +VA RRG     +   R++ +++   +
Sbjct: 151 QDILCKSLGSDNAINVVHATVAGLKQLNRPEEVAARRGKTLEEVAPARMLRARAGQEA 208


>gi|260886893|ref|ZP_05898156.1| ribosomal protein S5 [Selenomonas sputigena ATCC 35185]
 gi|330839309|ref|YP_004413889.1| ribosomal protein S5 [Selenomonas sputigena ATCC 35185]
 gi|260863492|gb|EEX77992.1| ribosomal protein S5 [Selenomonas sputigena ATCC 35185]
 gi|329747073|gb|AEC00430.1| ribosomal protein S5 [Selenomonas sputigena ATCC 35185]
          Length = 176

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 76/161 (47%), Positives = 102/161 (63%), Gaps = 1/161 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
                 +++V INRV+  + GGRRF+FS LVVVG+ K KVG     A EVPEA+RK  E 
Sbjct: 17  ETPEFEEKVVYINRVAKVVKGGRRFSFSALVVVGNKKGKVGAGLGKASEVPEAIRKGIED 76

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           AK+N+I VSL    T+ H+ +G  GAG+V+++ A  GTGVIAGG  RAV E+ G+ D++ 
Sbjct: 77  AKKNLIEVSL-KDTTIPHEMIGIFGAGRVLLKPAAKGTGVIAGGPARAVLELAGIRDILT 135

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           KS+GSSNP+N++RAT + L        VA  RG     L  
Sbjct: 136 KSLGSSNPNNMVRATVKGLEQLKRAEAVAELRGKTVQELLG 176


>gi|160941053|ref|ZP_02088391.1| hypothetical protein CLOBOL_05946 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436002|gb|EDP13769.1| hypothetical protein CLOBOL_05946 [Clostridium bolteae ATCC
           BAA-613]
          Length = 169

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + D++VAI RVS  + GGR   FS LVVVGD    VG     A EVPEA
Sbjct: 2   KRTIIDASQMELNDKVVAIKRVSKTVKGGRTMRFSALVVVGDGNGHVGAGLGKAGEVPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAA +N++ + + + +++ HD +G+ G+  V+++ A  GTGVIAGG  R+V E+ 
Sbjct: 62  IRKGKEAAIKNLVEIPVDENKSIPHDFIGKFGSAAVLLKRAPEGTGVIAGGPARSVLEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT   L S   P + A  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKTNVVLATLAGLTSLKTPEEFARLRGKSVEEIVG 169


>gi|315445959|ref|YP_004078838.1| 30S ribosomal protein S5P [Mycobacterium sp. Spyr1]
 gi|315264262|gb|ADU01004.1| SSU ribosomal protein S5P [Mycobacterium sp. Spyr1]
          Length = 222

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 107/173 (61%), Gaps = 1/173 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             ++ ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A+ K  E 
Sbjct: 40  EKSNYLERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEE 99

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HDV+A
Sbjct: 100 ARKNFFRVPLI-GGTVTHPVQGEAAAGVVMLRPASPGTGVIAGGACRAVLECAGVHDVLA 158

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           KS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  + +
Sbjct: 159 KSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLRARREAEA 211


>gi|254818380|ref|ZP_05223381.1| 30S ribosomal protein S5 [Mycobacterium intracellulare ATCC 13950]
          Length = 226

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 73/170 (42%), Positives = 104/170 (61%), Gaps = 1/170 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
            ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E A
Sbjct: 40  KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEA 99

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           ++    V L+   T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HD++AK
Sbjct: 100 RKGFFRVPLIR-GTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVHDILAK 158

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           S+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S
Sbjct: 159 SLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRES 208


>gi|255526595|ref|ZP_05393502.1| ribosomal protein S5 [Clostridium carboxidivorans P7]
 gi|296187283|ref|ZP_06855679.1| ribosomal protein S5 [Clostridium carboxidivorans P7]
 gi|255509703|gb|EET86036.1| ribosomal protein S5 [Clostridium carboxidivorans P7]
 gi|296048154|gb|EFG87592.1| ribosomal protein S5 [Clostridium carboxidivorans P7]
          Length = 165

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 99/165 (60%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FS LVVVGD    VG     + E+PEA+RK
Sbjct: 2   RIDPSTLNLKEKVVFINRVAKVVKGGRNFRFSALVVVGDENGHVGVGTGKSIEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ V+++ G T+ HD  G  G G+V++ +A  GTGVIAGG  RAV E+ G+ 
Sbjct: 62  GIEDAKKNLVEVAMV-GTTVPHDIQGEFGTGRVLIMTASEGTGVIAGGPARAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS+GS+NP N++ AT   L        VAN RG     +  
Sbjct: 121 DVRAKSLGSNNPRNMVNATINGLSRLRTVEHVANLRGKSVEEILG 165


>gi|15900163|ref|NP_344767.1| 30S ribosomal protein S5 [Streptococcus pneumoniae TIGR4]
 gi|15902250|ref|NP_357800.1| 30S ribosomal protein S5 [Streptococcus pneumoniae R6]
 gi|111658784|ref|ZP_01409415.1| hypothetical protein SpneT_02000081 [Streptococcus pneumoniae
           TIGR4]
 gi|116515495|ref|YP_815729.1| 30S ribosomal protein S5 [Streptococcus pneumoniae D39]
 gi|148983626|ref|ZP_01816945.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP3-BS71]
 gi|148987964|ref|ZP_01819427.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP6-BS73]
 gi|148992804|ref|ZP_01822447.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP9-BS68]
 gi|148996649|ref|ZP_01824367.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP11-BS70]
 gi|149001666|ref|ZP_01826639.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP14-BS69]
 gi|149005978|ref|ZP_01829707.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP18-BS74]
 gi|149011097|ref|ZP_01832402.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP19-BS75]
 gi|149017917|ref|ZP_01834376.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP23-BS72]
 gi|168483864|ref|ZP_02708816.1| ribosomal protein S5 [Streptococcus pneumoniae CDC1873-00]
 gi|168486006|ref|ZP_02710514.1| ribosomal protein S5 [Streptococcus pneumoniae CDC1087-00]
 gi|168489704|ref|ZP_02713903.1| ribosomal protein S5 [Streptococcus pneumoniae SP195]
 gi|168492181|ref|ZP_02716324.1| ribosomal protein S5 [Streptococcus pneumoniae CDC0288-04]
 gi|168493921|ref|ZP_02718064.1| ribosomal protein S5 [Streptococcus pneumoniae CDC3059-06]
 gi|168576346|ref|ZP_02722229.1| ribosomal protein S5 [Streptococcus pneumoniae MLV-016]
 gi|169832562|ref|YP_001693758.1| 30S ribosomal protein S5 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683205|ref|YP_001834952.1| 30S ribosomal protein S5 [Streptococcus pneumoniae CGSP14]
 gi|194398026|ref|YP_002036927.1| 30S ribosomal protein S5 [Streptococcus pneumoniae G54]
 gi|221231130|ref|YP_002510282.1| 30S ribosomal protein S5 [Streptococcus pneumoniae ATCC 700669]
 gi|225853832|ref|YP_002735344.1| 30S ribosomal protein S5 [Streptococcus pneumoniae JJA]
 gi|225855991|ref|YP_002737502.1| 30S ribosomal protein S5 [Streptococcus pneumoniae P1031]
 gi|225858080|ref|YP_002739590.1| 30S ribosomal protein S5 [Streptococcus pneumoniae 70585]
 gi|225860268|ref|YP_002741777.1| 30S ribosomal protein S5 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649706|ref|ZP_04523958.1| 30S ribosomal protein S5 [Streptococcus pneumoniae CCRI 1974]
 gi|237821404|ref|ZP_04597249.1| 30S ribosomal protein S5 [Streptococcus pneumoniae CCRI 1974M2]
 gi|298230383|ref|ZP_06964064.1| 30S ribosomal protein S5 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298256004|ref|ZP_06979590.1| 30S ribosomal protein S5 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502040|ref|YP_003723980.1| 30S ribosomal protein S5 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255078|ref|ZP_07341154.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS455]
 gi|303259278|ref|ZP_07345256.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP-BS293]
 gi|303261033|ref|ZP_07346982.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP14-BS292]
 gi|303263361|ref|ZP_07349284.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS397]
 gi|303265526|ref|ZP_07351426.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS457]
 gi|303267916|ref|ZP_07353718.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS458]
 gi|307066904|ref|YP_003875870.1| hypothetical protein SPAP_0275 [Streptococcus pneumoniae AP200]
 gi|307126446|ref|YP_003878477.1| 30S ribosomal protein S5 [Streptococcus pneumoniae 670-6B]
 gi|54039521|sp|P66582|RS5_STRR6 RecName: Full=30S ribosomal protein S5
 gi|54041971|sp|P66581|RS5_STRPN RecName: Full=30S ribosomal protein S5
 gi|122279385|sp|Q04ML9|RS5_STRP2 RecName: Full=30S ribosomal protein S5
 gi|14971696|gb|AAK74407.1| ribosomal protein S5 [Streptococcus pneumoniae TIGR4]
 gi|15457751|gb|AAK99010.1| 30S Ribosomal protein S5 [Streptococcus pneumoniae R6]
 gi|116076071|gb|ABJ53791.1| ribosomal protein S5 [Streptococcus pneumoniae D39]
 gi|147757224|gb|EDK64263.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP11-BS70]
 gi|147760124|gb|EDK67113.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP14-BS69]
 gi|147762334|gb|EDK69295.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP18-BS74]
 gi|147764733|gb|EDK71663.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP19-BS75]
 gi|147923773|gb|EDK74885.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP3-BS71]
 gi|147926428|gb|EDK77501.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP6-BS73]
 gi|147928530|gb|EDK79545.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP9-BS68]
 gi|147931481|gb|EDK82459.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP23-BS72]
 gi|168995064|gb|ACA35676.1| ribosomal protein S5 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042829|gb|EDT50875.1| ribosomal protein S5 [Streptococcus pneumoniae CDC1873-00]
 gi|182628539|gb|ACB89487.1| 30S ribosomal protein S5 [Streptococcus pneumoniae CGSP14]
 gi|183570907|gb|EDT91435.1| ribosomal protein S5 [Streptococcus pneumoniae CDC1087-00]
 gi|183571806|gb|EDT92334.1| ribosomal protein S5 [Streptococcus pneumoniae SP195]
 gi|183573639|gb|EDT94167.1| ribosomal protein S5 [Streptococcus pneumoniae CDC0288-04]
 gi|183576104|gb|EDT96632.1| ribosomal protein S5 [Streptococcus pneumoniae CDC3059-06]
 gi|183577788|gb|EDT98316.1| ribosomal protein S5 [Streptococcus pneumoniae MLV-016]
 gi|194357693|gb|ACF56141.1| 30S ribosomal protein S5 [Streptococcus pneumoniae G54]
 gi|220673590|emb|CAR68076.1| 30S ribosomal protein S5 [Streptococcus pneumoniae ATCC 700669]
 gi|225721594|gb|ACO17448.1| ribosomal protein S5 [Streptococcus pneumoniae 70585]
 gi|225723103|gb|ACO18956.1| ribosomal protein S5 [Streptococcus pneumoniae JJA]
 gi|225726119|gb|ACO21971.1| ribosomal protein S5 [Streptococcus pneumoniae P1031]
 gi|225726668|gb|ACO22519.1| ribosomal protein S5 [Streptococcus pneumoniae Taiwan19F-14]
 gi|298237635|gb|ADI68766.1| 30S ribosomal protein S5 [Streptococcus pneumoniae TCH8431/19A]
 gi|301793499|emb|CBW35872.1| 30S ribosomal protein S5 [Streptococcus pneumoniae INV104]
 gi|301799375|emb|CBW31910.1| 30S ribosomal protein S5 [Streptococcus pneumoniae OXC141]
 gi|301801170|emb|CBW33843.1| 30S ribosomal protein S5 [Streptococcus pneumoniae INV200]
 gi|302597908|gb|EFL64978.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS455]
 gi|302637870|gb|EFL68356.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP14-BS292]
 gi|302639696|gb|EFL70153.1| 30S ribosomal protein S5 [Streptococcus pneumoniae SP-BS293]
 gi|302642612|gb|EFL72957.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS458]
 gi|302644966|gb|EFL75213.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS457]
 gi|302647134|gb|EFL77358.1| 30S ribosomal protein S5 [Streptococcus pneumoniae BS397]
 gi|306408441|gb|ADM83868.1| hypothetical protein SPAP_0275 [Streptococcus pneumoniae AP200]
 gi|306483508|gb|ADM90377.1| ribosomal protein S5 [Streptococcus pneumoniae 670-6B]
 gi|327390645|gb|EGE88985.1| ribosomal protein S5 [Streptococcus pneumoniae GA04375]
 gi|332075891|gb|EGI86358.1| ribosomal protein S5 [Streptococcus pneumoniae GA17570]
 gi|332076672|gb|EGI87134.1| ribosomal protein S5 [Streptococcus pneumoniae GA17545]
 gi|332077527|gb|EGI87988.1| ribosomal protein S5 [Streptococcus pneumoniae GA41301]
          Length = 164

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/157 (45%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VA+NRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA + AK+
Sbjct: 9   ELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRVGFGTGKAQEVPEAIRKAVDDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVVELAGVADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      ++A  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEIAALRGISVSDLA 164


>gi|300857788|ref|YP_003782771.1| 30S ribosomal protein S5 [Corynebacterium pseudotuberculosis FRC41]
 gi|300685242|gb|ADK28164.1| 30S ribosomal protein S5 [Corynebacterium pseudotuberculosis FRC41]
 gi|302330080|gb|ADL20274.1| 30S ribosomal protein S5 [Corynebacterium pseudotuberculosis 1002]
          Length = 208

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
             +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A++
Sbjct: 32  NQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQ 91

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E A++N   V ++   T+ H   G   AG V+MR A  GTGVIAGGA R V E  G+
Sbjct: 92  KGAEEARKNFFRVPMV-AGTITHPVQGEAAAGIVMMRPAAPGTGVIAGGAARPVLECAGV 150

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
            D++ KS+G+ N  NV+ AT   L+  + P +VA RRG     +   R++ +++   +
Sbjct: 151 QDILCKSLGTDNAINVVHATVAGLKQLNRPEEVAARRGKTLEEVAPARMLRARAGQEA 208


>gi|240167726|ref|ZP_04746385.1| 30S ribosomal protein S5 [Mycobacterium kansasii ATCC 12478]
          Length = 218

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 73/170 (42%), Positives = 104/170 (61%), Gaps = 1/170 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
            ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E A
Sbjct: 36  KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEA 95

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           ++    V L+   T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HD++AK
Sbjct: 96  RKGFFRVPLIR-GTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVHDILAK 154

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           S+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S
Sbjct: 155 SLGSDNAINVVHATVAALKMLQRPEEVAARRGLPIEDVAPAGMLKARRES 204


>gi|313889572|ref|ZP_07823217.1| ribosomal protein S5 [Streptococcus pseudoporcinus SPIN 20026]
 gi|313122081|gb|EFR45175.1| ribosomal protein S5 [Streptococcus pseudoporcinus SPIN 20026]
          Length = 164

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 75/157 (47%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VAINRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA EAAK+
Sbjct: 9   ELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRVGFGTGKAQEVPEAIRKAVEAAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           NMI V ++ G T+ H+     G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NMIEVPMV-GTTIPHEVFTNFGGAKVLLKPAVEGSGVAAGGAVRAVVELAGIADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RG+  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGVSISDLA 164


>gi|330752365|emb|CBL87318.1| ribosomal protein S5 [uncultured Sphingobacteria bacterium]
          Length = 172

 Score =  169 bits (427), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 68/168 (40%), Positives = 100/168 (59%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
              +  +  D  + + +V INRV+    GGR F+F+ +VVVGD    VG     A EV +
Sbjct: 4   QTLKQVKTTDLELKETVVNINRVAKVTKGGRTFSFNAIVVVGDGNGIVGHGLGKAGEVID 63

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++K  E AK+N+I V +++  ++ H+  G++  G V M+ A  GTG+IAGGA+RAV + 
Sbjct: 64  AIQKGIEDAKKNLIRVPIIN-HSIPHEQYGKYSGGYVFMKPASHGTGIIAGGAMRAVFDS 122

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            G+ DV+AKS GSSNPHNV++AT + L        VA  RG   S + 
Sbjct: 123 AGVKDVLAKSKGSSNPHNVVKATMDALSKLRDAYTVAEHRGASLSKVF 170


>gi|148377792|ref|YP_001256668.1| 30S ribosomal protein S5 [Mycoplasma agalactiae PG2]
 gi|254765696|sp|A5IYW9|RS5_MYCAP RecName: Full=30S ribosomal protein S5
 gi|148291838|emb|CAL59228.1| 30S ribosomal protein S5 [Mycoplasma agalactiae PG2]
          Length = 231

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 64/174 (36%), Positives = 101/174 (58%)

Query: 5   ERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTA 64
             ++  N     E +N   +++V I+RV+  + GGRRF+FS  VVVGD K KVGF H  A
Sbjct: 58  RANKVKNRTRFGEANNEFSEKVVNISRVTKVVKGGRRFSFSAFVVVGDKKGKVGFGHGKA 117

Query: 65  REVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIR 124
            EVP+A++KA + A+ ++ISV + +  T+ H+   +  A KV+++ A  G G++A G +R
Sbjct: 118 NEVPDAIKKAVKDARNHLISVPIQNKITVPHEIHAKFLASKVMLKPAPKGKGIVASGTVR 177

Query: 125 AVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           AV E+ G  D+  K+ GS +  N++RAT + L+    P  +A  R      L  
Sbjct: 178 AVVELAGYTDIYTKTYGSRSKANIVRATLKALQQLRTPEQIAEIRDKDVKDLLG 231


>gi|260577162|ref|ZP_05845139.1| ribosomal protein S5 [Rhodobacter sp. SW2]
 gi|259020636|gb|EEW23955.1| ribosomal protein S5 [Rhodobacter sp. SW2]
          Length = 188

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 100/167 (59%), Positives = 126/167 (75%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           E      DR+VAINRVS  + GG+RF F+ LVVVGD + +VG+    A+EVPEA+RKATE
Sbjct: 18  EETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGYGKGKAKEVPEAIRKATE 77

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AKR MI V+L DGRTLHHD  GRHGAGKV+MR+A+AGTG+IAGG +RAV E+LG+ DVV
Sbjct: 78  QAKRQMIRVALRDGRTLHHDMEGRHGAGKVVMRTAVAGTGIIAGGPMRAVFEMLGLQDVV 137

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVS 183
           AKSIGSSNP+N+IRAT + L+ ++ PR VA RRG K + +  +    
Sbjct: 138 AKSIGSSNPYNMIRATIDGLKQETSPRQVAQRRGKKVAEILRKPEAE 184


>gi|310659485|ref|YP_003937206.1| 30S ribosomal protein S5 [Clostridium sticklandii DSM 519]
 gi|308826263|emb|CBH22301.1| 30S ribosomal subunit protein S5 [Clostridium sticklandii]
          Length = 168

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 74/167 (44%), Positives = 102/167 (61%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  + R   I ++++ I RV+  + GGR F F+ LVVVGD    VG     A EVPEA+
Sbjct: 3   KKPIDARQLDIEEKVIDIRRVTKVVKGGRNFRFAALVVVGDRNGHVGIGTGKAMEVPEAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA E AK+N+I+V ++ G T+ H   GR+GAG V++  A  GTGVIAGG +R V E+ G
Sbjct: 63  RKAVEDAKKNLITVPIV-GTTVPHRIQGRYGAGNVLIMPAKEGTGVIAGGPVRDVLELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + DV +KS+G++N  NV+ AT + L S     DVA  RG K   L  
Sbjct: 122 LKDVRSKSLGTNNARNVVNATMQGLASLRKIEDVATLRGKKVEDLLG 168


>gi|295093650|emb|CBK82741.1| SSU ribosomal protein S5P [Coprococcus sp. ART55/1]
          Length = 169

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 58/166 (34%), Positives = 95/166 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + D++VAI RV+  + GGR    + LVVVGD    VG     A E PEA
Sbjct: 2   KREIIDASKLELEDKVVAIKRVTKVVKGGRNSRVAALVVVGDRNGHVGVGVGKAVETPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +++++V + +  ++ +D  G+ G+  V++++A  GTG+IAGG  R+V E+ 
Sbjct: 62  IRKGKEDAAKHLVTVPVNEVGSIPYDWNGQFGSASVLLKTAPEGTGIIAGGPARSVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           G  ++  KS+GS+N  NV+ AT + L    +P D+A  RG     +
Sbjct: 122 GYKNIRTKSLGSNNKQNVVLATIKGLTEIKNPEDIARLRGKSVDEI 167


>gi|46579731|ref|YP_010539.1| 30S ribosomal protein S5 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602792|ref|YP_967192.1| 30S ribosomal protein S5 [Desulfovibrio vulgaris DP4]
 gi|73919051|sp|Q72CG3|RS5_DESVH RecName: Full=30S ribosomal protein S5
 gi|171769278|sp|A1VE99|RS5_DESVV RecName: Full=30S ribosomal protein S5
 gi|46449146|gb|AAS95798.1| ribosomal protein S5 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563021|gb|ABM28765.1| SSU ribosomal protein S5P [Desulfovibrio vulgaris DP4]
 gi|311233522|gb|ADP86376.1| ribosomal protein S5 [Desulfovibrio vulgaris RCH1]
          Length = 163

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 82/159 (51%), Positives = 113/159 (71%), Gaps = 1/159 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E+ +  ++++IV +NRV+  + GGRRF+FS LVVVGD K  VGF    A+EVPEA+RKAT
Sbjct: 2   EQNEFGLIEKIVYLNRVAKVVKGGRRFSFSALVVVGDGKGSVGFGLGKAQEVPEALRKAT 61

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK++MI V L+D  TL ++ +GR GAG V+++ A  GTG+IAGGA+RAV E +G+ DV
Sbjct: 62  ERAKKSMIEVPLID-GTLPYEILGRFGAGHVLLKPASKGTGIIAGGAVRAVMEAVGVTDV 120

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           + K+IG++NPHNV+RAT   L S     +V   RG K  
Sbjct: 121 LTKAIGTNNPHNVLRATVAGLASLRSAEEVGQLRGKKLE 159


>gi|319944778|ref|ZP_08019042.1| 30S ribosomal protein S5 [Lautropia mirabilis ATCC 51599]
 gi|319742027|gb|EFV94450.1| 30S ribosomal protein S5 [Lautropia mirabilis ATCC 51599]
          Length = 175

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 80/178 (44%), Positives = 112/178 (62%), Gaps = 3/178 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+ +   R   +  +ERD+ + ++++ INRV+  + GGR   F+ LVVVGD   +VG  
Sbjct: 1   MAKVQ--ARGPQRGADERDDGLKEKMIGINRVTKVVKGGRILGFAALVVVGDGDGRVGMG 58

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVP AV+KA + A+R M  V L    T+ H   GRHGA +V +  A  GTGVIAG
Sbjct: 59  KGKAREVPVAVQKAMDEARRKMFKVPLR-SGTVPHVVEGRHGASRVYIAPAADGTGVIAG 117

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G +RAV EVLG+ +VVAKS GSSNP+N++RAT +  R+ S P ++A +RG     +  
Sbjct: 118 GPMRAVFEVLGVSNVVAKSHGSSNPYNMVRATLDAFRNLSTPAEIAAKRGKTVEEILG 175


>gi|86749432|ref|YP_485928.1| 30S ribosomal protein S5 [Rhodopseudomonas palustris HaA2]
 gi|123098752|sp|Q2IXP3|RS5_RHOP2 RecName: Full=30S ribosomal protein S5
 gi|86572460|gb|ABD07017.1| SSU ribosomal protein S5P [Rhodopseudomonas palustris HaA2]
          Length = 191

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 104/160 (65%), Positives = 127/160 (79%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GG+RF F+ LVV+GD K +VGF H  AREVPEA+RKATEAAKRN
Sbjct: 23  FVDKLVHINRVAKVVKGGKRFGFAALVVIGDQKGRVGFGHGKAREVPEAIRKATEAAKRN 82

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKSIG
Sbjct: 83  LTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIQDVVAKSIG 142

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           SSNP+N++RATF+ L+    PR VA RR IK S LQARRV
Sbjct: 143 SSNPYNMVRATFDALKHVDSPRSVAARRNIKVSTLQARRV 182


>gi|212213233|ref|YP_002304169.1| 30S ribosomal protein S5 [Coxiella burnetii CbuG_Q212]
 gi|212011643|gb|ACJ19024.1| SSU ribosomal protein S5P [Coxiella burnetii CbuG_Q212]
          Length = 168

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 80/159 (50%), Positives = 103/159 (64%), Gaps = 1/159 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           + I +++VA+ R +  + GGR F FS LVV GD   KVGF    AREVP A++KATE A+
Sbjct: 11  DGIQEKLVAVRRTAKVVKGGRVFGFSALVVAGDGDGKVGFGLGKAREVPSAIQKATENAR 70

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RNMISV L  G TLHH     H +  V+M  A  GTGVIAG A+RA+ EV+G+ +V+AK 
Sbjct: 71  RNMISVPLY-GATLHHAIKATHASSTVLMLPASEGTGVIAGNAMRAIFEVMGVQNVLAKC 129

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           IGSSNP NV+RATF+ L+    P  VA +RG     +  
Sbjct: 130 IGSSNPINVVRATFKGLKQMETPESVAAKRGKAIEEIVE 168


>gi|119502941|ref|ZP_01625026.1| 30S ribosomal protein S5 [marine gamma proteobacterium HTCC2080]
 gi|119461287|gb|EAW42377.1| 30S ribosomal protein S5 [marine gamma proteobacterium HTCC2080]
          Length = 174

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 4/178 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA  ++  R   Q  E     + +++V +NRV+  + GGR  +F+ L VVGD K +VG+ 
Sbjct: 1   MAYNDQKGRGGDQRTEG---DLQEKLVQVNRVAKTVKGGRIMSFTALTVVGDGKGRVGYG 57

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              AREVP A++KA EAA+RNM+ V L+D  TL +     HGA KV M+ A  GTGVIAG
Sbjct: 58  RGKAREVPVAIQKAMEAARRNMVKVELVD-GTLQYPVKANHGASKVYMQPASEGTGVIAG 116

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GA+RAV E+ G+H+V+AK  GS+NP NV+RAT++ LR    P  VA RRG     + +
Sbjct: 117 GAMRAVLELAGVHNVLAKCYGSTNPVNVVRATYKGLRDMQSPDAVAARRGKSVEEILS 174


>gi|90417586|ref|ZP_01225504.1| 30S ribosomal protein S5 [marine gamma proteobacterium HTCC2207]
 gi|90330607|gb|EAS45903.1| 30S ribosomal protein S5 [marine gamma proteobacterium HTCC2207]
          Length = 168

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 78/163 (47%), Positives = 112/163 (68%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           ++++    +++++V +NRV+  + GGR FAF+ L VVGD   KVGF    AREVP+A++K
Sbjct: 5   DQKDAAEGMMEKLVQVNRVAKTVKGGRIFAFTALTVVGDGNGKVGFGRGKAREVPQAIQK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E+A+RNMI V+L DG T+ +   G H A K+ M+ A  GTGVIAGGA+R+V E+ G+ 
Sbjct: 65  AMESARRNMIDVAL-DGNTIQYPTKGIHAASKIYMQPASDGTGVIAGGAMRSVLELAGVQ 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +V+AK  GS+NP NV+RATF+ LR    P DVA +RG     +
Sbjct: 124 NVLAKCYGSTNPVNVVRATFKALRDMKSPDDVAAKRGKSVEEI 166


>gi|255282622|ref|ZP_05347177.1| ribosomal protein S5 [Bryantella formatexigens DSM 14469]
 gi|255266915|gb|EET60120.1| ribosomal protein S5 [Bryantella formatexigens DSM 14469]
          Length = 169

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 98/168 (58%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V+I RV+  + GG+   F+ LVVVGD    VG     A+E+PEA
Sbjct: 2   KREIIDANSLELNEKVVSIKRVTKVVKGGKNMKFTALVVVGDGNGHVGAGLGKAKEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+I+V+L D  ++ HD  G+ G   V+++ A  GTGVIAGG  R V E+ 
Sbjct: 62  IRKGKEDAAKNLINVALDDNASIPHDFEGKFGGSHVVLKRAPEGTGVIAGGPARNVLEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS N  NV+ AT E L+    P +VA  RG     ++A
Sbjct: 122 GIRNIRTKSLGSRNKQNVVLATLEGLKQLKSPEEVARLRGKAVEEVRA 169


>gi|91228965|ref|ZP_01262860.1| 30S ribosomal protein S5 [Vibrio alginolyticus 12G01]
 gi|254509442|ref|ZP_05121521.1| ribosomal protein S5 [Vibrio parahaemolyticus 16]
 gi|262392499|ref|YP_003284353.1| 30S ribosomal protein S5p [Vibrio sp. Ex25]
 gi|269964718|ref|ZP_06178956.1| 30S ribosomal protein S5 [Vibrio alginolyticus 40B]
 gi|312884686|ref|ZP_07744387.1| 30S ribosomal protein S5 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323492136|ref|ZP_08097298.1| 30S ribosomal protein S5 [Vibrio brasiliensis LMG 20546]
 gi|323495521|ref|ZP_08100595.1| 30S ribosomal protein S5 [Vibrio sinaloensis DSM 21326]
 gi|91187485|gb|EAS73822.1| 30S ribosomal protein S5 [Vibrio alginolyticus 12G01]
 gi|219547636|gb|EED24682.1| ribosomal protein S5 [Vibrio parahaemolyticus 16]
 gi|262336093|gb|ACY49888.1| SSU ribosomal protein S5p (S2e) [Vibrio sp. Ex25]
 gi|269830617|gb|EEZ84838.1| 30S ribosomal protein S5 [Vibrio alginolyticus 40B]
 gi|309367599|gb|EFP95150.1| 30S ribosomal protein S5 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323313697|gb|EGA66799.1| 30S ribosomal protein S5 [Vibrio brasiliensis LMG 20546]
 gi|323319402|gb|EGA72339.1| 30S ribosomal protein S5 [Vibrio sinaloensis DSM 21326]
          Length = 167

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RNM +++L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNMTTIAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L S   P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDALGSMKSPEMVAAKRGLTVESISE 167


>gi|146298144|ref|YP_001192735.1| 30S ribosomal protein S5 [Flavobacterium johnsoniae UW101]
 gi|146152562|gb|ABQ03416.1| 30S ribosomal protein S5 [Flavobacterium johnsoniae UW101]
          Length = 173

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 71/171 (41%), Positives = 108/171 (63%), Gaps = 1/171 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
           S+  N +  +     + DR+V++NRV+    GGR F FS +VVVGD    VG     +++
Sbjct: 2   SKYKNVELVKPSGLELKDRLVSVNRVTKVTKGGRAFGFSAIVVVGDENGVVGHGLGKSKD 61

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           V EA+ KA E AK+N++ + L +G+++ H+  G+ G  +V +  A  GTGVIAGGA+R+V
Sbjct: 62  VSEAIAKAVEDAKKNLVRIPL-NGQSVPHEQKGKFGGARVFLIPASHGTGVIAGGAVRSV 120

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            E +G+HDV++KS GSSNPHNV++ATF+ L        VA +RG+    + 
Sbjct: 121 LESVGIHDVLSKSQGSSNPHNVVKATFDALLQMRSAHTVAKQRGVSLEKVF 171


>gi|331000661|ref|ZP_08324314.1| ribosomal protein S5 [Parasutterella excrementihominis YIT 11859]
 gi|329570873|gb|EGG52584.1| ribosomal protein S5 [Parasutterella excrementihominis YIT 11859]
          Length = 172

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 71/178 (39%), Positives = 110/178 (61%), Gaps = 6/178 (3%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA+  ++        EE+D+ I ++++A+NRV+  + GGR   F+ L VVGD   ++G  
Sbjct: 1   MAKNPKNA-----VAEEQDDGIREKMIAVNRVTEVVKGGRILGFAALTVVGDGDGRIGMG 55

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              +REVP +V+KA + A+R M  V L +  T+ H   G HGA +V++  A  GTGVIAG
Sbjct: 56  KGKSREVPVSVQKAMDQARRAMEKVPLRN-GTIFHAVEGHHGASRVMLHPAPEGTGVIAG 114

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G +RA+ +V+G+ ++VAKS GSSNP+N++RAT + L     P ++A +RG     L  
Sbjct: 115 GPMRAIFDVMGIRNIVAKSHGSSNPYNMVRATLDALSKLRSPSEIAAKRGKTVEELIG 172


>gi|313678382|ref|YP_004056122.1| 30S ribosomal protein S5 [Mycoplasma bovis PG45]
 gi|312950256|gb|ADR24851.1| ribosomal protein S5 [Mycoplasma bovis PG45]
          Length = 231

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 63/174 (36%), Positives = 101/174 (58%)

Query: 5   ERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTA 64
             ++  N     E +N   +++V I+RV+  + GGRRF+FS  VVVGD K KVGF H  A
Sbjct: 58  RANKVKNRTRFGEANNEFSEKVVNISRVTKVVKGGRRFSFSAFVVVGDKKGKVGFGHGKA 117

Query: 65  REVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIR 124
            EVP+A++KA + A+ ++I+V + +  T+ H+   +  A KV+++ A  G G++A G +R
Sbjct: 118 NEVPDAIKKAVKDARNHLITVPIQNKITVPHEIHAKFLASKVMLKPAPKGKGIVASGTVR 177

Query: 125 AVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           AV E+ G  D+  K+ GS +  N++RAT + L+    P  +A  R      L  
Sbjct: 178 AVVELAGYTDIYTKTYGSRSKANIVRATLKALQQLRTPEQIAEIRDKNVKDLLG 231


>gi|296141080|ref|YP_003648323.1| ribosomal protein S5 [Tsukamurella paurometabola DSM 20162]
 gi|296029214|gb|ADG79984.1| ribosomal protein S5 [Tsukamurella paurometabola DSM 20162]
          Length = 215

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 1/175 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E   ++ ++++V INRVS  + GGRRF+F+ LV+VGD +  VG  +  A+EVP A++K  
Sbjct: 42  EAEKSNYIEKVVTINRVSKVVKGGRRFSFTALVIVGDGQGMVGVGYGKAKEVPAAIQKGV 101

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A++N   V ++ G T+ H   G   AG V++R A  GTGVIAGGA+R V E  G+HDV
Sbjct: 102 EEARKNFFRVPMI-GNTIVHPVQGEAAAGVVLLRPASPGTGVIAGGAVRPVLEAAGVHDV 160

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           +AKS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ +++   +
Sbjct: 161 IAKSLGSDNAINVVHATVAALKELQRPEEVAARRGLPIEDVAPAGMLRARAGQGA 215


>gi|29653607|ref|NP_819299.1| SSU ribosomal protein S5P [Coxiella burnetii RSA 493]
 gi|153209774|ref|ZP_01947502.1| ribosomal protein S5 [Coxiella burnetii 'MSU Goat Q177']
 gi|154707599|ref|YP_001425165.1| 30S ribosomal protein S5 [Coxiella burnetii Dugway 5J108-111]
 gi|161830486|ref|YP_001596202.1| 30S ribosomal protein S5 [Coxiella burnetii RSA 331]
 gi|165924141|ref|ZP_02219973.1| ribosomal protein S5 [Coxiella burnetii RSA 334]
 gi|212218091|ref|YP_002304878.1| 30S ribosomal protein S5 [Coxiella burnetii CbuK_Q154]
 gi|73919049|sp|Q83EQ9|RS5_COXBU RecName: Full=30S ribosomal protein S5
 gi|29540869|gb|AAO89813.1| SSU ribosomal protein S5P [Coxiella burnetii RSA 493]
 gi|120575251|gb|EAX31875.1| ribosomal protein S5 [Coxiella burnetii 'MSU Goat Q177']
 gi|154356885|gb|ABS78347.1| SSU ribosomal protein S5P [Coxiella burnetii Dugway 5J108-111]
 gi|161762353|gb|ABX77995.1| ribosomal protein S5 [Coxiella burnetii RSA 331]
 gi|165916423|gb|EDR35027.1| ribosomal protein S5 [Coxiella burnetii RSA 334]
 gi|212012353|gb|ACJ19733.1| SSU ribosomal protein S5P [Coxiella burnetii CbuK_Q154]
          Length = 168

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 80/159 (50%), Positives = 103/159 (64%), Gaps = 1/159 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           + I +++VA+ R +  + GGR F FS LVV GD   KVGF    AREVP A++KATE A+
Sbjct: 11  DGIQEKLVAVRRTAKVVKGGRVFGFSALVVAGDGDGKVGFGLGKAREVPSAIQKATENAR 70

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           RNMISV L  G TLHH     H +  V+M  A  GTGVIAG A+RA+ EV+G+ +V+AK 
Sbjct: 71  RNMISVPLY-GATLHHAIKATHASSTVLMLPASEGTGVIAGNAMRAIFEVMGVQNVLAKC 129

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           IGSSNP NV+RATF+ L+    P  VA +RG     +  
Sbjct: 130 IGSSNPINVVRATFKGLKQMETPESVAAKRGKAIEEIVE 168


>gi|270292017|ref|ZP_06198232.1| ribosomal protein S5 [Streptococcus sp. M143]
 gi|293364330|ref|ZP_06611056.1| 30S ribosomal protein S5 [Streptococcus oralis ATCC 35037]
 gi|306825969|ref|ZP_07459305.1| 30S ribosomal protein S5 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|307702703|ref|ZP_07639655.1| ribosomal protein S5 [Streptococcus oralis ATCC 35037]
 gi|315612349|ref|ZP_07887262.1| 30S ribosomal protein S5 [Streptococcus sanguinis ATCC 49296]
 gi|322375022|ref|ZP_08049536.1| ribosomal protein S5 [Streptococcus sp. C300]
 gi|331267118|ref|YP_004326748.1| 30S ribosomal protein S5 [Streptococcus oralis Uo5]
 gi|270279545|gb|EFA25387.1| ribosomal protein S5 [Streptococcus sp. M143]
 gi|291317176|gb|EFE57603.1| 30S ribosomal protein S5 [Streptococcus oralis ATCC 35037]
 gi|304431685|gb|EFM34665.1| 30S ribosomal protein S5 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|307623819|gb|EFO02804.1| ribosomal protein S5 [Streptococcus oralis ATCC 35037]
 gi|315315330|gb|EFU63369.1| 30S ribosomal protein S5 [Streptococcus sanguinis ATCC 49296]
 gi|321280522|gb|EFX57561.1| ribosomal protein S5 [Streptococcus sp. C300]
 gi|326683790|emb|CBZ01408.1| 30S ribosomal protein S5 [Streptococcus oralis Uo5]
          Length = 164

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VA+NRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA E AK+
Sbjct: 9   ELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRVGFGTGKAQEVPEAIRKAVEDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVVELAGVADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|117927532|ref|YP_872083.1| SSU ribosomal protein S5P [Acidothermus cellulolyticus 11B]
 gi|171460808|sp|A0LRN7|RS5_ACIC1 RecName: Full=30S ribosomal protein S5
 gi|117647995|gb|ABK52097.1| SSU ribosomal protein S5P [Acidothermus cellulolyticus 11B]
          Length = 199

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/176 (40%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q      ++ ++R+V INRV+  + GGRRF+F+ LVVVGD    VG  +  AREVP A+ 
Sbjct: 23  QEASPEKSNFLERVVTINRVAKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAREVPAAIA 82

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E AK++  +V  +   T+ H  +G   AG V++R A  GTGVIAGG +RAV E  G+
Sbjct: 83  KGVEEAKKHFFTVPRV-QGTIPHPVIGEAAAGVVLLRPASPGTGVIAGGPVRAVLECAGV 141

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            DV++KS+GS N  N++ AT + LR+   P  VA RRG+    +    ++ +K+ +
Sbjct: 142 RDVLSKSLGSDNAVNIVHATVKALRALVPPEKVAVRRGLPLEEVAPPALLRAKAEA 197


>gi|166031642|ref|ZP_02234471.1| hypothetical protein DORFOR_01342 [Dorea formicigenerans ATCC
           27755]
 gi|166028619|gb|EDR47376.1| hypothetical protein DORFOR_01342 [Dorea formicigenerans ATCC
           27755]
          Length = 169

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/168 (38%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V+I RV+  + GGR   F+ LVVVGD    VG     A E+PEA
Sbjct: 2   RQERIDASQLELEEKVVSIKRVTKVVKGGRNMRFTALVVVGDKNGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+I V+L +  ++ HD +G+ G   V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAAKNLIKVALDENDSITHDFIGKFGGASVLLKKAPEGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E LR    P  VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATVEGLRQVKTPEAVAKLRGKSVEEILG 169


>gi|125625124|ref|YP_001033607.1| 30S ribosomal protein S5 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|171769764|sp|A2RNN6|RS5_LACLM RecName: Full=30S ribosomal protein S5
 gi|124493932|emb|CAL98927.1| 30S ribosomal protein S5 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071932|gb|ADJ61332.1| 30S ribosomal protein S5 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 168

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 75/167 (44%), Positives = 108/167 (64%), Gaps = 1/167 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +   +   +R+V+INRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA
Sbjct: 3   ENRRNDREQSEFEERVVSINRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA EAAK+N+I+V ++ G TL H+ +G  G GK++++ A+ G GV AGGA+RAV E+ 
Sbjct: 63  IRKAIEAAKKNLITVPMV-GTTLPHEALGVFGGGKILLKPAVEGAGVAAGGAVRAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           G+ DV +KS+GS+ P NV+RAT + L       +VA  RG   S   
Sbjct: 122 GVADVTSKSLGSNTPINVVRATVDGLTQLKRAEEVAALRGKSVSDFA 168


>gi|254785096|ref|YP_003072524.1| 30S ribosomal protein S5 [Teredinibacter turnerae T7901]
 gi|237686590|gb|ACR13854.1| ribosomal protein S5 [Teredinibacter turnerae T7901]
          Length = 170

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 81/167 (48%), Positives = 110/167 (65%), Gaps = 1/167 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
              +  E     + +++V +NRV+  + GGR FAF+ L VVGD   KVGF    AREVP 
Sbjct: 3   QQIKKEESTAEGLQEKLVQVNRVAKTVKGGRIFAFTALTVVGDGNGKVGFGRGKAREVPI 62

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++KA E+A+RNMI V L +G T+ +   GRHGA KV M+ A  GTGVIAGGA+R+V E+
Sbjct: 63  AIQKAMESARRNMIQVEL-NGDTIQYPTKGRHGASKVYMQPASQGTGVIAGGAMRSVLEI 121

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            G+ +V+AK  GS+NP NV+RATFE LR+ + P  VA +RG     +
Sbjct: 122 AGVQNVLAKCYGSTNPVNVVRATFEALRAMASPDAVAAKRGKSVEDI 168


>gi|37912964|gb|AAR05296.1| ribosomal protein S5 [uncultured marine gamma proteobacterium
           EB000-45B06]
 gi|40063194|gb|AAR38031.1| ribosomal protein S5 [uncultured marine bacterium 562]
          Length = 169

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 71/167 (42%), Positives = 106/167 (63%), Gaps = 1/167 (0%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           ++N     ++ +++ +++V +NRV+  + GGR F F+ L VVGD   +VGF    A+EVP
Sbjct: 2   KENNVANNQQVDALEEKLVQVNRVAKVVKGGRIFGFTALTVVGDGNGRVGFGRGKAKEVP 61

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
            A++KA E A+R+M+ V L +  TL +    +HG+  V M+ A  GTG+IAGGA+RAV E
Sbjct: 62  IAIQKAMENARRSMVEVEL-NNTTLWYPVKAKHGSANVYMQPASEGTGIIAGGAMRAVLE 120

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSL 175
           + G+ +V+AK  GS+NP NV+RAT   L +   P  VA RRG K   
Sbjct: 121 LAGVQNVLAKCYGSTNPVNVVRATINALSAMESPDTVAARRGKKVEK 167


>gi|306828800|ref|ZP_07461992.1| 30S ribosomal protein S5 [Streptococcus mitis ATCC 6249]
 gi|304428978|gb|EFM32066.1| 30S ribosomal protein S5 [Streptococcus mitis ATCC 6249]
          Length = 164

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/157 (45%), Positives = 105/157 (66%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
              +R+VA+NRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA + AK+
Sbjct: 9   EFEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRVGFGTGKAQEVPEAIRKAVDDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVVELAGVADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|307543842|ref|YP_003896321.1| 30S ribosomal protein S5 [Halomonas elongata DSM 2581]
 gi|307215866|emb|CBV41136.1| 30S ribosomal protein S5 [Halomonas elongata DSM 2581]
          Length = 166

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E+++  + +++V +NRV+  + GGR F F+ L VVGD   +VGF    AREVP A++K
Sbjct: 3   KNEQQNGDLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGNGRVGFGRGKAREVPVAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A + A+RNM+ V+L  G TL +    RHGA KV M+ A  GTG+IAGGA+R+V E+ G+H
Sbjct: 63  AMDQARRNMVKVNLA-GNTLQYSVKARHGASKVYMQPASEGTGIIAGGAMRSVLELAGVH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV+AK  GS+NP NV+RAT   L +Q  P DVA +RG+    +  
Sbjct: 122 DVLAKCYGSTNPVNVVRATVNGLTAQRSPEDVAAKRGLSVEAITG 166


>gi|229829412|ref|ZP_04455481.1| hypothetical protein GCWU000342_01502 [Shuttleworthia satelles DSM
           14600]
 gi|229791843|gb|EEP27957.1| hypothetical protein GCWU000342_01502 [Shuttleworthia satelles DSM
           14600]
          Length = 169

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 66/168 (39%), Positives = 96/168 (57%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                +     + + +VAI RV+  + GGR   F+ LVVVGD    VG     A E+P+A
Sbjct: 2   KRTIIDPSQMELNENVVAIKRVTKVVKGGRNMRFAALVVVGDGNGHVGAGLGKATEIPDA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A +N+I V L + +++ HD +G+H    V+++ A  GTG+IAGG  RAVCE+ 
Sbjct: 62  IRKGKEDAAKNLIEVKLDENKSITHDIIGKHTGASVLLKKAPDGTGIIAGGPARAVCELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GSSN  NV+ AT E LR    P +VA  RG     +  
Sbjct: 122 GIANIRTKSLGSSNKQNVVLATIEALRQLKSPEEVARLRGKSVEEIVG 169


>gi|297564054|ref|YP_003683027.1| ribosomal protein S5 [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296848503|gb|ADH70521.1| ribosomal protein S5 [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 200

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 71/170 (41%), Positives = 107/170 (62%), Gaps = 1/170 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
           S ++++V INRV+  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E AK+
Sbjct: 30  SYIEKVVTINRVAKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAAIAKGVEEAKK 89

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N   V  +   T+ H   G   AG V++R A  GTGVIAGG +RAV E  G+HDV++KS+
Sbjct: 90  NFFRVPRI-QGTIVHRVQGEDAAGVVLLRPAAPGTGVIAGGPVRAVLECAGIHDVLSKSL 148

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           GSSNP N++ AT   L+  + P ++A RRG+    +    ++ +++ + +
Sbjct: 149 GSSNPLNIVHATVAALKGINQPEEIAARRGLPIEDVAPAAMLRARAEAKA 198


>gi|70732865|ref|YP_262633.1| 30S ribosomal protein S5 [Pseudomonas fluorescens Pf-5]
 gi|91207879|sp|Q4K550|RS5_PSEF5 RecName: Full=30S ribosomal protein S5
 gi|68347164|gb|AAY94770.1| ribosomal protein S5 [Pseudomonas fluorescens Pf-5]
          Length = 166

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +V+AK  GS+NP NV+ ATF+ L++   P  +A +RG     + 
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGKSVQEII 166


>gi|163847940|ref|YP_001635984.1| 30S ribosomal protein S5 [Chloroflexus aurantiacus J-10-fl]
 gi|222525820|ref|YP_002570291.1| 30S ribosomal protein S5 [Chloroflexus sp. Y-400-fl]
 gi|226703337|sp|A9WH83|RS5_CHLAA RecName: Full=30S ribosomal protein S5
 gi|254765687|sp|B9LJE9|RS5_CHLSY RecName: Full=30S ribosomal protein S5
 gi|163669229|gb|ABY35595.1| ribosomal protein S5 [Chloroflexus aurantiacus J-10-fl]
 gi|222449699|gb|ACM53965.1| ribosomal protein S5 [Chloroflexus sp. Y-400-fl]
          Length = 178

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 75/178 (42%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +        + +R+V INRVS  + GGRRF+FS +VVVGD K  VG     A EVP+A
Sbjct: 2   KRERINPETLELEERVVQINRVSKVVKGGRRFSFSTVVVVGDGKGHVGIGMGKAAEVPDA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  EAAKRN+I V L+   T+ H+ V +  A KV++R A  GTGVIAG  +R V E  
Sbjct: 62  IRKGAEAAKRNLIRVPLVHA-TVPHEVVTKFAATKVMLRPAAPGTGVIAGRGVRPVVEAA 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           G+ D+++K  GS+NP NV++ATF+ L   +   ++A+RR +    L  RR      ++
Sbjct: 121 GIKDLLSKVYGSNNPVNVVKATFKALSEMTSLHEMASRRDMTPQELMERRTRRETEAA 178


>gi|260779486|ref|ZP_05888376.1| SSU ribosomal protein S5p (S2e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260604295|gb|EEX30599.1| SSU ribosomal protein S5p (S2e) [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 167

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RNM +++L +  TL H   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNMTTIAL-NEGTLFHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L S   P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDALGSMKSPEMVAAKRGLTVESISE 167


>gi|289450452|ref|YP_003475767.1| 30S ribosomal protein S5 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184999|gb|ADC91424.1| ribosomal protein S5 [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 163

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 69/162 (42%), Positives = 102/162 (62%), Gaps = 1/162 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           + +   + ++++ I RVS  + GGR F F+ LV+VGD    VG     A E+P+A+RK  
Sbjct: 3   DIKSLELEEKVIHIGRVSKTVKGGRNFRFTALVIVGDGNGHVGKGLGKAAEIPDAIRKGI 62

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N+I + L  G T+ H+ +G  GAGKV+++ A  GTGVIAGG +RAV E  G+ D+
Sbjct: 63  EDAKKNLIQIPLS-GTTIPHEAIGAFGAGKVLLKPARIGTGVIAGGPVRAVLEAAGIKDI 121

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            AKS+GS+N +N++ A  E LRS   P+ VA  RG   + + 
Sbjct: 122 RAKSMGSNNTNNMVNAAMEGLRSLRSPKAVAELRGKSVAEIV 163


>gi|212697271|ref|ZP_03305399.1| hypothetical protein ANHYDRO_01839 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325848825|ref|ZP_08170335.1| ribosomal protein S5 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|212675720|gb|EEB35327.1| hypothetical protein ANHYDRO_01839 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325480469|gb|EGC83531.1| ribosomal protein S5 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 168

 Score =  168 bits (426), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 69/164 (42%), Positives = 99/164 (60%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            ++    ++ DR+V+INRV+  + GGR   F+ LVVVGD    VG     A EVPEA+RK
Sbjct: 5   KQDVDKLNLEDRVVSINRVAKTVKGGRNMRFAALVVVGDQNGHVGVGTGKATEVPEAIRK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           ATE  K++MI+V +++  T+ H  +   GAG V++  A  GTG+IAGG +RA+CE+ G  
Sbjct: 65  ATEDGKKHMITVPIVN-TTVPHRTLANKGAGSVLLMPAKEGTGIIAGGPVRAICELAGYK 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D+ AK++GSSNP N+I A  +   S     +VA  RG       
Sbjct: 124 DIRAKNLGSSNPKNIINACLKAFSSMKTVEEVARLRGKSIEEFD 167


>gi|331702063|ref|YP_004399022.1| 30S ribosomal protein S5 [Lactobacillus buchneri NRRL B-30929]
 gi|329129406|gb|AEB73959.1| ribosomal protein S5 [Lactobacillus buchneri NRRL B-30929]
          Length = 167

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 69/167 (41%), Positives = 106/167 (63%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  +     + D +V+INR++  + GGRR  F+ LVVVGD    VGF    A+EVPEA+
Sbjct: 2   KKFIDPDKLELEDNVVSINRITKVVKGGRRLRFAALVVVGDKHGHVGFGTGKAQEVPEAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA EAA++N+I V ++ G T+ H+ +G  G G+++++ A  G+GV AGGA+R+V E+ G
Sbjct: 62  RKAVEAARKNLIEVPIV-GTTIPHEVLGTFGGGRILLKPAEEGSGVAAGGAVRSVMELAG 120

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + DV +K +GS+ P NVIRATF+ L       +++  RG+    L  
Sbjct: 121 IDDVTSKRLGSNTPINVIRATFKGLVELKSAEEISALRGVSTQHLAE 167


>gi|289168715|ref|YP_003446984.1| 30S ribosomal protein S5 [Streptococcus mitis B6]
 gi|307704082|ref|ZP_07641011.1| ribosomal protein S5 [Streptococcus mitis SK597]
 gi|307708077|ref|ZP_07644545.1| ribosomal protein S5 [Streptococcus mitis NCTC 12261]
 gi|307709927|ref|ZP_07646374.1| ribosomal protein S5 [Streptococcus mitis SK564]
 gi|307711039|ref|ZP_07647461.1| ribosomal protein S5 [Streptococcus mitis SK321]
 gi|322377213|ref|ZP_08051705.1| ribosomal protein S5 [Streptococcus sp. M334]
 gi|288908282|emb|CBJ23124.1| 30S ribosomal protein S5 [Streptococcus mitis B6]
 gi|307615862|gb|EFN95067.1| ribosomal protein S5 [Streptococcus mitis NCTC 12261]
 gi|307617001|gb|EFN96179.1| ribosomal protein S5 [Streptococcus mitis SK321]
 gi|307619298|gb|EFN98427.1| ribosomal protein S5 [Streptococcus mitis SK564]
 gi|307622372|gb|EFO01380.1| ribosomal protein S5 [Streptococcus mitis SK597]
 gi|321281926|gb|EFX58934.1| ribosomal protein S5 [Streptococcus sp. M334]
          Length = 164

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 72/157 (45%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VA+NRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA + AK+
Sbjct: 9   ELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRVGFGTGKAQEVPEAIRKAVDDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVVELAGVADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|261250400|ref|ZP_05942975.1| SSU ribosomal protein S5p (S2e) [Vibrio orientalis CIP 102891]
 gi|260938969|gb|EEX94956.1| SSU ribosomal protein S5p (S2e) [Vibrio orientalis CIP 102891]
          Length = 167

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RNM +++L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNMTTIAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L     P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDGLSGMKSPEMVAAKRGLTVESISE 167


>gi|169630875|ref|YP_001704524.1| 30S ribosomal protein S5 [Mycobacterium abscessus ATCC 19977]
 gi|226703363|sp|B1MGC5|RS5_MYCA9 RecName: Full=30S ribosomal protein S5
 gi|169242842|emb|CAM63870.1| 30S ribosomal protein S5 [Mycobacterium abscessus]
          Length = 221

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             ++ ++R+V INRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  + 
Sbjct: 41  EKSNYLERVVTINRVSKVVKGGRRFSFTALVIVGDGHGLVGVGYGKAKEVPAAIAKGVDE 100

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++N   V L+ G T+ H   G   AG V++R A AGTGVIAGGA RAV E  G+HD++A
Sbjct: 101 ARKNFFRVPLI-GGTITHPVQGEDSAGVVMLRPASAGTGVIAGGAARAVLECAGVHDILA 159

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVV 182
           KS+GS N  NV+ AT   L+    P +VA RRG+    +    ++
Sbjct: 160 KSLGSDNAINVVHATVAALKQLQRPEEVAARRGLPIEDVAPAGML 204


>gi|302205526|gb|ADL09868.1| 30S ribosomal protein S5 [Corynebacterium pseudotuberculosis C231]
 gi|308275762|gb|ADO25661.1| 30S ribosomal protein S5 [Corynebacterium pseudotuberculosis I19]
          Length = 208

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
             +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A++
Sbjct: 32  NQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQ 91

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E A++N   V ++   T+ H   G   AG V+MR A  GTGVIAGGA R V E  G+
Sbjct: 92  KGAEEARKNFFRVPMV-AGTITHPVQGEAAAGIVMMRPAAPGTGVIAGGAARPVLECAGV 150

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
            D++ KS+G+ N  NV+ AT   L+  + P +VA RRG     +   R++ +++   +
Sbjct: 151 QDILCKSLGTDNAINVVHATVAGLKQLNRPEEVAARRGKTMEEVAPARMLRARAGQEA 208


>gi|296113780|ref|YP_003627718.1| 30S ribosomal protein S5 [Moraxella catarrhalis RH4]
 gi|295921474|gb|ADG61825.1| 30S ribosomal protein S5 [Moraxella catarrhalis RH4]
 gi|326562125|gb|EGE12453.1| 30S ribosomal protein S5 [Moraxella catarrhalis 7169]
 gi|326564510|gb|EGE14736.1| 30S ribosomal protein S5 [Moraxella catarrhalis 46P47B1]
 gi|326565693|gb|EGE15856.1| 30S ribosomal protein S5 [Moraxella catarrhalis 12P80B1]
 gi|326566262|gb|EGE16414.1| 30S ribosomal protein S5 [Moraxella catarrhalis 103P14B1]
 gi|326567086|gb|EGE17208.1| 30S ribosomal protein S5 [Moraxella catarrhalis BC1]
 gi|326568350|gb|EGE18430.1| 30S ribosomal protein S5 [Moraxella catarrhalis BC7]
 gi|326572251|gb|EGE22246.1| 30S ribosomal protein S5 [Moraxella catarrhalis BC8]
 gi|326574593|gb|EGE24533.1| 30S ribosomal protein S5 [Moraxella catarrhalis O35E]
 gi|326574849|gb|EGE24779.1| 30S ribosomal protein S5 [Moraxella catarrhalis 101P30B1]
 gi|326576173|gb|EGE26088.1| 30S ribosomal protein S5 [Moraxella catarrhalis CO72]
          Length = 165

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 82/162 (50%), Positives = 110/162 (67%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           E+ + +V+++VA++RV+  + GGR F+F+ L VVGD   +VGF    AREVP A++KA E
Sbjct: 5   EQTDGLVEKLVAVDRVAKVVKGGRIFSFTALTVVGDGNGRVGFGRGKAREVPAAIQKALE 64

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
           AAKRNMI+V L  G TL H    RHGA KV M+ A  GTGVIAGGA+RAV EV G+ +V+
Sbjct: 65  AAKRNMITVDLA-GHTLQHPINARHGASKVYMQPASEGTGVIAGGAMRAVLEVAGVQNVL 123

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           AK  GS+N  NV++ATF+ LR  + P  VA +RG     +  
Sbjct: 124 AKCYGSTNAANVVQATFKGLRDMTSPEQVAAKRGKSVEEILG 165


>gi|309799075|ref|ZP_07693328.1| ribosomal protein S5 [Streptococcus infantis SK1302]
 gi|308117310|gb|EFO54733.1| ribosomal protein S5 [Streptococcus infantis SK1302]
          Length = 164

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 74/157 (47%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VA+NRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA E AK+
Sbjct: 9   ELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGRVGFGTGKAQEVPEAIRKAVEDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ DV +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVISEFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGVADVTSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|193214817|ref|YP_001996016.1| 30S ribosomal protein S5 [Chloroherpeton thalassium ATCC 35110]
 gi|226703341|sp|B3QYE1|RS5_CHLT3 RecName: Full=30S ribosomal protein S5
 gi|193088294|gb|ACF13569.1| ribosomal protein S5 [Chloroherpeton thalassium ATCC 35110]
          Length = 172

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 69/169 (40%), Positives = 105/169 (62%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           +  +     + ++ +++V INR +  + GG+RF F+ +VVVGD +  VG+    A EV +
Sbjct: 4   NPRKKIRPGELNLKEKLVHINRTAKVVKGGKRFGFNAIVVVGDGEGHVGYGLGKANEVQD 63

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ K  E AK+N+I V ++   T+ H    + GA KV+M+ A  GTG+IAGGA+RAV E+
Sbjct: 64  AIAKGIEDAKKNVIEVPIIK-GTIPHQIFAKFGAAKVLMKPATPGTGLIAGGAVRAVLEM 122

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G+ DV+ KS+GSSNPHNV++AT   L+  S   DV+ RRG     +  
Sbjct: 123 AGVKDVLTKSLGSSNPHNVVKATVHGLQEVSDAYDVSERRGKSLQDIYE 171


>gi|304310033|ref|YP_003809631.1| 30S ribosomal protein S5 [gamma proteobacterium HdN1]
 gi|301795766|emb|CBL43965.1| 30S ribosomal protein S5 [gamma proteobacterium HdN1]
          Length = 166

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 81/165 (49%), Positives = 111/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +E+     +++V +NRV+  + GGR FAF+ L VVGD K KVGF    AREVP+A++K
Sbjct: 3   KTDEKAEGFQEKLVQVNRVAKVVKGGRIFAFTALTVVGDGKGKVGFGRGKAREVPQAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E+A++NMI V L +G TL H    RHGA  V M+ A  GTGVIAGGA+RAV EV G+ 
Sbjct: 63  ALESARKNMIRVEL-NGTTLQHPVRARHGASAVFMQPASEGTGVIAGGAMRAVLEVAGVQ 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK  GS+NP NV+RAT+E L++   P D+A +RG     + +
Sbjct: 122 NVLAKCYGSTNPVNVVRATYEGLKAMKSPEDIAAKRGKTVEQILS 166


>gi|293363607|ref|ZP_06610363.1| ribosomal protein S5 [Mycoplasma alligatoris A21JP2]
 gi|292552956|gb|EFF41710.1| ribosomal protein S5 [Mycoplasma alligatoris A21JP2]
          Length = 221

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 65/173 (37%), Positives = 103/173 (59%), Gaps = 1/173 (0%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           ++R      + RE+      +++V I RV+  + GGRRF+FS  VVVG+ K +VGF H  
Sbjct: 49  RQRKDSRPNRQREDAFPDFSEKVVDIARVTKVVKGGRRFSFSAFVVVGNKKGRVGFGHGK 108

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EVP+A++KA + A+ N+I+VS+ +  T+ H+   +  A KV+++ A  G G+IA G +
Sbjct: 109 ANEVPDAIKKAIKDAQNNLINVSVTN-GTVPHEVHAKFLASKVMLKPAPKGKGLIASGTV 167

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           RAV E+ G  D+V K+ GS +  N ++AT E L++   P  +A  R      L
Sbjct: 168 RAVVELAGYTDIVTKTYGSRSKSNTVKATVEALKNLRTPEQIAQIRDKDVKDL 220


>gi|26987212|ref|NP_742637.1| 30S ribosomal protein S5 [Pseudomonas putida KT2440]
 gi|148545756|ref|YP_001265858.1| 30S ribosomal protein S5 [Pseudomonas putida F1]
 gi|167031517|ref|YP_001666748.1| 30S ribosomal protein S5 [Pseudomonas putida GB-1]
 gi|170723889|ref|YP_001751577.1| 30S ribosomal protein S5 [Pseudomonas putida W619]
 gi|37999420|sp|Q88QL8|RS5_PSEPK RecName: Full=30S ribosomal protein S5
 gi|172048430|sp|A5VXR4|RS5_PSEP1 RecName: Full=30S ribosomal protein S5
 gi|226703375|sp|B0KK84|RS5_PSEPG RecName: Full=30S ribosomal protein S5
 gi|226703376|sp|B1JAJ5|RS5_PSEPW RecName: Full=30S ribosomal protein S5
 gi|24981850|gb|AAN66101.1|AE016238_19 ribosomal protein S5 [Pseudomonas putida KT2440]
 gi|148509814|gb|ABQ76674.1| SSU ribosomal protein S5P [Pseudomonas putida F1]
 gi|166858005|gb|ABY96412.1| ribosomal protein S5 [Pseudomonas putida GB-1]
 gi|169761892|gb|ACA75208.1| ribosomal protein S5 [Pseudomonas putida W619]
 gi|313496836|gb|ADR58202.1| RpsE [Pseudomonas putida BIRD-1]
          Length = 166

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L  G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-KGTTLQYATKAAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +V+AK  GS+NP NV+ ATF+ L++   P  +A +RG     + 
Sbjct: 122 QNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKRGKSVEEIF 166


>gi|77918332|ref|YP_356147.1| 30S ribosomal protein S5 [Pelobacter carbinolicus DSM 2380]
 gi|91207873|sp|Q3A6N0|RS5_PELCD RecName: Full=30S ribosomal protein S5
 gi|77544415|gb|ABA87977.1| SSU ribosomal protein S5P [Pelobacter carbinolicus DSM 2380]
          Length = 163

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 77/162 (47%), Positives = 108/162 (66%), Gaps = 1/162 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +  +  + DR+V INR +  + GGRRF+FS LVVVGD +  VG+ H  A+EVPEA+RK
Sbjct: 3   RIDPNELELTDRVVHINRCAKVVKGGRRFSFSALVVVGDGQGIVGYGHGKAKEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N+I V L   R++  D +G+ GAG+V+++ A AGTGVIAGGA+RAV EV G+ 
Sbjct: 63  GVEQAKKNLIRVPL-KDRSIPFDVIGKFGAGRVLLKPASAGTGVIAGGAVRAVLEVSGVG 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSL 175
           D+++K IGS+NPHNV+RAT + L       ++   RG     
Sbjct: 122 DILSKCIGSNNPHNVVRATIDALSRLKSAEELRALRGADTEE 163


>gi|312140901|ref|YP_004008237.1| 30S ribosomal protein s5 rpse [Rhodococcus equi 103S]
 gi|325675461|ref|ZP_08155145.1| 30S ribosomal protein S5 [Rhodococcus equi ATCC 33707]
 gi|311890240|emb|CBH49558.1| 30S ribosomal protein S5 RpsE [Rhodococcus equi 103S]
 gi|325553432|gb|EGD23110.1| 30S ribosomal protein S5 [Rhodococcus equi ATCC 33707]
          Length = 213

 Score =  168 bits (425), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 72/171 (42%), Positives = 108/171 (63%), Gaps = 1/171 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             ++ ++R+V+INRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A++K  E 
Sbjct: 40  EKSNHIERVVSINRVSKVVKGGRRFSFTALVIVGDGNGLVGVGYGKAKEVPAAIQKGVEE 99

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA+RAV E  G+ D++A
Sbjct: 100 ARKNFFRVPLI-GSTITHPVQGEAAAGVVMLRPASPGTGVIAGGAVRAVLECAGVSDILA 158

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           KS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ +++ +
Sbjct: 159 KSLGSDNAINVVHATVAALKGLQRPEEVAARRGLPLEDVAPAGMLRARAQA 209


>gi|110004246|emb|CAK98584.1| 30s ribosomal protein s5 [Spiroplasma citri]
          Length = 203

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 73/175 (41%), Positives = 108/175 (61%), Gaps = 1/175 (0%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           ++ +QR    +R   +N   +++V I RV+    GGR F F+ +VV+GD K +VGF    
Sbjct: 30  RQGNQRFERNDRRGDENMFEEKVVTIRRVTKVTKGGRHFRFAAVVVIGDKKGRVGFGTGK 89

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EVP+A++KA + AK+ ++ V L+ G T+ H+ +G  GAGKV+++ A  GTGVIAGG I
Sbjct: 90  ANEVPDAIKKAIKEAKKQLVKVPLV-GTTVPHEVIGHFGAGKVLIKPARKGTGVIAGGPI 148

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           R V E+ G+ DV  KS+GS+ P N+IRAT + L +      +A  RG     LQ 
Sbjct: 149 RVVIELAGLADVYTKSLGSNTPINMIRATLDGLSNLRTIDQIAKLRGKTVEELQG 203


>gi|330812058|ref|YP_004356520.1| 30S ribosomal protein S5 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380166|gb|AEA71516.1| 30S ribosomal protein S5 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 166

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +V+AK  GS+NP NV+ ATF+ L++   P  +A +RG     + 
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGKSVKEIF 166


>gi|85704010|ref|ZP_01035113.1| 30S ribosomal protein S5 [Roseovarius sp. 217]
 gi|85671330|gb|EAQ26188.1| 30S ribosomal protein S5 [Roseovarius sp. 217]
          Length = 188

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 98/161 (60%), Positives = 121/161 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATEAAK
Sbjct: 17  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEAAK 76

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVVAKS
Sbjct: 77  RAMIRVPLREGRTLHHDMEGRHGAGKVVMRTAPTGTGIIAGGPMRAVFEMLGIQDVVAKS 136

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
            GS NP+N+IRAT + L+ ++ PR VA RRG K + +  + 
Sbjct: 137 TGSQNPYNMIRATLDGLKKETSPRMVAQRRGKKVADILKKG 177


>gi|116495930|ref|YP_807664.1| ribosomal protein S5 [Lactobacillus casei ATCC 334]
 gi|191639412|ref|YP_001988578.1| 30S ribosomal protein S5 [Lactobacillus casei BL23]
 gi|239630334|ref|ZP_04673365.1| SSU ribosomal protein S5P [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301067486|ref|YP_003789509.1| 30S ribosomal protein L5 [Lactobacillus casei str. Zhang]
 gi|122262670|sp|Q035A0|RS5_LACC3 RecName: Full=30S ribosomal protein S5
 gi|116106080|gb|ABJ71222.1| SSU ribosomal protein S5P [Lactobacillus casei ATCC 334]
 gi|190713714|emb|CAQ67720.1| 30S ribosomal protein S5 [Lactobacillus casei BL23]
 gi|239527946|gb|EEQ66947.1| SSU ribosomal protein S5P [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439893|gb|ADK19659.1| Ribosomal protein S5 [Lactobacillus casei str. Zhang]
 gi|327383500|gb|AEA54976.1| 30S ribosomal protein S5 [Lactobacillus casei LC2W]
 gi|327386693|gb|AEA58167.1| 30S ribosomal protein S5 [Lactobacillus casei BD-II]
          Length = 167

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 70/162 (43%), Positives = 107/162 (66%), Gaps = 1/162 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D++V+INRV+  + GGRR  F+ + +VGD    VGFA   A+EVPEA+RKA 
Sbjct: 6   DPNQLDLEDQVVSINRVTKVVKGGRRLRFAAIAIVGDKNGHVGFATGKAQEVPEAIRKAV 65

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           +AAK+++I V ++ G T+ H+ +G  GAG+V+++ A  G+GV AGGAIR+V E+ G+ D+
Sbjct: 66  DAAKKSLIEVPIV-GTTIPHEVIGHFGAGEVLLKPAEEGSGVAAGGAIRSVMELAGIADI 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +KS+G + P N+IRAT + L        VA  RG+  S L+
Sbjct: 125 TSKSLGRNTPINMIRATMDGLTQLRTREQVAELRGVSASSLE 166


>gi|229592886|ref|YP_002875005.1| 30S ribosomal protein S5 [Pseudomonas fluorescens SBW25]
 gi|312963351|ref|ZP_07777834.1| 30S ribosomal protein S5 [Pseudomonas fluorescens WH6]
 gi|259495312|sp|C3K2V9|RS5_PSEFS RecName: Full=30S ribosomal protein S5
 gi|229364752|emb|CAY52736.1| 30S ribosomal protein S5 [Pseudomonas fluorescens SBW25]
 gi|311282431|gb|EFQ61029.1| 30S ribosomal protein S5 [Pseudomonas fluorescens WH6]
          Length = 166

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 110/165 (66%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +V+AK  GS+NP NV+ ATF+ L++   P  +A +RG+    + 
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGLTVKEIF 166


>gi|103488278|ref|YP_617839.1| 30S ribosomal protein S5 [Sphingopyxis alaskensis RB2256]
 gi|122984737|sp|Q1GPB6|RS5_SPHAL RecName: Full=30S ribosomal protein S5
 gi|98978355|gb|ABF54506.1| SSU ribosomal protein S5P [Sphingopyxis alaskensis RB2256]
          Length = 242

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 99/181 (54%), Positives = 126/181 (69%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E+    +++++V INRVS  + GG+RF F+ LVVVGD K + GF H  AREVPEA+ KAT
Sbjct: 62  EDGGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAREVPEAISKAT 121

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AAK+ MI V L DGRTLHHDG G  GAG V +RSA AGTG+IAGG +RAV E LG+ DV
Sbjct: 122 AAAKKAMIRVPLRDGRTLHHDGRGHFGAGNVTLRSAPAGTGIIAGGPMRAVFESLGVADV 181

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKN 195
           V KS+G+SNP+N+IRATFE L  Q+ P+ VA RRG K S L  R   S +++     +  
Sbjct: 182 VTKSVGTSNPYNMIRATFEALGEQTSPKSVAQRRGKKVSDLIKRGGASDRAAEAEAAAVT 241

Query: 196 K 196
           +
Sbjct: 242 E 242


>gi|28897048|ref|NP_796653.1| 30S ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210633]
 gi|156973068|ref|YP_001443975.1| 30S ribosomal protein S5 [Vibrio harveyi ATCC BAA-1116]
 gi|260364123|ref|ZP_05776837.1| ribosomal protein S5 [Vibrio parahaemolyticus K5030]
 gi|260877966|ref|ZP_05890321.1| ribosomal protein S5 [Vibrio parahaemolyticus AN-5034]
 gi|260897585|ref|ZP_05906081.1| ribosomal protein S5 [Vibrio parahaemolyticus Peru-466]
 gi|260903544|ref|ZP_05911939.1| ribosomal protein S5 [Vibrio parahaemolyticus AQ4037]
 gi|269959707|ref|ZP_06174087.1| 30S ribosomal protein S5 [Vibrio harveyi 1DA3]
 gi|31340378|sp|Q87SZ6|RS5_VIBPA RecName: Full=30S ribosomal protein S5
 gi|171769814|sp|A7MWH5|RS5_VIBHB RecName: Full=30S ribosomal protein S5
 gi|28805256|dbj|BAC58537.1| ribosomal protein S5 [Vibrio parahaemolyticus RIMD 2210633]
 gi|156524662|gb|ABU69748.1| hypothetical protein VIBHAR_00747 [Vibrio harveyi ATCC BAA-1116]
 gi|269835630|gb|EEZ89709.1| 30S ribosomal protein S5 [Vibrio harveyi 1DA3]
 gi|308087872|gb|EFO37567.1| ribosomal protein S5 [Vibrio parahaemolyticus Peru-466]
 gi|308089746|gb|EFO39441.1| ribosomal protein S5 [Vibrio parahaemolyticus AN-5034]
 gi|308109053|gb|EFO46593.1| ribosomal protein S5 [Vibrio parahaemolyticus AQ4037]
 gi|308115560|gb|EFO53100.1| ribosomal protein S5 [Vibrio parahaemolyticus K5030]
 gi|328471851|gb|EGF42728.1| 30S ribosomal protein S5 [Vibrio parahaemolyticus 10329]
          Length = 167

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RNM +++L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNMTTIAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L S   P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDALGSMKSPEMVAAKRGLTVEAISE 167


>gi|316933544|ref|YP_004108526.1| 30S ribosomal protein S5 [Rhodopseudomonas palustris DX-1]
 gi|315601258|gb|ADU43793.1| ribosomal protein S5 [Rhodopseudomonas palustris DX-1]
          Length = 191

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 102/160 (63%), Positives = 128/160 (80%)

Query: 22  IVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRN 81
            VD++V INRV+  + GG+RF F+ LVVVGD K +VGF H  AREVPEA+RKATE+AKRN
Sbjct: 23  FVDKLVHINRVAKVVKGGKRFGFAALVVVGDQKGRVGFGHGKAREVPEAIRKATESAKRN 82

Query: 82  MISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIG 141
           +  V+L +GRTLHHD  GRHGAG+V +R+A AGTG+IAGG +RAV E LG+ DVVAKS+G
Sbjct: 83  LTRVALREGRTLHHDIAGRHGAGRVYLRAAPAGTGIIAGGPMRAVFETLGIQDVVAKSVG 142

Query: 142 SSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           SSNP+N++RATF+ L+S   PR VA RR IK S LQ+RR+
Sbjct: 143 SSNPYNMVRATFDALKSVDSPRSVAARRNIKVSTLQSRRI 182


>gi|157151183|ref|YP_001451218.1| 30S ribosomal protein S5 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283565|ref|ZP_06061330.1| ribosomal protein S5 [Streptococcus sp. 2_1_36FAA]
 gi|172045596|sp|A8AZK8|RS5_STRGC RecName: Full=30S ribosomal protein S5
 gi|157075977|gb|ABV10660.1| ribosomal protein S5 [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|262260622|gb|EEY79323.1| ribosomal protein S5 [Streptococcus sp. 2_1_36FAA]
          Length = 164

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 75/157 (47%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VAINRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA E AK+
Sbjct: 9   ELEERVVAINRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEAIRKAVEDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ DV +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGVADVTSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|199598849|ref|ZP_03212260.1| Ribosomal protein S5 [Lactobacillus rhamnosus HN001]
 gi|258509465|ref|YP_003172216.1| 30S ribosomal protein S5 [Lactobacillus rhamnosus GG]
 gi|258540663|ref|YP_003175162.1| 30S ribosomal protein S5 [Lactobacillus rhamnosus Lc 705]
 gi|199590261|gb|EDY98356.1| Ribosomal protein S5 [Lactobacillus rhamnosus HN001]
 gi|257149392|emb|CAR88365.1| SSU/30S ribosomal protein S5P [Lactobacillus rhamnosus GG]
 gi|257152339|emb|CAR91311.1| SSU/30S ribosomal protein S5P [Lactobacillus rhamnosus Lc 705]
 gi|259650744|dbj|BAI42906.1| 30S ribosomal protein S5 [Lactobacillus rhamnosus GG]
 gi|328478166|gb|EGF48011.1| 30S ribosomal protein S5 [Lactobacillus rhamnosus MTCC 5462]
          Length = 167

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/162 (43%), Positives = 107/162 (66%), Gaps = 1/162 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + D++VAINRV+  + GGRR  F+ + +VGD    VGFA   A+EVPEA+RKA 
Sbjct: 6   DPNQLDLEDQVVAINRVTKVVKGGRRLRFAAIAIVGDKNGHVGFATGKAQEVPEAIRKAV 65

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           +AAK+++I V ++ G T+ H+ +G  GAG+V+++ A  G+GV AGGAIR+V E+ G+ D+
Sbjct: 66  DAAKKSLIEVPIV-GTTIPHEVIGHFGAGEVLLKPAEEGSGVAAGGAIRSVMELAGIADI 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +KS+G + P N+IRAT + L        VA  RG+  S L+
Sbjct: 125 TSKSLGRNTPINMIRATMDGLTQLRTREQVAELRGVSASSLE 166


>gi|189218712|ref|YP_001939353.1| Ribosomal protein S5 [Methylacidiphilum infernorum V4]
 gi|189185570|gb|ACD82755.1| Ribosomal protein S5 [Methylacidiphilum infernorum V4]
          Length = 217

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 65/170 (38%), Positives = 108/170 (63%), Gaps = 1/170 (0%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           +  S++ ++++ E     ++DR++ +NR +  + GGRR++F  LVVVGD   ++G     
Sbjct: 40  RRHSEKRDFKHEETYHEELMDRVIHVNRCAKVVKGGRRYSFGALVVVGDRAGQIGIGFGK 99

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EV +AV+KATE+A++ M  + + +G T+ H+ +G    GKV+M+ A  GTGVIAG  +
Sbjct: 100 ANEVADAVKKATESARKKMQRI-VRNGDTIPHEVIGEFSGGKVLMKPASPGTGVIAGVIV 158

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKH 173
           R++ E  G+ DV+ KS+GS NP+NV +ATF+ L       +V ++RG   
Sbjct: 159 RSILEAAGIKDVLTKSLGSKNPYNVAKATFKALLQLKSRDEVLHKRGKDI 208


>gi|126724884|ref|ZP_01740727.1| 30S ribosomal protein S5 [Rhodobacterales bacterium HTCC2150]
 gi|126706048|gb|EBA05138.1| 30S ribosomal protein S5 [Rhodobacterales bacterium HTCC2150]
          Length = 194

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 94/160 (58%), Positives = 120/160 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD + +VGF    A+EVPEA+RKATE AK
Sbjct: 19  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQRGRVGFGKGKAKEVPEAIRKATEQAK 78

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V+L +GRTLHHD  GRHGAGK+++R+A  GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 79  RQMIRVALREGRTLHHDMEGRHGAGKIVIRTAPEGTGIIAGGPMRAVFEMLGVKDVVSKS 138

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           IGS NP+N+IRAT + L   + PR VA RRG K + +  +
Sbjct: 139 IGSQNPYNMIRATMDALVKGASPRAVAQRRGKKVADILPK 178


>gi|71278175|ref|YP_267368.1| 30S ribosomal protein S5 [Colwellia psychrerythraea 34H]
 gi|91207859|sp|Q488Z6|RS5_COLP3 RecName: Full=30S ribosomal protein S5
 gi|71143915|gb|AAZ24388.1| ribosomal protein S5 [Colwellia psychrerythraea 34H]
          Length = 169

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 72/168 (42%), Positives = 107/168 (63%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           N      + + + ++++A+NRVS  + GGR F+F+ L VVGD   +VGF +  AREVP A
Sbjct: 3   NHNQENSQQSDMAEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA E A RN++++ L  G TL H   G+H   KV M+ A  GTG+IAGGA+RAV EV 
Sbjct: 63  IQKAMEKAHRNIVTIDL-KGTTLQHVITGKHSGSKVFMKPASEGTGIIAGGAMRAVLEVA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ +V++K+ GS+NP NV+RAT   L +   P  +A +RG +   +  
Sbjct: 122 GVQNVLSKAYGSTNPINVVRATVSALVNMHSPEGMAAKRGKRVDEILG 169


>gi|104779772|ref|YP_606270.1| 30S ribosomal protein S5 [Pseudomonas entomophila L48]
 gi|172046717|sp|Q1IFU9|RS5_PSEE4 RecName: Full=30S ribosomal protein S5
 gi|95108759|emb|CAK13453.1| 30S ribosomal subunit protein S5 [Pseudomonas entomophila L48]
          Length = 166

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L  G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-KGTTLQYATKAAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +V+AK  GS+NP NV+ ATF+ L++   P  +A +RG     + 
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGKTVEEIF 166


>gi|325261511|ref|ZP_08128249.1| ribosomal protein S5 [Clostridium sp. D5]
 gi|324032965|gb|EGB94242.1| ribosomal protein S5 [Clostridium sp. D5]
          Length = 169

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/168 (39%), Positives = 100/168 (59%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +     + +++V+I RV+  + GGR F F+ LVVVGD K  VG     A E+PEA
Sbjct: 2   KQERIDASQMELTEKVVSIKRVTKVVKGGRNFRFTALVVVGDGKGHVGAGLGKATEIPEA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RK  E A + +I+V+L D  ++ HD +G+ G+  V+++ A  GTGVIAGG  RAV E+ 
Sbjct: 62  IRKGKEDAAKKLITVALDDNDSVTHDVIGKFGSASVLLKKAPDGTGVIAGGPARAVIEMA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ ++  KS+GS+N  NV+ AT E LR    P +VA  RG     +  
Sbjct: 122 GIKNIRTKSLGSNNKQNVVLATIEGLRGVKTPEEVAKLRGKSVEEIVG 169


>gi|332042703|gb|EGI78903.1| ribosomal protein S5 [Lacinutrix algicola 5H-3-7-4]
          Length = 174

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 71/177 (40%), Positives = 103/177 (58%), Gaps = 5/177 (2%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           M QK +S     +  +     + DR+V + RV+    GGR F FS +VVVGD    VG  
Sbjct: 1   MYQKYKS----AELVKPSGLDLKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDEAGVVGHG 56

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              +++V  A+ KA E AK+N++ + ++   TL H+  G+ G  +V +  A  GTGVIAG
Sbjct: 57  LGKSKDVASAIAKAIEDAKKNLVRIPIIK-GTLPHEQKGKFGGARVNIIPAAPGTGVIAG 115

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GA+R V E +G+HDV++KS GSSNPHNV++ATF+ L        +A  RGI    + 
Sbjct: 116 GAVRTVLEAVGVHDVLSKSQGSSNPHNVVKATFDALLQLRSAEAIARERGISLEKVF 172


>gi|41410282|ref|NP_963118.1| 30S ribosomal protein S5 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|73919077|sp|Q73S92|RS5_MYCPA RecName: Full=30S ribosomal protein S5
 gi|41399116|gb|AAS06734.1| RpsE [Mycobacterium avium subsp. paratuberculosis K-10]
          Length = 224

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 73/170 (42%), Positives = 104/170 (61%), Gaps = 1/170 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
            ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E A
Sbjct: 41  KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEA 100

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           ++    V L+   T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HD++AK
Sbjct: 101 RKGFFRVPLIR-GTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVHDILAK 159

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           S+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S
Sbjct: 160 SLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRES 209


>gi|257067043|ref|YP_003153299.1| 30S ribosomal protein S5 [Anaerococcus prevotii DSM 20548]
 gi|256798923|gb|ACV29578.1| ribosomal protein S5 [Anaerococcus prevotii DSM 20548]
          Length = 169

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 73/164 (44%), Positives = 99/164 (60%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E    ++ DR+VAINRV+  + GGR   FS LVVVG+    VG     A EVPEA+RK
Sbjct: 6   RSEVEKLNLEDRVVAINRVAKTVKGGRNIRFSALVVVGNGNGYVGIGTGKATEVPEAIRK 65

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A+E AK++MI+V ++ G T+ H   G   +GKV++  A  GTG+IAGG +RA+CE+ G  
Sbjct: 66  ASEDAKKHMINVPIV-GTTIPHRIHGAKASGKVLLMPAKEGTGIIAGGPVRAICELAGYK 124

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D+ AK++GSSNP N+I A  E   S     +VA  RG       
Sbjct: 125 DIRAKNLGSSNPRNIINACIEGFASMKTVEEVARLRGKSVEEFD 168


>gi|220913416|ref|YP_002488725.1| 30S ribosomal protein S5 [Arthrobacter chlorophenolicus A6]
 gi|219860294|gb|ACL40636.1| ribosomal protein S5 [Arthrobacter chlorophenolicus A6]
          Length = 238

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 75/173 (43%), Positives = 106/173 (61%), Gaps = 1/173 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             N  V+R+V INRVS  + GGRRF+F+ LVVVGD    VG  +  A+EVP A+ K  E 
Sbjct: 65  EKNQFVERVVTINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPAAIAKGVEE 124

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           AK++   V  + G T+ H   G   AG V++R A AGTGVIAGG +RAV E +G+HD+++
Sbjct: 125 AKKSFFRVPRV-GNTIPHRVQGEAAAGVVMLRPASAGTGVIAGGPVRAVLECVGIHDILS 183

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
           KS+GSSN  N++ AT + L+    P  VA RRG+    +    +V +  +  +
Sbjct: 184 KSLGSSNAINIVHATVDALKRLEEPAAVAARRGLPLDEVAPAALVKALLAPKA 236


>gi|125717003|ref|YP_001034136.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK36]
 gi|323350957|ref|ZP_08086615.1| 30S ribosomal protein S5 [Streptococcus sanguinis VMC66]
 gi|171769893|sp|A3CK81|RS5_STRSV RecName: Full=30S ribosomal protein S5
 gi|125496920|gb|ABN43586.1| 30S ribosomal protein S5, putative [Streptococcus sanguinis SK36]
 gi|322122939|gb|EFX94645.1| 30S ribosomal protein S5 [Streptococcus sanguinis VMC66]
 gi|324989985|gb|EGC21926.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK353]
 gi|324991832|gb|EGC23757.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK405]
 gi|324996278|gb|EGC28186.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK678]
 gi|325686422|gb|EGD28452.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK72]
 gi|325689214|gb|EGD31220.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK115]
 gi|325695793|gb|EGD37690.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK150]
 gi|325697993|gb|EGD39876.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK160]
 gi|327458448|gb|EGF04804.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK1]
 gi|327463705|gb|EGF10021.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK1057]
 gi|327467352|gb|EGF12852.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK330]
 gi|327471725|gb|EGF17166.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK408]
 gi|327490446|gb|EGF22228.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK1058]
 gi|328945200|gb|EGG39354.1| 30S ribosomal protein S5 [Streptococcus sanguinis SK1087]
          Length = 164

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 75/157 (47%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VAINRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA E AK+
Sbjct: 9   ELEERLVAINRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEAIRKAVEDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ DV +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGVADVTSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|54307558|ref|YP_128578.1| putative ribosomal subunit protein S5 [Photobacterium profundum
           SS9]
 gi|73919084|sp|Q6LV99|RS5_PHOPR RecName: Full=30S ribosomal protein S5
 gi|46911978|emb|CAG18776.1| putative ribosomal subunit protein S5 [Photobacterium profundum
           SS9]
          Length = 165

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E+  + + ++++A+NRVS  + GGR F+F+ L VVGD   ++GF +  AREVP A++K+
Sbjct: 3   NEKTQSDLNEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRIGFGYGKAREVPAAIQKS 62

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+RNM++V+L +  TLHH   GRH   KV M+ A  GTG+IAGGA+RAV EV G+ +
Sbjct: 63  MEKARRNMVTVAL-NEGTLHHAVKGRHTGSKVYMQPASEGTGIIAGGAMRAVLEVAGIRN 121

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V+AK+ GS+NP NV+RAT   L   + P  +A +RG+    +  
Sbjct: 122 VLAKAYGSTNPINVVRATIAGLSGMNSPEMIAAKRGLSVKEILG 165


>gi|15829041|ref|NP_326401.1| 30S ribosomal protein S5 [Mycoplasma pulmonis UAB CTIP]
 gi|26399466|sp|Q98PZ9|RS5_MYCPU RecName: Full=30S ribosomal protein S5
 gi|14089985|emb|CAC13743.1| 30S RIBOSOMAL PROTEIN S5 [Mycoplasma pulmonis]
          Length = 229

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/173 (38%), Positives = 107/173 (61%)

Query: 6   RSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAR 65
           +++R   +   +      ++IV I RV+  + GGRRF+FS  VVVG+ K KVG+ H  A 
Sbjct: 57  KARRKVKKVISKPKTEFSEKIVDIARVTKVVKGGRRFSFSAFVVVGNKKGKVGYGHGKAN 116

Query: 66  EVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRA 125
           EVP+A++KA + A+ ++I+V +++  T+ H+  G+  + KVI++SA  G G+IA GA+RA
Sbjct: 117 EVPDAIKKAIKDAQNHLITVPIINESTVPHEMSGKFLSSKVIIKSAPKGKGIIASGAVRA 176

Query: 126 VCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V E+ G  D+ AKS GS    N ++AT E L+      ++A  RG+K   + +
Sbjct: 177 VMELAGYTDIYAKSYGSRTKMNTVKATVETLKKMRTVEEIAALRGLKVQDIIS 229


>gi|260770930|ref|ZP_05879859.1| SSU ribosomal protein S5p (S2e) [Vibrio furnissii CIP 102972]
 gi|260614167|gb|EEX39357.1| SSU ribosomal protein S5p (S2e) [Vibrio furnissii CIP 102972]
 gi|315178976|gb|ADT85890.1| 30S ribosomal protein S5 [Vibrio furnissii NCTC 11218]
          Length = 167

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 76/166 (45%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RNM +++L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNMTTIAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L S   P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDALASVKSPEMVAAKRGLTVESISE 167


>gi|126662247|ref|ZP_01733246.1| 30S ribosomal protein S5 [Flavobacteria bacterium BAL38]
 gi|126625626|gb|EAZ96315.1| 30S ribosomal protein S5 [Flavobacteria bacterium BAL38]
          Length = 174

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 70/157 (44%), Positives = 102/157 (64%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + DR+V++NRV+    GGR F FS +VVVGD    VG     +++V EA+ KA E AK+
Sbjct: 17  ELKDRLVSVNRVTKVTKGGRAFGFSAIVVVGDENGVVGHGLGKSKDVSEAIAKAVEDAKK 76

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N++ + L  G+++ H+  G+ G  +V +  A  GTGVIAGGA+RAV E +G+HDV++KS 
Sbjct: 77  NLVRIPL-HGQSVPHEQKGKFGGARVFLMPASHGTGVIAGGAVRAVLESVGIHDVLSKSQ 135

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GSSNPHNV++ATF+ L        VA +RG+    + 
Sbjct: 136 GSSNPHNVVKATFDALLQMRSALTVAKQRGVSLEKVF 172


>gi|261854967|ref|YP_003262250.1| ribosomal protein S5 [Halothiobacillus neapolitanus c2]
 gi|261835436|gb|ACX95203.1| ribosomal protein S5 [Halothiobacillus neapolitanus c2]
          Length = 171

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 78/168 (46%), Positives = 114/168 (67%), Gaps = 1/168 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           +  + E   + +++++VA+NRV+  + GGR F+F+ L VVGD + +VGF +  A+EVP A
Sbjct: 2   SRNSNEVATDGLIEKLVAVNRVAKVVKGGRIFSFTALTVVGDGEGRVGFGYGKAKEVPAA 61

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           ++KA + AKRNM+ V L D  TLH+  VG HGA +V M+ A  GTGVIAGGA+RAV E +
Sbjct: 62  IQKAMDRAKRNMVDVPLRD-GTLHYSTVGHHGAAQVFMKPASEGTGVIAGGAMRAVFEAV 120

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ +V+AK IG+ N  NVIRAT   L+S S P  +A++RG +   +  
Sbjct: 121 GVRNVLAKCIGTRNHMNVIRATVNGLQSISSPEMIASKRGKRVEEIVG 168


>gi|319760346|ref|YP_004124284.1| 30S ribosomal protein S5 [Candidatus Blochmannia vafer str. BVAF]
 gi|318039060|gb|ADV33610.1| 30S ribosomal protein S5 [Candidatus Blochmannia vafer str. BVAF]
          Length = 179

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 70/165 (42%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
             +    +   ++++ +NRVS  + GGR F+F+ L VVG++  KVGF +  AREVP A++
Sbjct: 6   NKQNSNLSEFREKLITVNRVSKTVKGGRVFSFAALTVVGNSNGKVGFGYGKAREVPSAIQ 65

Query: 73  KATEAAKRNMISVS-LLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           KA E A+ N+I V  L  GRTL H  VG +   ++ M+ A  GTG+IAGGA+RA+ EV+G
Sbjct: 66  KAMEKARHNLIDVPFLRTGRTLQHAIVGVYTGARIYMQPASEGTGIIAGGAMRAILEVVG 125

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +H+V+AK+ GS+NP N++RAT   L++   P  +A +RG     +
Sbjct: 126 VHNVLAKAYGSTNPINIVRATVNALKTMKSPEMIAKKRGKSVEYI 170


>gi|145300918|ref|YP_001143759.1| 30S ribosomal protein S5 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|172044480|sp|A4SSY9|RS5_AERS4 RecName: Full=30S ribosomal protein S5
 gi|142853690|gb|ABO92011.1| ribosomal protein S5 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 166

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E +   + ++++A+NRVS  + GGR  +F+ L VVGD   +VG+ +  AREVP A++K
Sbjct: 3   KVESQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGYGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AKRN+  V L +  TLHH   G H    V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEQAKRNLSKVEL-NNGTLHHPVRGVHSGSSVFMKPASQGTGIIAGGAMRAVLEVAGIH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK+ GS+NP NV+RAT + L     P  +A +RG++   +  
Sbjct: 122 NVLAKTYGSTNPINVVRATVDALVQGQSPAQIAAKRGLRVEEILG 166


>gi|116513036|ref|YP_811943.1| 30S ribosomal protein S5 [Lactococcus lactis subsp. cremoris SK11]
 gi|122939919|sp|Q02W42|RS5_LACLS RecName: Full=30S ribosomal protein S5
 gi|116108690|gb|ABJ73830.1| SSU ribosomal protein S5P [Lactococcus lactis subsp. cremoris SK11]
          Length = 168

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 75/167 (44%), Positives = 108/167 (64%), Gaps = 1/167 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +   +   +R+V+INRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA
Sbjct: 3   ENRRNDREQSEFEERVVSINRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA EAAK+N+I+V ++ G TL H+ +G  G GK++++ A+ G GV AGGA+RAV E+ 
Sbjct: 63  IRKAIEAAKKNLITVPMV-GATLPHEALGVFGGGKILLKPAVEGAGVAAGGAVRAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           G+ DV +KS+GS+ P NV+RAT + L       +VA  RG   S   
Sbjct: 122 GVADVTSKSLGSNTPINVVRATVDGLTQLKRAEEVAALRGKSVSDFA 168


>gi|317131386|ref|YP_004090700.1| ribosomal protein S5 [Ethanoligenens harbinense YUAN-3]
 gi|315469365|gb|ADU25969.1| ribosomal protein S5 [Ethanoligenens harbinense YUAN-3]
          Length = 171

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 77/170 (45%), Positives = 112/170 (65%), Gaps = 1/170 (0%)

Query: 9   RDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVP 68
           R+N+++    ++ + +++VAINRVS  + GGR F F+ LVVVGD K KVGF    + EVP
Sbjct: 3   RNNFRSNNREESDLNEKVVAINRVSKTVKGGRIFKFAALVVVGDGKGKVGFGIGKSGEVP 62

Query: 69  EAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           +A+RK  E AK+N+ +V+L  G T+ H+ VG  GAG+V+++ A  GTGVIAGG +RAV E
Sbjct: 63  DAIRKGIEDAKKNLFTVAL-KGTTIPHEIVGAFGAGRVLLKPAAPGTGVIAGGPVRAVVE 121

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V G+ D+  K++ S+NP NV+RAT + L+S      VA  RG     +  
Sbjct: 122 VAGIKDIRTKALRSNNPCNVVRATIQGLKSIRGAERVAEIRGKTVKEILG 171


>gi|225020461|ref|ZP_03709653.1| hypothetical protein CORMATOL_00468 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305679830|ref|ZP_07402640.1| ribosomal protein S5 [Corynebacterium matruchotii ATCC 14266]
 gi|224946850|gb|EEG28059.1| hypothetical protein CORMATOL_00468 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305660450|gb|EFM49947.1| ribosomal protein S5 [Corynebacterium matruchotii ATCC 14266]
          Length = 207

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 71/178 (39%), Positives = 107/178 (60%), Gaps = 1/178 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
             +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A++
Sbjct: 31  NQQQDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQ 90

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  E A++N   V ++ G T+ H   G   AG V++R A  GTGVIAGGA R V E  G+
Sbjct: 91  KGAEEARKNFFRVPMV-GGTITHPVQGEAAAGIVMLRPAAPGTGVIAGGAARPVLECAGI 149

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYS 190
            D+++KS+GS N  NV+ AT   L+    P +VA RRG     +   R++  ++   +
Sbjct: 150 QDILSKSLGSDNAINVVHATVAGLKQLVRPEEVAARRGKSLEEVAPARMLRQRAGQEA 207


>gi|15674063|ref|NP_268238.1| 30S ribosomal protein S5 [Lactococcus lactis subsp. lactis Il1403]
 gi|281492741|ref|YP_003354721.1| 50S ribosomal protein S5P [Lactococcus lactis subsp. lactis KF147]
 gi|26399482|sp|Q9CDY0|RS5_LACLA RecName: Full=30S ribosomal protein S5
 gi|12725134|gb|AAK06179.1|AE006437_9 30S ribosomal protein S5 [Lactococcus lactis subsp. lactis Il1403]
 gi|281376393|gb|ADA65879.1| SSU ribosomal protein S5P [Lactococcus lactis subsp. lactis KF147]
 gi|326407614|gb|ADZ64685.1| 50S ribosomal protein S5P [Lactococcus lactis subsp. lactis CV56]
          Length = 168

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 75/167 (44%), Positives = 108/167 (64%), Gaps = 1/167 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
             +  +   +   +R+V+INRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA
Sbjct: 3   ENRRNDREQSEFEERVVSINRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEA 62

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           +RKA EAAK+N+I+V ++ G TL H+ +G  G GK++++ A+ G GV AGGA+RAV E+ 
Sbjct: 63  IRKAIEAAKKNLITVPMV-GTTLPHEALGVFGGGKILLKPAVEGAGVAAGGAVRAVLELA 121

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           G+ DV +KS+GS+ P NV+RAT + L       +VA  RG   S   
Sbjct: 122 GVADVTSKSLGSNTPINVVRATVDGLNQLKRAEEVAALRGKSVSDFA 168


>gi|86132561|ref|ZP_01051154.1| 30S ribosomal protein S5 [Dokdonia donghaensis MED134]
 gi|85816803|gb|EAQ37988.1| 30S ribosomal protein S5 [Dokdonia donghaensis MED134]
          Length = 174

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 72/168 (42%), Positives = 103/168 (61%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N +  +     + DR+V + RV+    GGR F FS +VVVGD    VG     ++EV  
Sbjct: 6   KNVELVKPSGLDLKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGHGLGKSKEVAS 65

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ + L +  T+ H+  G+ G  +V++  A AGTGVIAGGAIRAV E 
Sbjct: 66  AIAKAMEDAKKNLVRIPL-NKATIPHEQKGKFGGARVLLLPAAAGTGVIAGGAIRAVLES 124

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +G+HDV++K+ GSSNPHNV++ATF+ L        VA +RGI    + 
Sbjct: 125 VGIHDVLSKNQGSSNPHNVVKATFDALLQLRSAETVAKQRGISLDKVF 172


>gi|118465328|ref|YP_883583.1| 30S ribosomal protein S5 [Mycobacterium avium 104]
 gi|254776884|ref|ZP_05218400.1| 30S ribosomal protein S5 [Mycobacterium avium subsp. avium ATCC
           25291]
 gi|118166615|gb|ABK67512.1| 30S ribosomal protein S5 [Mycobacterium avium 104]
          Length = 225

 Score =  167 bits (424), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 73/170 (42%), Positives = 104/170 (61%), Gaps = 1/170 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
            ++ ++R+VAINRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A+ K  E A
Sbjct: 42  KSNYLERVVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEA 101

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           ++    V L+   T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HD++AK
Sbjct: 102 RKGFFRVPLIR-GTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVHDILAK 160

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           S+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S
Sbjct: 161 SLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRES 210


>gi|196019204|ref|XP_002118940.1| hypothetical protein TRIADDRAFT_34973 [Trichoplax adhaerens]
 gi|190577623|gb|EDV18575.1| hypothetical protein TRIADDRAFT_34973 [Trichoplax adhaerens]
          Length = 169

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 81/165 (49%), Positives = 120/165 (72%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
             +  I++++V +NR +    GGR+F+FSV+VVVGD K KVG+    A EV +A RKA++
Sbjct: 3   NNNIEIIEKLVKVNRCTKVTKGGRKFSFSVIVVVGDKKGKVGYGLGKADEVMDAKRKASD 62

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            A++NM  + L +GRTLHHD VG+  +GKV+MR+A AGTGVIAGG  R + EVLG+ D+V
Sbjct: 63  EARKNMFKIPLREGRTLHHDIVGKFCSGKVVMRAAPAGTGVIAGGPTRPLFEVLGIKDIV 122

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           AKS+GS+NPHNV++A    LR+ + P+ +A++RG K + + ++R 
Sbjct: 123 AKSVGSNNPHNVVKAAIIGLRNINTPKMIADKRGKKLAEIASQRE 167


>gi|169335646|ref|ZP_02862839.1| hypothetical protein ANASTE_02066 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258384|gb|EDS72350.1| hypothetical protein ANASTE_02066 [Anaerofustis stercorihominis DSM
           17244]
          Length = 167

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 75/167 (44%), Positives = 104/167 (62%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +N    +  I +++VAINRV+  + GGR F FS LVVVGD    VG     A E+PEA+
Sbjct: 2   NRNFNPEELDIKEKVVAINRVTKVVKGGRNFRFSTLVVVGDENGHVGVGLGKAIEIPEAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  E AK+NM+ VSL+ G T+ H+ +GR GAG+V+M+ A  GTGVIAGG  RAV E+ G
Sbjct: 62  RKGIEDAKKNMVEVSLV-GTTIPHETIGRFGAGRVLMKPAAKGTGVIAGGPARAVIELAG 120

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + D+  KS+GS+N  N+++AT   L       +VA +RG     +  
Sbjct: 121 IKDIRTKSLGSNNASNMVKATLAGLSELVTVEEVAKKRGKTVEEILG 167


>gi|283853170|ref|ZP_06370423.1| ribosomal protein S5 [Desulfovibrio sp. FW1012B]
 gi|283571428|gb|EFC19435.1| ribosomal protein S5 [Desulfovibrio sp. FW1012B]
          Length = 177

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 79/174 (45%), Positives = 113/174 (64%), Gaps = 1/174 (0%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           MA     +       ++ D   +++IV +NRV+  + GGRRF+FS LVVVGD K  VG+ 
Sbjct: 1   MAALNSKRGKEDGMDQQSDLGQIEKIVYLNRVAKVVKGGRRFSFSALVVVGDGKGSVGYG 60

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              A EVPEA+RKATE A++ MI + LLD  TL ++ +G+ GAG+V+++ A  GTG+IAG
Sbjct: 61  LGKANEVPEAIRKATEQARKGMIRIPLLD-GTLPYEVLGQFGAGRVMLKPASKGTGIIAG 119

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           G +RA+ E  G+HD++ K+IG++NPHNV+RAT E L S      V   RG   +
Sbjct: 120 GPVRAIMEACGVHDILTKAIGTNNPHNVLRATMEGLASLRSADVVGTMRGKALA 173


>gi|225443646|ref|XP_002274092.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 340

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 63/163 (38%), Positives = 93/163 (57%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            +E+  +   +R+V + RV+  + GG++  F  +VVVGD + +VG     A+EV  AV+K
Sbjct: 176 KKEKVRDGFEERVVQVRRVTKVVKGGKQLHFRAVVVVGDKQGQVGVGVGKAKEVIAAVQK 235

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           +   A+RN+I+V +    T  H   G +GA KV++R A  GTGVIAGGA+R V E+ G+ 
Sbjct: 236 SATNARRNIITVPMTKYLTFPHRADGDYGAAKVMLRPASPGTGVIAGGAVRIVLEMAGVE 295

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           + + K I S N  N  RAT   ++      DVA  RGI    L
Sbjct: 296 NALGKQIRSKNALNNARATVVAVQKMRQFSDVARERGIPMEEL 338


>gi|116334252|ref|YP_795779.1| 30S ribosomal protein S5 [Lactobacillus brevis ATCC 367]
 gi|122269066|sp|Q03PX4|RS5_LACBA RecName: Full=30S ribosomal protein S5
 gi|116099599|gb|ABJ64748.1| SSU ribosomal protein S5P [Lactobacillus brevis ATCC 367]
          Length = 167

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 70/166 (42%), Positives = 105/166 (63%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           +  +     + D +VAINR++  + GGRR  F+ LV+VGD    VGF    A+EVPEA+R
Sbjct: 3   KFIDPDKLELEDNVVAINRITKVVKGGRRLRFAALVIVGDKNGHVGFGTGKAQEVPEAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA++N+I V ++ G T+ H+ +G  G GK++++ A  G+GV AGGA+R+V E+ G+
Sbjct: 63  KAVEAARKNLIEVPIV-GTTIPHEVLGTFGGGKIMLKPAAEGSGVTAGGAVRSVMELAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV +K +GS+ P N +RATF+ L       +VA  RG+    L  
Sbjct: 122 ADVTSKRLGSNTPVNAVRATFDGLTQLKRAEEVAALRGVSLQHLAE 167


>gi|254253501|ref|ZP_04946819.1| Ribosomal protein S5 [Burkholderia dolosa AUO158]
 gi|124896110|gb|EAY69990.1| Ribosomal protein S5 [Burkholderia dolosa AUO158]
          Length = 191

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 77/172 (44%), Positives = 112/172 (65%), Gaps = 1/172 (0%)

Query: 8   QRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREV 67
           +       +ERD+ + ++++++NRV+  + GGR   F+ L VVGD   +VG     A+EV
Sbjct: 3   KMQAKVQADERDDGLREKMISVNRVTKVVKGGRILGFAALTVVGDGDGRVGMGKGKAKEV 62

Query: 68  PEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVC 127
           P AV+KA E A+RNM  V L +  TL H+  G+HGA  V++  A  GTGVIAGG +RAV 
Sbjct: 63  PVAVQKAMEQARRNMFKVPLKN-GTLQHEVHGKHGASTVLLAPAKDGTGVIAGGPMRAVF 121

Query: 128 EVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +V+G+ +VVAKS GS+NP+N++RAT + LR QS P D+A +RG       A+
Sbjct: 122 DVMGVQNVVAKSHGSTNPYNLVRATLDGLRKQSTPADIAAKRGKSVEEFWAK 173


>gi|81429361|ref|YP_396362.1| 30S ribosomal protein S5 [Lactobacillus sakei subsp. sakei 23K]
 gi|91207866|sp|Q38US8|RS5_LACSS RecName: Full=30S ribosomal protein S5
 gi|78611004|emb|CAI56056.1| 30S ribosomal protein S5 [Lactobacillus sakei subsp. sakei 23K]
          Length = 166

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 73/162 (45%), Positives = 105/162 (64%), Gaps = 1/162 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +     + DR+V+INRV+  + GGRR  F+ +V+VGD    VGF    A+EVPEA+RKA 
Sbjct: 5   DPTHLDLEDRVVSINRVTKVVKGGRRLRFAAIVIVGDKNGHVGFGTGKAQEVPEAIRKAV 64

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK+N+I+V  + G TL H+ +GR GAG+V+++ A+ G+G+ AGGA+RAV E+ G+ DV
Sbjct: 65  EDAKKNLINVPKV-GTTLPHEVIGRFGAGRVLLKPAVEGSGIAAGGAVRAVMELAGIDDV 123

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +K++GS    NVIRAT + L        +A  R I    LQ
Sbjct: 124 TSKTLGSKTAINVIRATIDGLTRMKTAEQIAELRNISVESLQ 165


>gi|317054783|ref|YP_004103250.1| 30S ribosomal protein S5 [Ruminococcus albus 7]
 gi|315447052|gb|ADU20616.1| ribosomal protein S5 [Ruminococcus albus 7]
          Length = 167

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 71/159 (44%), Positives = 101/159 (63%), Gaps = 1/159 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
             + +++VAINRVS  + GGR   FS LVVVGD    VGF    + EVP+A+RKA + AK
Sbjct: 10  EELQEKVVAINRVSKTVKGGRIMKFSALVVVGDGNGIVGFGIGKSGEVPDAIRKAIQDAK 69

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           +N++ +SL  G T+ H+ VG+ GAG+V+++ A  GTG+IAGG +RAV E  G+ D+ AKS
Sbjct: 70  KNLVKISL-KGTTIPHEIVGKFGAGEVLLKPAAPGTGIIAGGTVRAVVEAAGIRDIRAKS 128

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + S+NP+N +RAT   L S      +A  RG     +  
Sbjct: 129 LRSNNPYNAVRATINGLTSVRSAEAIAELRGKTVKEIFE 167


>gi|149376667|ref|ZP_01894426.1| 30S ribosomal protein S5 [Marinobacter algicola DG893]
 gi|149359040|gb|EDM47505.1| 30S ribosomal protein S5 [Marinobacter algicola DG893]
          Length = 166

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 74/164 (45%), Positives = 109/164 (66%), Gaps = 1/164 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            E++   + +++V +NRV+  + GGR FAF+ L VVGD K +VGF    AREVP A++KA
Sbjct: 4   NEQKAPELQEKLVQVNRVAKVVKGGRIFAFTALTVVGDGKGRVGFGRGKAREVPVAIQKA 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            EAA++NM+ + L DG TL +    +HG  KV M+ A  GTG+IAGGA+RAV EV G+ +
Sbjct: 64  MEAARKNMVDIPL-DGNTLQYAVKAQHGGSKVYMQPASEGTGIIAGGAMRAVLEVAGVQN 122

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           V++K  GS+NP NV+R+T + L++   P D+A +RG     +  
Sbjct: 123 VLSKCYGSTNPVNVVRSTIKGLQATQAPEDIAAKRGKSVEEILG 166


>gi|295135684|ref|YP_003586360.1| 30S ribosomal protein S5 [Zunongwangia profunda SM-A87]
 gi|294983699|gb|ADF54164.1| 30S ribosomal protein S5 [Zunongwangia profunda SM-A87]
          Length = 174

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 72/168 (42%), Positives = 104/168 (61%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N ++ +     + DR+V + RV+    GGR F FS +VVVGD    VG     ++EV +
Sbjct: 6   KNVEHVKPGGLELKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGQGLGKSKEVAD 65

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ + L    TL H+  G++G  +V++  A  GTG+IAGGAIRAV E 
Sbjct: 66  AISKAVEDAKKNLVRIPLHK-GTLPHEQKGKYGGARVLLLPAATGTGIIAGGAIRAVLES 124

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +G+HDV++K+ GSSNPHNV++ATF+ L        VA +RGI    L 
Sbjct: 125 VGVHDVLSKNQGSSNPHNVVKATFDALLQLRSADTVAKQRGITLEKLF 172


>gi|268609576|ref|ZP_06143303.1| 30S ribosomal protein S5 [Ruminococcus flavefaciens FD-1]
          Length = 166

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 106/165 (64%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           N E +    V+++VAINRVS  + GGR   FS LVVVGD    VGF    + EVP+A+RK
Sbjct: 3   NIENQAPEFVEKVVAINRVSKTVKGGRIMKFSALVVVGDGNGTVGFGLGKSGEVPDAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK+N++ ++L  G T+ H+ VG  GAG+V+M+ A  GTGVIAGG +RAV EV G+ 
Sbjct: 63  GIEDAKKNLVKIAL-KGTTIPHEIVGAFGAGRVLMKPAAPGTGVIAGGPVRAVIEVAGIK 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           D+  KS+ S+NP NV+RAT   L + +  ++VA +RG     +  
Sbjct: 122 DIRTKSLRSNNPCNVVRATINGLVNCTSAKEVAAKRGKSVKEILG 166


>gi|94987417|ref|YP_595350.1| 30S ribosomal protein S5 [Lawsonia intracellularis PHE/MN1-00]
 gi|172046237|sp|Q1MPP8|RS5_LAWIP RecName: Full=30S ribosomal protein S5
 gi|94731666|emb|CAJ55029.1| ribosomal protein S5 [Lawsonia intracellularis PHE/MN1-00]
          Length = 163

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 75/159 (47%), Positives = 112/159 (70%), Gaps = 1/159 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E+ +   ++++V++NRV+  + GGRRF+FS LVVVGD K  VGF    A+EVPEA+RKAT
Sbjct: 2   EQSELGFIEKVVSLNRVAKVVKGGRRFSFSALVVVGDGKGSVGFGLGKAQEVPEALRKAT 61

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A++ M+ + L++  TL ++ +G  GAG V+++ A  GTG+IAGGA+RA+ E  G+ DV
Sbjct: 62  EQARKAMMKIPLIE-GTLPYEILGEFGAGSVMLKPASRGTGIIAGGAVRAIMEAAGVTDV 120

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           +AK+IG++NPHNV+RAT   L +    + V+N RG    
Sbjct: 121 LAKAIGTNNPHNVLRATMAGLSALRSAQLVSNIRGKLLE 159


>gi|254468785|ref|ZP_05082191.1| ribosomal protein S5 [beta proteobacterium KB13]
 gi|207087595|gb|EDZ64878.1| ribosomal protein S5 [beta proteobacterium KB13]
          Length = 170

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 73/163 (44%), Positives = 110/163 (67%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           +++ + + ++++ +NRV+  + GGR  +F+ L VVGD    +G     AREVP AV+KA 
Sbjct: 8   QQQTDGLKEKMITVNRVTKVVKGGRIMSFAALTVVGDGDGSIGMGKGKAREVPLAVQKAM 67

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AKR M+ VSL    TL H  +G+HGA KV+++ A  GTG+IAGGA+RA+ EV+GMH+V
Sbjct: 68  EEAKRGMLKVSLTKTGTLQHAVIGKHGAAKVLIQPATEGTGIIAGGAMRAIFEVMGMHNV 127

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            AKS GSSNP+N++RAT   L + + P ++A +RG     ++ 
Sbjct: 128 TAKSFGSSNPYNIVRATLNGLANMNTPAEIAAKRGKTVEEIRG 170


>gi|54020087|ref|YP_115718.1| 30S ribosomal protein S5 [Mycoplasma hyopneumoniae 232]
 gi|71893529|ref|YP_278975.1| 30S ribosomal protein S5 [Mycoplasma hyopneumoniae J]
 gi|73919074|sp|Q601J7|RS5_MYCH2 RecName: Full=30S ribosomal protein S5
 gi|91207869|sp|Q4AAF7|RS5_MYCHJ RecName: Full=30S ribosomal protein S5
 gi|53987260|gb|AAV27461.1| 30s ribosomal protein S5 [Mycoplasma hyopneumoniae 232]
 gi|71851656|gb|AAZ44264.1| 30S ribosomal protein S5 [Mycoplasma hyopneumoniae J]
          Length = 216

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 60/178 (33%), Positives = 96/178 (53%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           + R         +       +R++AI+RV   + GGRRF+FS   VVG+ K +VGF H  
Sbjct: 39  QRRRPLRKNSRDKNSKPEFEERVIAIHRVVKVVKGGRRFSFSAFAVVGNKKGRVGFGHGK 98

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EV +AV+KA + A+  ++SV +    T+ H+   ++ A K++++ A  G G++A   +
Sbjct: 99  ANEVQDAVKKAIKDAQNRLVSVPIYRKSTVPHEIAVKYLASKILIKPAPRGKGIVASNTV 158

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           RAV E+ G  D+  K+ GS    NV+RAT + L        VA  R +     QA++V
Sbjct: 159 RAVVELAGYTDIYTKTYGSRTKINVVRATLKALLKLRTINQVAELRDLSPQQAQAQKV 216


>gi|225024807|ref|ZP_03713999.1| hypothetical protein EIKCOROL_01694 [Eikenella corrodens ATCC
           23834]
 gi|224942410|gb|EEG23619.1| hypothetical protein EIKCOROL_01694 [Eikenella corrodens ATCC
           23834]
          Length = 168

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 113/165 (68%), Gaps = 1/165 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            Q+ EER++ +++++VA+NRV+  + GGR  AFS L VVGD   ++G     ++EVP AV
Sbjct: 3   KQDIEERNDGLIEKMVAVNRVTKVVKGGRIMAFSALTVVGDGDGRIGMGKGKSKEVPVAV 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           +KA + A+R+MI VSL +  T+HH+ VG+HGA KV M+ A  G+GV AGG +R + E +G
Sbjct: 63  QKAMDQARRSMIKVSL-NNGTIHHEVVGKHGATKVFMQPAKEGSGVKAGGPMRLIFEAMG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +H++ AK  GS+NP+N++RAT + L     P +VA +RGI    L
Sbjct: 122 VHNISAKVHGSTNPYNIVRATLDGLAKLYTPSEVAAKRGISVEEL 166


>gi|52840591|ref|YP_094390.1| 30S ribosomal protein S5 [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|54293338|ref|YP_125753.1| 30S ribosomal protein S5 [Legionella pneumophila str. Lens]
 gi|54296382|ref|YP_122751.1| 30S ribosomal protein S5 [Legionella pneumophila str. Paris]
 gi|148361036|ref|YP_001252243.1| hypothetical protein LPC_2996 [Legionella pneumophila str. Corby]
 gi|296105895|ref|YP_003617595.1| small subunit ribosomal protein S5 [Legionella pneumophila 2300/99
           Alcoy]
 gi|73919065|sp|Q5X842|RS5_LEGPA RecName: Full=30S ribosomal protein S5
 gi|73919066|sp|Q5ZYM6|RS5_LEGPH RecName: Full=30S ribosomal protein S5
 gi|73919067|sp|Q5WZJ5|RS5_LEGPL RecName: Full=30S ribosomal protein S5
 gi|172047875|sp|A5IHP7|RS5_LEGPC RecName: Full=30S ribosomal protein S5
 gi|52627702|gb|AAU26443.1| 30S ribosomal protein S5 [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|53750167|emb|CAH11559.1| 30S ribosomal subunit protein S5 [Legionella pneumophila str.
           Paris]
 gi|53753170|emb|CAH14617.1| 30S ribosomal subunit protein S5 [Legionella pneumophila str. Lens]
 gi|148282809|gb|ABQ56897.1| hypothetical protein LPC_2996 [Legionella pneumophila str. Corby]
 gi|295647796|gb|ADG23643.1| small subunit ribosomal protein S5 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609154|emb|CBW98610.1| 30S ribosomal subunit protein S5 [Legionella pneumophila 130b]
          Length = 168

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
            + +   +++V++ R +  + GGR F F+VLVVVGD K KVGF    AREVP A++KA +
Sbjct: 7   PKSDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGDGKGKVGFGRGKAREVPIAIQKAMD 66

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK+NM+ + L  G T+ H+    +GA KV M+ A  GTG+IAGGA+RAV EVLG+ +++
Sbjct: 67  QAKKNMVYIPLS-GTTIFHEITWNYGASKVFMKPASEGTGIIAGGAMRAVLEVLGVQNIL 125

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           AKSIGS+NP N++RAT   L     P  VA +RG     + A
Sbjct: 126 AKSIGSTNPSNIVRATIGALTHIGTPDYVAAKRGKTVEEVMA 167


>gi|28867871|ref|NP_790490.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66047758|ref|YP_237599.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. syringae B728a]
 gi|213969231|ref|ZP_03397369.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tomato T1]
 gi|237797449|ref|ZP_04585910.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|257483202|ref|ZP_05637243.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623832|ref|ZP_06456786.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648925|ref|ZP_06480268.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289675505|ref|ZP_06496395.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. syringae FF5]
 gi|301381738|ref|ZP_07230156.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tomato Max13]
 gi|302061062|ref|ZP_07252603.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tomato K40]
 gi|302130797|ref|ZP_07256787.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302189294|ref|ZP_07265967.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. syringae 642]
 gi|37999396|sp|Q889V4|RS5_PSESM RecName: Full=30S ribosomal protein S5
 gi|81307870|sp|Q4ZMR1|RS5_PSEU2 RecName: Full=30S ribosomal protein S5
 gi|28851107|gb|AAO54185.1| ribosomal protein S5 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63258465|gb|AAY39561.1| Ribosomal protein S5, bacterial and organelle form [Pseudomonas
           syringae pv. syringae B728a]
 gi|213925909|gb|EEB59466.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tomato T1]
 gi|320322305|gb|EFW78399.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331963|gb|EFW87899.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330869414|gb|EGH04123.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330879386|gb|EGH13535.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330879425|gb|EGH13574.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330891916|gb|EGH24577.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330899719|gb|EGH31138.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330940904|gb|EGH43857.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330953180|gb|EGH53440.1| 30S ribosomal protein S5 [Pseudomonas syringae Cit 7]
 gi|330962508|gb|EGH62768.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. maculicola str.
           ES4326]
 gi|330966894|gb|EGH67154.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330969804|gb|EGH69870.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330976657|gb|EGH76700.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330988265|gb|EGH86368.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331012430|gb|EGH92486.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331018177|gb|EGH98233.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331020299|gb|EGI00356.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 166

 Score =  167 bits (423), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 77/165 (46%), Positives = 109/165 (66%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            + ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NHDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +V+AK  GS+NP NV+ ATF+ L+    P  +A +RG +   + 
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKGMQSPESIAAKRGKRVEEII 166


>gi|310816993|ref|YP_003964957.1| 30S ribosomal protein S5 [Ketogulonicigenium vulgare Y25]
 gi|308755728|gb|ADO43657.1| 30S ribosomal protein S5 [Ketogulonicigenium vulgare Y25]
          Length = 187

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 96/170 (56%), Positives = 125/170 (73%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GGRR  F+ LVVVGD K +VGF    A+EVPEA+RKATE AK
Sbjct: 18  PEFADRLVAINRVSKTVKGGRRMGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQAK 77

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R+MI V L +GRTLHHD  GRHGAG+++MR+A+ GTG+IAGG +RAV E+LG+ DVV+KS
Sbjct: 78  RSMIRVQLREGRTLHHDIEGRHGAGRIVMRTAVPGTGIIAGGPMRAVFEMLGVQDVVSKS 137

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
           +GS NP+N+IRAT   L+S+  PR VA RRG K + +  R   ++++   
Sbjct: 138 LGSQNPYNMIRATMNALKSEQSPRAVAQRRGKKVADILHRTGEAAEAVEA 187


>gi|111023113|ref|YP_706085.1| 30S ribosomal protein S5 [Rhodococcus jostii RHA1]
 gi|226365612|ref|YP_002783395.1| 30S ribosomal protein S5 [Rhodococcus opacus B4]
 gi|123144248|sp|Q0S3F9|RS5_RHOSR RecName: Full=30S ribosomal protein S5
 gi|254765203|sp|C1B029|RS5_RHOOB RecName: Full=30S ribosomal protein S5
 gi|110822643|gb|ABG97927.1| 30S ribosomal protein S5 [Rhodococcus jostii RHA1]
 gi|226244102|dbj|BAH54450.1| 30S ribosomal protein S5 [Rhodococcus opacus B4]
          Length = 218

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 70/174 (40%), Positives = 109/174 (62%), Gaps = 1/174 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           +    ++ ++R+V INRVS  + GGRRF+F+ LV+VGD    VG  +  A+EVP A++K 
Sbjct: 42  QSAEKSNHIERVVTINRVSKVVKGGRRFSFTALVIVGDGNGLVGVGYGKAKEVPAAIQKG 101

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A+++   V ++ G T+ H   G   AG V++R A  GTGVIAGGA+RAV E  G+HD
Sbjct: 102 VEEARKSFFRVPMI-GSTITHPVQGEAAAGVVMLRPASPGTGVIAGGAVRAVLECAGIHD 160

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           +++KS+GS N  NV+ AT   L+    P +VA RRG+    +    ++ +++ +
Sbjct: 161 ILSKSLGSDNAINVVHATVAALKGLQRPEEVAARRGLALEDVAPAGMLRARAQA 214


>gi|149371646|ref|ZP_01891062.1| 30S ribosomal protein S5 [unidentified eubacterium SCB49]
 gi|149355273|gb|EDM43833.1| 30S ribosomal protein S5 [unidentified eubacterium SCB49]
          Length = 174

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + DR+V + RV+    GGR F FS +VVVGD    VG     +++V  A+ KA E AK+
Sbjct: 17  DLKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGQGLGKSKDVASAIAKAIEDAKK 76

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N++ + L +  TL H+  G++G  +V +  A  GTGVIAGGA+RAV E +G+HDV++KS 
Sbjct: 77  NLVRIPL-NKGTLPHEQKGKYGGARVNLLPAAPGTGVIAGGAVRAVLEAVGIHDVLSKSQ 135

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GSSNPHNV++ATF+ L        VA +RGI    L 
Sbjct: 136 GSSNPHNVVKATFDALLQMRSAHTVAKQRGISLEKLF 172


>gi|229818223|ref|ZP_04448505.1| hypothetical protein BIFANG_03521 [Bifidobacterium angulatum DSM
           20098]
 gi|229784474|gb|EEP20588.1| hypothetical protein BIFANG_03521 [Bifidobacterium angulatum DSM
           20098]
          Length = 242

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 67/172 (38%), Positives = 103/172 (59%), Gaps = 1/172 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
            + + ++DR+V INRVS    GGR F+F+ LVVVGD    VG  +  +REVP A+ K   
Sbjct: 53  NKGDELLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQL 112

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++M +V  +   T+ H  +G   AG V++R A  GTGVIAGG +RAV E  G+ DV+
Sbjct: 113 DAKKHMFNVPRVR-GTITHPVIGHDAAGTVLLRPAAPGTGVIAGGPVRAVMECAGISDVL 171

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            KS+GS    N++RA  + L+    P ++A RRG+    +    ++ ++++ 
Sbjct: 172 TKSMGSPTAINMVRAVVDALKQLEEPEEIAARRGLSLEEVAPDALLRARAAG 223


>gi|312601088|gb|ADQ90343.1| 30S ribosomal protein S5 [Mycoplasma hyopneumoniae 168]
          Length = 216

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 60/178 (33%), Positives = 96/178 (53%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           + R         +       +R++AI+RV   + GGRRF+FS   VVG+ K +VGF H  
Sbjct: 39  QRRRPLRKNARDKNSKPEFEERVIAIHRVVKVVKGGRRFSFSAFAVVGNKKGRVGFGHGK 98

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EV +AV+KA + A+  ++SV +    T+ H+   ++ A K++++ A  G G++A   +
Sbjct: 99  ANEVQDAVKKAIKDAQNRLVSVPIYRKSTVPHEIAVKYLASKILIKPAPRGKGIVASNTV 158

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           RAV E+ G  D+  K+ GS    NV+RAT + L        VA  R +     QA++V
Sbjct: 159 RAVVELAGYTDIYTKTYGSRTKINVVRATLKALLKLRTINQVAELRDLSPQQAQAQKV 216


>gi|308178116|ref|YP_003917522.1| 30S ribosomal protein S5 [Arthrobacter arilaitensis Re117]
 gi|307745579|emb|CBT76551.1| 30S ribosomal protein S5 [Arthrobacter arilaitensis Re117]
          Length = 236

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 74/181 (40%), Positives = 107/181 (59%), Gaps = 1/181 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           D   +R E  +  ++R+VAINRVS  + GGRRF+F+ LVVVGD    VG  +  A+EVP 
Sbjct: 55  DQKDSRNEDKDKFLERVVAINRVSKVVKGGRRFSFTALVVVGDGNGMVGVGYGKAKEVPA 114

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ K  E AK++   V  + G T+ H   G   AG V++R A  GTGVIAGG +RAV E 
Sbjct: 115 AIAKGVEEAKKSFFRVPRV-GTTIPHLVKGEAAAGVVLLRPAAPGTGVIAGGPVRAVLEC 173

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
            G+HD+++KS+GS N  N+++ T   L++   P  VA RRG+    +    ++    S  
Sbjct: 174 AGIHDILSKSMGSQNQINIVQGTIAALKALEEPAAVAARRGLPLDEVAPAAMLRHIQSQK 233

Query: 190 S 190
           +
Sbjct: 234 A 234


>gi|319443005|ref|ZP_07992161.1| 30S ribosomal protein S5 [Corynebacterium variabile DSM 44702]
          Length = 214

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 70/174 (40%), Positives = 106/174 (60%), Gaps = 1/174 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           +++  +  ++R+V INRVS  + GGRRF+F+ LV+VGD +  VG  +  A+EVP A++K 
Sbjct: 39  QDDERSQYIERVVTINRVSKVVKGGRRFSFTALVIVGDGQGMVGVGYGKAKEVPAAIQKG 98

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A++N   V ++ G T+ H   G   AG V M  A  GTGVIAGGA R V E  G+ D
Sbjct: 99  AEEARKNFFRVPMI-GGTITHPVQGEAAAGVVWMAPAAPGTGVIAGGAARPVLECAGVQD 157

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           V++KS+GS N  NV+ AT + L+    P +VA RRG     +    ++ ++++ 
Sbjct: 158 VLSKSLGSDNAINVVHATVDALKQLVRPEEVAARRGKTLEEVAPAAMLRARAAG 211


>gi|116515242|ref|YP_802871.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
 gi|122285362|sp|Q057C1|RS5_BUCCC RecName: Full=30S ribosomal protein S5
 gi|58384675|gb|AAW72690.1| 30S ribosomal protein S5 [Buchnera aphidicola (Cinara cedri)]
 gi|116257096|gb|ABJ90778.1| 30S ribosomal protein S5 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
          Length = 164

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 65/157 (41%), Positives = 101/157 (64%), Gaps = 1/157 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
            ++    + ++++++NRVS  + GGR F+F+ L VVG+ + KVGF +  AREVP A++KA
Sbjct: 4   EKKLSIELKEKLISVNRVSKTVKGGRIFSFTALTVVGNNQGKVGFGYGKAREVPSAIQKA 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E A++NMI + L    T+ H   G H    + M+ A  GTG+IAGGA+R+V EV G+ +
Sbjct: 64  MEKARKNMIIIPLFK-NTIQHSVTGLHTGSFIFMKPASEGTGIIAGGAMRSVLEVAGIQN 122

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGI 171
           ++AK  GS+NP NV+RAT   L+    P  ++ +RG 
Sbjct: 123 ILAKIYGSTNPINVVRATLNGLKKIRSPEMISKKRGK 159


>gi|15599442|ref|NP_252936.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1]
 gi|107103761|ref|ZP_01367679.1| hypothetical protein PaerPA_01004832 [Pseudomonas aeruginosa PACS2]
 gi|116052281|ref|YP_788873.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152987171|ref|YP_001346240.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa PA7]
 gi|218889426|ref|YP_002438290.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa LESB58]
 gi|254237109|ref|ZP_04930432.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa C3719]
 gi|296387197|ref|ZP_06876696.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa PAb1]
 gi|313111400|ref|ZP_07797205.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa 39016]
 gi|26399501|sp|Q9HWF2|RS5_PSEAE RecName: Full=30S ribosomal protein S5
 gi|122261430|sp|Q02T63|RS5_PSEAB RecName: Full=30S ribosomal protein S5
 gi|171460893|sp|A6UZK5|RS5_PSEA7 RecName: Full=30S ribosomal protein S5
 gi|226703374|sp|B7V661|RS5_PSEA8 RecName: Full=30S ribosomal protein S5
 gi|9950463|gb|AAG07634.1|AE004841_12 30S ribosomal protein S5 [Pseudomonas aeruginosa PAO1]
 gi|115587502|gb|ABJ13517.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169040|gb|EAZ54551.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa C3719]
 gi|150962329|gb|ABR84354.1| ribosomal protein S5 [Pseudomonas aeruginosa PA7]
 gi|218769649|emb|CAW25409.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa LESB58]
 gi|310883707|gb|EFQ42301.1| 30S ribosomal protein S5 [Pseudomonas aeruginosa 39016]
          Length = 166

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 81/164 (49%), Positives = 110/164 (67%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR FAF+ L VVGD K +VGF    AREVP A++
Sbjct: 3   NNEQKRDEGYIEKLVQVNRVAKTVKGGRIFAFTALTVVGDGKGRVGFGRGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYPTKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            +V+AK  GS+NP NV+ ATF+ L++   P  VA +RG     +
Sbjct: 122 QNVLAKCYGSTNPVNVVYATFKGLKNMQAPEAVAAKRGKSVEEI 165


>gi|116327241|ref|YP_796961.1| 30S ribosomal protein S5 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116327281|ref|YP_797001.1| 30S ribosomal protein S5 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116332105|ref|YP_801823.1| 30S ribosomal protein S5 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122280165|sp|Q04PV5|RS5_LEPBJ RecName: Full=30S ribosomal protein S5
 gi|122284912|sp|Q055C7|RS5_LEPBL RecName: Full=30S ribosomal protein S5
 gi|116119985|gb|ABJ78028.1| 30S Ribosomal protein S5 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120025|gb|ABJ78068.1| 30S Ribosomal protein S5 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125794|gb|ABJ77065.1| 30S Ribosomal protein S5 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 168

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 67/165 (40%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           ++E      +++V I+RV+  + GGRRF+F+ L VVGD K KVG     A EVP+A+RK+
Sbjct: 4   QDEESKEYSEKVVKIDRVAKVVKGGRRFSFNALSVVGDQKGKVGIGFGKANEVPDAIRKS 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            EAAK++++ ++   G T+ H+ VG+  + +VI++ + AGTG+IAG ++R++ E  G+ D
Sbjct: 64  IEAAKKHLVKINF-KGHTIPHEVVGKFKSARVILKPSTAGTGIIAGASVRSIVEKAGIQD 122

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           V+ KS GSSNP N+++AT + L     P   A +RGI  + L  +
Sbjct: 123 VLTKSWGSSNPVNIVKATLDALEQLETPILAAKKRGISLNQLFGK 167


>gi|222152282|ref|YP_002561457.1| 30S ribosomal protein S5 [Streptococcus uberis 0140J]
 gi|222113093|emb|CAR40469.1| 30S ribosomal protein S5 [Streptococcus uberis 0140J]
          Length = 164

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 107/157 (68%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VAINRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA EAAK+
Sbjct: 9   ELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRVGFGTGKAQEVPEAIRKAVEAAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N++ V ++ G T+ H+    +G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NLVEVPMV-GTTIPHEVFVNYGGAKVLLKPAVEGSGVAAGGAVRAVVELAGIADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RG+  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGVSVSDLA 164


>gi|320094563|ref|ZP_08026329.1| 30S ribosomal protein S5 [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319978478|gb|EFW10055.1| 30S ribosomal protein S5 [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 226

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 80/198 (40%), Positives = 117/198 (59%), Gaps = 3/198 (1%)

Query: 3   QKERSQRDNW--QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           ++ RS R +   +   E  N  ++R+V INRVS  + GGRRF+F+ LVVVGD +  VG  
Sbjct: 18  RERRSGRSDRDGRRNNENKNEYIERVVTINRVSKVVKGGRRFSFTALVVVGDGEGTVGVG 77

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
           +  A+EVP+A+ K  E AK+N   V ++  RT+ H   GR  AG V++R A  GTGVIAG
Sbjct: 78  YGKAKEVPQAISKGVEEAKKNFFRVPMIR-RTITHLVEGRDTAGIVLLRPAAPGTGVIAG 136

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           G +RAV E  G+HDV+ KS+GSSN  N++ AT + L+    P  VA RRG+    +    
Sbjct: 137 GPVRAVLEAAGVHDVLTKSLGSSNAINIVHATVDALKRLEQPEAVAARRGLPLERVAPAS 196

Query: 181 VVSSKSSSYSRDSKNKGG 198
           ++ +++   +     K  
Sbjct: 197 MLRARAEGEADKRAAKEA 214


>gi|71737621|ref|YP_276689.1| 30S ribosomal protein S5 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|91207878|sp|Q48D53|RS5_PSE14 RecName: Full=30S ribosomal protein S5
 gi|71558174|gb|AAZ37385.1| ribosomal protein S5 [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 166

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 76/165 (46%), Positives = 107/165 (64%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            + ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NHDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L    TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDLNC-TTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            +V+AK  GS+NP NV+ ATF+ L+    P  +A +RG +   + 
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKGMQSPESIAAKRGKRVEEII 166


>gi|322388384|ref|ZP_08061987.1| 30S ribosomal protein S5 [Streptococcus infantis ATCC 700779]
 gi|322391216|ref|ZP_08064688.1| 30S ribosomal protein S5 [Streptococcus peroris ATCC 700780]
 gi|321140697|gb|EFX36199.1| 30S ribosomal protein S5 [Streptococcus infantis ATCC 700779]
 gi|321145969|gb|EFX41358.1| 30S ribosomal protein S5 [Streptococcus peroris ATCC 700780]
          Length = 164

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VA+NRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA E AK+
Sbjct: 9   ELEERVVAVNRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEAIRKAVEDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ D+ +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVVELAGVADITSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|326803049|ref|YP_004320867.1| ribosomal protein S5 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650209|gb|AEA00392.1| ribosomal protein S5 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 168

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 73/167 (43%), Positives = 103/167 (61%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
               +  D  I DR+VAINRV+  + GGRR  F+ LVVVGD +  VGF    A EVP A+
Sbjct: 3   KDFVQIDDKKIEDRVVAINRVTKVVKGGRRMRFAALVVVGDGEGHVGFGTGKASEVPAAI 62

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
            KA E  K+NMI+V L  G T+ H+ +G+   G+V+++ A  G+GV AGG IRAV E+ G
Sbjct: 63  NKAIENGKKNMIAVPLA-GTTIPHEVIGKFNGGRVMLKPAKVGSGVAAGGPIRAVVELAG 121

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + D+ +KS+GS+ P N+++AT + L     P++VA  RG     L  
Sbjct: 122 IADITSKSLGSNTPINMVQATIQGLAELKDPKEVAQLRGKSVQELLG 168


>gi|260772113|ref|ZP_05881030.1| SSU ribosomal protein S5p (S2e) [Vibrio metschnikovii CIP 69.14]
 gi|260612980|gb|EEX38182.1| SSU ribosomal protein S5p (S2e) [Vibrio metschnikovii CIP 69.14]
          Length = 167

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RNM +++L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNMFTIAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L     P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVEAISE 167


>gi|257454064|ref|ZP_05619338.1| ribosomal protein S5 [Enhydrobacter aerosaccus SK60]
 gi|257448542|gb|EEV23511.1| ribosomal protein S5 [Enhydrobacter aerosaccus SK60]
          Length = 165

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 82/162 (50%), Positives = 106/162 (65%), Gaps = 1/162 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
           E+ + +V+R+V + RVS  + GGR F+F+ L VVGD   +VGF    AREVP A++KA E
Sbjct: 5   EQTDGLVERLVTVGRVSKVVKGGRIFSFTALTVVGDGNGRVGFGRGKAREVPAAIQKALE 64

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
           AAKRNMI+V L  G TL H     HGA +V M+ A  GTGVIAGGA+RAV EV G+ +V+
Sbjct: 65  AAKRNMITVDLA-GTTLQHPITASHGASRVYMQPASEGTGVIAGGAMRAVLEVAGVENVL 123

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           AK  GS+N  NV+RATF  L+  S P  VA +RG     +  
Sbjct: 124 AKCYGSTNAANVVRATFNGLKEMSSPEKVAAKRGKSVEEILG 165


>gi|262203558|ref|YP_003274766.1| 30S ribosomal protein S5 [Gordonia bronchialis DSM 43247]
 gi|262086905|gb|ACY22873.1| ribosomal protein S5 [Gordonia bronchialis DSM 43247]
          Length = 215

 Score =  167 bits (422), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 74/165 (44%), Positives = 104/165 (63%), Gaps = 1/165 (0%)

Query: 24  DRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMI 83
           +R+V INRVS  + GGRRF+F+ LVVVGD +  VG  +  A+EVP A++K  E A++N  
Sbjct: 50  ERVVTINRVSKVVKGGRRFSFTALVVVGDGQGMVGVGYGKAKEVPAAIQKGVEEARKNFF 109

Query: 84  SVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGSS 143
            V L+   T+ H   G   AG V++R A  GTGVIAGGA+RAV E  G+HDV+AKS+GS 
Sbjct: 110 RVPLI-AGTVTHPVQGEAAAGVVMLRPASPGTGVIAGGAVRAVLECAGVHDVLAKSLGSD 168

Query: 144 NPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
           N  NV+ AT   L+    P +VA RRG+    +    ++ +++  
Sbjct: 169 NAINVVHATVAALKMLQRPEEVAARRGLPIEDVAPAGMLRARAGQ 213


>gi|152031678|sp|Q89A82|RS5_BUCBP RecName: Full=30S ribosomal protein S5
          Length = 171

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/163 (44%), Positives = 102/163 (62%), Gaps = 1/163 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
                 + ++++++NRVS  + GGR F+FS L VVGD   KVGF +  AREVP A++KA 
Sbjct: 6   RNVSGDLKEKLISVNRVSKTVKGGRIFSFSALTVVGDGHGKVGFGYGKAREVPSAIQKAM 65

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E A+RNMI V L +  TL +   G +    + M+ A  GTG+IAGGA+R+V EV G+H+V
Sbjct: 66  EKARRNMIQVPL-NNGTLQYSVTGSYTGSYIFMKPASNGTGIIAGGAMRSVLEVAGVHNV 124

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +AK+ GS+NP NV+RAT  VL S   P  +A +R      +  
Sbjct: 125 LAKTYGSTNPINVVRATMLVLESMKSPEMIALKRNKLVKEILE 167


>gi|77461283|ref|YP_350790.1| 30S ribosomal protein S5 [Pseudomonas fluorescens Pf0-1]
 gi|91207881|sp|Q3K605|RS5_PSEPF RecName: Full=30S ribosomal protein S5
 gi|77385286|gb|ABA76799.1| 30S ribosomal protein S5 [Pseudomonas fluorescens Pf0-1]
          Length = 166

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 78/164 (47%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
            N ++RD   ++++V +NRV+  + GGR F F+ L VVGD K +VGF    +REVP A++
Sbjct: 3   NNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA EAA+RNMI V L +G TL +     HGA KV M+ A  GTG+IAGGA+RAV EV G+
Sbjct: 63  KAMEAARRNMIQVDL-NGTTLQYAMKSAHGASKVYMQPASEGTGIIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
            +V+AK  GS+NP NV+ ATF+ L++   P  +A +RG++   +
Sbjct: 122 QNVLAKCYGSTNPVNVVHATFKGLKAMQSPESIAAKRGLRVEEI 165


>gi|72080516|ref|YP_287574.1| 30S ribosomal protein S5 [Mycoplasma hyopneumoniae 7448]
 gi|91207868|sp|Q4A8I8|RS5_MYCH7 RecName: Full=30S ribosomal protein S5
 gi|71913640|gb|AAZ53551.1| 30S ribosomal protein S5 [Mycoplasma hyopneumoniae 7448]
          Length = 216

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 60/178 (33%), Positives = 96/178 (53%)

Query: 4   KERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHST 63
           + R         +       +R++AI+RV   + GGRRF+FS   VVG+ K +VGF H  
Sbjct: 39  QRRRPLRKNARDKNSKPEFEERVIAIHRVVKVVKGGRRFSFSAFAVVGNKKGRVGFGHGK 98

Query: 64  AREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAI 123
           A EV +AV+KA + A+  ++SV +    T+ H+   ++ A K++++ A  G G++A   +
Sbjct: 99  ANEVQDAVKKAIKDAQNRLVSVPIYRKSTVPHEIAVKYLASKILIKPAPRGKGIVASNTV 158

Query: 124 RAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           RAV E+ G  D+  K+ GS    NV+RAT + L        VA  R +     QA++V
Sbjct: 159 RAVVELAGYTDIYTKTYGSRTKINVVRATLKALLKLRTINQVAELRDLSPQQAQAQKV 216


>gi|332187842|ref|ZP_08389576.1| ribosomal protein S5 [Sphingomonas sp. S17]
 gi|332012192|gb|EGI54263.1| ribosomal protein S5 [Sphingomonas sp. S17]
          Length = 238

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 95/165 (57%), Positives = 121/165 (73%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           EE+   +++++V INRVS  + GG+RF F+ LVVVGD K + GF H  AREVPEA+ KAT
Sbjct: 57  EEQGEELIEKLVHINRVSKTVKGGKRFGFAALVVVGDGKGRAGFGHGKAREVPEAISKAT 116

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
            AAK+ M+ V L DGRTLHHDG G  GAG+V +RSA  GTG+IAGG +RA+ E LG+ DV
Sbjct: 117 AAAKKAMVRVPLKDGRTLHHDGNGHFGAGRVTVRSAPQGTGIIAGGPMRAIFESLGVADV 176

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           V KS+G+SNP+N+IRATFE L  Q+ P+ VA RRG K + L  R 
Sbjct: 177 VTKSVGTSNPYNMIRATFEALGDQTSPKAVAQRRGKKIADLLGRG 221


>gi|117621023|ref|YP_854860.1| ribosomal protein S5 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|171855190|sp|A0KF38|RS5_AERHH RecName: Full=30S ribosomal protein S5
 gi|117562430|gb|ABK39378.1| ribosomal protein S5 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 166

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 105/165 (63%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             E +   + ++++A+NRVS  + GGR  +F+ L VVGD   +VG+ +  AREVP A++K
Sbjct: 3   KVESQAGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGYGYGKAREVPAAIQK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AKRN+  V L +  TLHH   G H    V M+ A  GTG+IAGGA+RAV EV G+H
Sbjct: 63  AMEQAKRNLNKVEL-NNGTLHHPVRGVHSGSTVFMKPASQGTGIIAGGAMRAVLEVAGIH 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK+ GS+NP NV+RAT + L     P  +A +RG++   +  
Sbjct: 122 NVLAKTYGSTNPINVVRATVDALVQGQSPAQIAAKRGLRVEEILG 166


>gi|330814182|ref|YP_004358421.1| SSU ribosomal protein S5p (S2e) [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487277|gb|AEA81682.1| SSU ribosomal protein S5p (S2e) [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 165

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 88/161 (54%), Positives = 124/161 (77%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           + I +++VAINR++  + GGRRF F+ LVV G+ K +VG+    A++VP+A++KA+EAAK
Sbjct: 5   SEIKEKLVAINRITKVVKGGRRFGFAALVVAGNQKGQVGYGQGKAKQVPDAIKKASEAAK 64

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           +++I + L DGRTLHHD  G+ GAGKV++RSA AGTG+IAGGA+RA+CE+ G+ DVV KS
Sbjct: 65  KSLIKIPLRDGRTLHHDVKGKSGAGKVVLRSAPAGTGIIAGGAVRAICEMSGIQDVVGKS 124

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
           IGS+NP+N+IRA F  L SQ  P+D++  RG K   + ARR
Sbjct: 125 IGSANPYNLIRAVFVALGSQQTPKDISLIRGKKIKDIVARR 165


>gi|227509948|ref|ZP_03939997.1| 30S ribosomal protein S5 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227512881|ref|ZP_03942930.1| 30S ribosomal protein S5 [Lactobacillus buchneri ATCC 11577]
 gi|227523009|ref|ZP_03953058.1| 30S ribosomal protein S5 [Lactobacillus hilgardii ATCC 8290]
 gi|227083881|gb|EEI19193.1| 30S ribosomal protein S5 [Lactobacillus buchneri ATCC 11577]
 gi|227089827|gb|EEI25139.1| 30S ribosomal protein S5 [Lactobacillus hilgardii ATCC 8290]
 gi|227190554|gb|EEI70621.1| 30S ribosomal protein S5 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 167

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/167 (42%), Positives = 108/167 (64%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  +     + D +V+INR++  + GGRR  F+ LVVVGD    VGF    A+EVPEA+
Sbjct: 2   KKFIDPDKLELEDNVVSINRITKVVKGGRRLRFAALVVVGDKHGHVGFGTGKAQEVPEAI 61

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RKA EAA++N+I V ++ G T+ H+ VG +G G+++++ A  G+GV AGGA+R+V E+ G
Sbjct: 62  RKAVEAARKNLIEVPIV-GTTIPHEVVGTYGGGRIMLKPAEEGSGVAAGGAVRSVMELAG 120

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + DV +K +GS+ P NVIRATFE L +     +++  RG+    L  
Sbjct: 121 IDDVTSKRLGSNTPVNVIRATFEGLVALKSAEEISALRGVSTQHLAE 167


>gi|171741256|ref|ZP_02917063.1| hypothetical protein BIFDEN_00331 [Bifidobacterium dentium ATCC
           27678]
 gi|283455383|ref|YP_003359947.1| 30S ribosomal protein S5 [Bifidobacterium dentium Bd1]
 gi|171276870|gb|EDT44531.1| hypothetical protein BIFDEN_00331 [Bifidobacterium dentium ATCC
           27678]
 gi|283102017|gb|ADB09123.1| rpsE 30S ribosomal protein S5 [Bifidobacterium dentium Bd1]
          Length = 243

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/178 (40%), Positives = 108/178 (60%), Gaps = 1/178 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
           +N ++DR+V INRVS    GGR F+F+ LVVVGD    VG  +  +REVP A+ K    A
Sbjct: 52  ENEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQLDA 111

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           K++M +V  +   T+ H  +G   AG V++R A  GTGVIAGGA+RAV E  G+ DV+ K
Sbjct: 112 KKHMFTVPRVK-GTVTHPVIGHDAAGTVLLRPAAPGTGVIAGGAVRAVMECAGITDVLTK 170

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           S+GS+   NV+RAT + L+    P ++A RRG+    +    ++ +++   +   K +
Sbjct: 171 SMGSATAVNVVRATVDALKKLEEPEEIAARRGMSLEEVAPDALLRARAEGIAEARKAR 228


>gi|118469641|ref|YP_885854.1| 30S ribosomal protein S5 [Mycobacterium smegmatis str. MC2 155]
 gi|189045482|sp|A0QSG6|RS5_MYCS2 RecName: Full=30S ribosomal protein S5
 gi|118170928|gb|ABK71824.1| ribosomal protein S5 [Mycobacterium smegmatis str. MC2 155]
          Length = 214

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/171 (43%), Positives = 107/171 (62%), Gaps = 1/171 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
            ++ ++R+V+INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A+ K  E A
Sbjct: 33  KSNYIERVVSINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEEA 92

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           ++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HD++AK
Sbjct: 93  RKNFFRVPLI-GSTITHPVQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGVHDILAK 151

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSY 189
           S+GS N  NV+ AT   L+    P +VA RRG+    +    ++ ++  S 
Sbjct: 152 SLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRESE 202


>gi|120402350|ref|YP_952179.1| 30S ribosomal protein S5 [Mycobacterium vanbaalenii PYR-1]
 gi|119955168|gb|ABM12173.1| SSU ribosomal protein S5P [Mycobacterium vanbaalenii PYR-1]
          Length = 225

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/164 (45%), Positives = 101/164 (61%), Gaps = 1/164 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             +  ++R+V INRVS  + GGRRF+F+ LV+VGD K  VG  +  A+EVP A+ K  E 
Sbjct: 43  EKSQYLERVVTINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEE 102

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++N   V L+ G T+ H   G   AG V++R A  GTGVIAGGA RAV E  G+HDV+A
Sbjct: 103 ARKNFFRVPLI-GGTVTHPVQGEAAAGVVMLRPASPGTGVIAGGACRAVLECAGVHDVLA 161

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           KS+GS N  NV+ AT   L+    P +VA RRG+    +    +
Sbjct: 162 KSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGM 205


>gi|149203532|ref|ZP_01880502.1| 30S ribosomal protein S5 [Roseovarius sp. TM1035]
 gi|149143365|gb|EDM31404.1| 30S ribosomal protein S5 [Roseovarius sp. TM1035]
          Length = 188

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 99/161 (61%), Positives = 121/161 (75%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
               DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATEAAK
Sbjct: 17  PEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEAAK 76

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           R MI V L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVVAKS
Sbjct: 77  RAMIRVPLREGRTLHHDMEGRHGAGKVVMRTAPHGTGIIAGGPMRAVFEMLGVQDVVAKS 136

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARR 180
            GS NP+N+IRAT + LR ++ PR VA RRG K + +  + 
Sbjct: 137 TGSQNPYNMIRATLDGLRKETSPRMVAQRRGKKVADILKKG 177


>gi|319942190|ref|ZP_08016506.1| 30S ribosomal protein S5 [Sutterella wadsworthensis 3_1_45B]
 gi|319804243|gb|EFW01135.1| 30S ribosomal protein S5 [Sutterella wadsworthensis 3_1_45B]
          Length = 172

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/169 (43%), Positives = 106/169 (62%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
                 EE+D+ + ++++A+NRV+  + GGR  AF+ L VVGD    +G     +REVP+
Sbjct: 5   QAKNAVEEQDDGLREKMIAVNRVTKVVKGGRILAFAALTVVGDGDGSIGMGTGKSREVPQ 64

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           +V KA E A+  M  V L +  TLHH   GRHGA +VIM  A  G+GVIAGG +RAVC+ 
Sbjct: 65  SVSKAMERARHTMKRVPLKN-GTLHHAVEGRHGASRVIMMPAPEGSGVIAGGPMRAVCDA 123

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +G+ +VVAK+ GS+NP+N++RAT   L +   P ++A +RG     L  
Sbjct: 124 VGIRNVVAKAYGSTNPYNLVRATLNALDNLRSPAEIAAKRGKSVEELLG 172


>gi|223983938|ref|ZP_03634098.1| hypothetical protein HOLDEFILI_01379 [Holdemania filiformis DSM
           12042]
 gi|223964130|gb|EEF68482.1| hypothetical protein HOLDEFILI_01379 [Holdemania filiformis DSM
           12042]
          Length = 170

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/169 (43%), Positives = 106/169 (62%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           +    R ERD    +R+V INRV+  + GGRRF F+ LVV+GD K +VG+    A EVP+
Sbjct: 2   ERKPRRVERDKEFEERVVVINRVTKVVKGGRRFRFAALVVIGDKKGRVGYGTGKANEVPD 61

Query: 70  AVRKATEAAKRNMISVSLLDGR-TLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCE 128
           A++KA+E AK+N+  V L++   T+ H   G +GAG+V ++ A  GTGVIAGGA+RAV E
Sbjct: 62  AIKKASENAKKNLFRVPLVNNGSTIPHAVTGVYGAGEVFLKPAAEGTGVIAGGAVRAVLE 121

Query: 129 VLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           + G+ DV++K IGS  P N++ AT   L+       V+  R  K   ++
Sbjct: 122 LAGVSDVLSKCIGSRTPINMVHATVAGLKELKTIESVSKLREKKPQEIR 170


>gi|227494562|ref|ZP_03924878.1| 30S ribosomal protein S5 [Actinomyces coleocanis DSM 15436]
 gi|226832296|gb|EEH64679.1| 30S ribosomal protein S5 [Actinomyces coleocanis DSM 15436]
          Length = 230

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 76/179 (42%), Positives = 108/179 (60%), Gaps = 1/179 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
                   R E  N  ++R+V INRVS  + GGRRF+F+ LVVVGD +  VG  +  A+E
Sbjct: 28  QSERRDNRRNEEKNQYIERVVTINRVSKVVKGGRRFSFTALVVVGDGEGTVGVGYGKAKE 87

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           VP+A+ K  E AK++ I V ++  RT+ H   G   AG V++R A  GTGVIAGG +RAV
Sbjct: 88  VPQAIAKGVEEAKKSFIRVPMIR-RTITHLVQGEDAAGVVLLRPAAPGTGVIAGGPVRAV 146

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSK 185
            E  G+HDV++KS+GSSN  N++ AT   L+    P  VA RRG+    +    ++ ++
Sbjct: 147 LECAGVHDVLSKSLGSSNAINIVHATIAALKQLEQPEAVAARRGLPLERVAPASMLRAR 205


>gi|322386336|ref|ZP_08059966.1| 30S ribosomal protein S5 [Streptococcus cristatus ATCC 51100]
 gi|321269560|gb|EFX52490.1| 30S ribosomal protein S5 [Streptococcus cristatus ATCC 51100]
          Length = 164

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/157 (47%), Positives = 106/157 (67%), Gaps = 1/157 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + +R+VA+NRV+  + GGRR  F+ LVVVGD   +VGF    A+EVPEA+RKA E AK+
Sbjct: 9   ELEERLVAVNRVTKVVKGGRRLRFAALVVVGDRNGRVGFGTGKAQEVPEAIRKAVEDAKK 68

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I V ++ G T+ H+ +   G  KV+++ A+ G+GV AGGA+RAV E+ G+ DV +KS+
Sbjct: 69  NLIEVPMV-GTTIPHEVLSEFGGAKVLLKPAVEGSGVAAGGAVRAVIELAGVADVTSKSL 127

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           GS+ P N++RAT E L+      +VA  RGI  S L 
Sbjct: 128 GSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDLA 164


>gi|15642574|ref|NP_232207.1| 30S ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121730158|ref|ZP_01682553.1| ribosomal protein S5 [Vibrio cholerae V52]
 gi|147675266|ref|YP_001218073.1| 30S ribosomal protein S5 [Vibrio cholerae O395]
 gi|153217553|ref|ZP_01951234.1| ribosomal protein S5 [Vibrio cholerae 1587]
 gi|153820265|ref|ZP_01972932.1| ribosomal protein S5 [Vibrio cholerae NCTC 8457]
 gi|153827618|ref|ZP_01980285.1| ribosomal protein S5 [Vibrio cholerae MZO-2]
 gi|153831170|ref|ZP_01983837.1| ribosomal protein S5 [Vibrio cholerae 623-39]
 gi|183179730|ref|ZP_02957941.1| ribosomal protein S5 [Vibrio cholerae MZO-3]
 gi|227082696|ref|YP_002811247.1| ribosomal protein S5 [Vibrio cholerae M66-2]
 gi|229507369|ref|ZP_04396874.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae BX 330286]
 gi|229509707|ref|ZP_04399188.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae B33]
 gi|229513502|ref|ZP_04402966.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae TMA 21]
 gi|229516832|ref|ZP_04406278.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae RC9]
 gi|229521645|ref|ZP_04411063.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae TM 11079-80]
 gi|229524560|ref|ZP_04413965.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527491|ref|ZP_04416883.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae 12129(1)]
 gi|229606875|ref|YP_002877523.1| 30S ribosomal protein S5 [Vibrio cholerae MJ-1236]
 gi|254292231|ref|ZP_04962995.1| ribosomal protein S5 [Vibrio cholerae AM-19226]
 gi|254851119|ref|ZP_05240469.1| 30S ribosomal protein S5 [Vibrio cholerae MO10]
 gi|255744452|ref|ZP_05418404.1| SSU ribosomal protein S5p (S2e) [Vibrio cholera CIRS 101]
 gi|258622731|ref|ZP_05717749.1| 30S ribosomal protein S5 [Vibrio mimicus VM573]
 gi|258625757|ref|ZP_05720636.1| 30S ribosomal protein S5 [Vibrio mimicus VM603]
 gi|261211134|ref|ZP_05925423.1| SSU ribosomal protein S5p (S2e) [Vibrio sp. RC341]
 gi|262166600|ref|ZP_06034337.1| SSU ribosomal protein S5p (S2e) [Vibrio mimicus VM223]
 gi|262170484|ref|ZP_06038162.1| SSU ribosomal protein S5p (S2e) [Vibrio mimicus MB-451]
 gi|262401866|ref|ZP_06078431.1| SSU ribosomal protein S5p (S2e) [Vibrio sp. RC586]
 gi|297581421|ref|ZP_06943344.1| ribosomal protein S5 [Vibrio cholerae RC385]
 gi|298500597|ref|ZP_07010401.1| SSU ribosomal protein S5 [Vibrio cholerae MAK 757]
 gi|26399510|sp|Q9KP01|RS5_VIBCH RecName: Full=30S ribosomal protein S5
 gi|172047560|sp|A5F563|RS5_VIBC3 RecName: Full=30S ribosomal protein S5
 gi|254765208|sp|C3LRP1|RS5_VIBCM RecName: Full=30S ribosomal protein S5
 gi|9657166|gb|AAF95720.1| ribosomal protein S5 [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121628100|gb|EAX60639.1| ribosomal protein S5 [Vibrio cholerae V52]
 gi|124113495|gb|EAY32315.1| ribosomal protein S5 [Vibrio cholerae 1587]
 gi|126509186|gb|EAZ71780.1| ribosomal protein S5 [Vibrio cholerae NCTC 8457]
 gi|146317149|gb|ABQ21688.1| ribosomal protein S5 [Vibrio cholerae O395]
 gi|148873357|gb|EDL71492.1| ribosomal protein S5 [Vibrio cholerae 623-39]
 gi|149737904|gb|EDM52809.1| ribosomal protein S5 [Vibrio cholerae MZO-2]
 gi|150421850|gb|EDN13833.1| ribosomal protein S5 [Vibrio cholerae AM-19226]
 gi|183013141|gb|EDT88441.1| ribosomal protein S5 [Vibrio cholerae MZO-3]
 gi|227010584|gb|ACP06796.1| ribosomal protein S5 [Vibrio cholerae M66-2]
 gi|227014468|gb|ACP10678.1| ribosomal protein S5 [Vibrio cholerae O395]
 gi|229335123|gb|EEO00608.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae 12129(1)]
 gi|229338141|gb|EEO03158.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229341239|gb|EEO06243.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae TM 11079-80]
 gi|229345895|gb|EEO10867.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae RC9]
 gi|229349379|gb|EEO14335.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae TMA 21]
 gi|229353181|gb|EEO18120.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae B33]
 gi|229354874|gb|EEO19795.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae BX 330286]
 gi|229369530|gb|ACQ59953.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae MJ-1236]
 gi|254846824|gb|EET25238.1| 30S ribosomal protein S5 [Vibrio cholerae MO10]
 gi|255737977|gb|EET93370.1| SSU ribosomal protein S5p (S2e) [Vibrio cholera CIRS 101]
 gi|258581995|gb|EEW06865.1| 30S ribosomal protein S5 [Vibrio mimicus VM603]
 gi|258584919|gb|EEW09650.1| 30S ribosomal protein S5 [Vibrio mimicus VM573]
 gi|260839635|gb|EEX66246.1| SSU ribosomal protein S5p (S2e) [Vibrio sp. RC341]
 gi|261891560|gb|EEY37546.1| SSU ribosomal protein S5p (S2e) [Vibrio mimicus MB-451]
 gi|262026316|gb|EEY44984.1| SSU ribosomal protein S5p (S2e) [Vibrio mimicus VM223]
 gi|262351838|gb|EEZ00969.1| SSU ribosomal protein S5p (S2e) [Vibrio sp. RC586]
 gi|297534259|gb|EFH73097.1| ribosomal protein S5 [Vibrio cholerae RC385]
 gi|297540766|gb|EFH76823.1| SSU ribosomal protein S5 [Vibrio cholerae MAK 757]
 gi|327485061|gb|AEA79468.1| SSU ribosomal protein S5p (S2e) [Vibrio cholerae LMA3894-4]
          Length = 167

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 74/166 (44%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+R+M++++L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRSMVTIAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L     P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVEAISE 167


>gi|27364197|ref|NP_759725.1| 30S ribosomal protein S5 [Vibrio vulnificus CMCP6]
 gi|37678576|ref|NP_933185.1| 30S ribosomal protein S5 [Vibrio vulnificus YJ016]
 gi|320157584|ref|YP_004189963.1| 30S ribosomal protein S5p (S2e) [Vibrio vulnificus MO6-24/O]
 gi|29611838|sp|Q8DE57|RS5_VIBVU RecName: Full=30S ribosomal protein S5
 gi|71153731|sp|Q7MPH1|RS5_VIBVY RecName: Full=30S ribosomal protein S5
 gi|27360315|gb|AAO09252.1| ribosomal protein S5 [Vibrio vulnificus CMCP6]
 gi|37197316|dbj|BAC93156.1| ribosomal protein S5 [Vibrio vulnificus YJ016]
 gi|319932896|gb|ADV87760.1| SSU ribosomal protein S5p (S2e) [Vibrio vulnificus MO6-24/O]
          Length = 167

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/166 (45%), Positives = 112/166 (67%), Gaps = 1/166 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           + ++ + N + ++++A+NRVS  + GGR  +F+ L VVGD   +VGF +  AREVP A++
Sbjct: 3   KEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAAIQ 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E A+RNM++++L +  TLHH   GRH   KV M+ A  GTGVIAGGA+RAV EV G+
Sbjct: 63  KAMEKARRNMVTIAL-NEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAGV 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           H+V++K+ GS+NP N++RAT + L     P  VA +RG+    +  
Sbjct: 122 HNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVEAISE 167


>gi|300867118|ref|ZP_07111784.1| 30S ribosomal protein S5 [Oscillatoria sp. PCC 6506]
 gi|300334873|emb|CBN56950.1| 30S ribosomal protein S5 [Oscillatoria sp. PCC 6506]
          Length = 183

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 62/183 (33%), Positives = 101/183 (55%), Gaps = 5/183 (2%)

Query: 1   MAQKERSQRDNWQNRE-----ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKS 55
           MA+++  +  N   ++     +++    +R+V I RV+  + GG++ +F  +V++G+ + 
Sbjct: 1   MAEQKEQRNSNTNKKKSNKSRDKEPEWQERVVQIRRVTKVVKGGKKLSFRAIVIIGNERG 60

Query: 56  KVGFAHSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGT 115
           +VG     A +V  AV+K     K+++I V L    ++ H   G  G  KV+MR A  GT
Sbjct: 61  QVGVGVGKASDVIGAVKKGVADGKKHLIEVPLTKANSIPHPVNGEGGGAKVMMRPASPGT 120

Query: 116 GVIAGGAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSL 175
           GVIAGGA+R V E+ G+ +++AK +GS NP N  RA    L S     +VA  RG+    
Sbjct: 121 GVIAGGAVRTVLELAGVRNILAKQLGSGNPLNNARAAVNALSSLRTFSEVAQERGVPVEH 180

Query: 176 LQA 178
           L A
Sbjct: 181 LYA 183


>gi|313673450|ref|YP_004051561.1| SSU ribosomal protein s5p [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940206|gb|ADR19398.1| SSU ribosomal protein S5P [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 167

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 65/162 (40%), Positives = 105/162 (64%), Gaps = 1/162 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
           + + D++V I RV+  + GGR F F+ +V+VGD    VG  +  AREVP+A+RKA EAAK
Sbjct: 6   SQLEDKVVHIGRVTKVVKGGRIFRFTAMVIVGDRNGSVGIGYGKAREVPDAIRKALEAAK 65

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           +N+I + +    T+ H+ +G+ GA ++IM+ A  GTG+I+GG  R++ E+ G+HD++AKS
Sbjct: 66  KNLIKLPISK-GTIPHEVIGKFGAAEIIMKPAAPGTGIISGGVTRSLFELAGVHDILAKS 124

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRV 181
           + S NP+N+I A F+  +       +A  RG + S +  R+ 
Sbjct: 125 VRSRNPNNLILAVFDGFKKIRTLDKIAAYRGKEISEIIYRKE 166


>gi|120437157|ref|YP_862843.1| 30S ribosomal protein S5 [Gramella forsetii KT0803]
 gi|171460859|sp|A0M581|RS5_GRAFK RecName: Full=30S ribosomal protein S5
 gi|117579307|emb|CAL67776.1| 30S ribosomal protein S5 [Gramella forsetii KT0803]
          Length = 174

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/168 (42%), Positives = 105/168 (62%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N ++ +     + DR+V + RV+    GGR F FS +VVVGD    VG     ++EV +
Sbjct: 6   KNVEHVKPGGLELKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGQGLGKSKEVAD 65

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ + L    TL H+  G++G  +V++  A AGTG+IAGGAIRAV E 
Sbjct: 66  AISKAVEDAKKNLVRIPLHK-GTLPHEQKGKYGGARVMLLPAAAGTGIIAGGAIRAVLES 124

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +G+HDV++K+ GSSNPHNV++ATF+ L        VA +RG+    + 
Sbjct: 125 VGVHDVLSKNQGSSNPHNVVKATFDALLQLRSAETVAKQRGVSLEKVF 172


>gi|325678673|ref|ZP_08158283.1| ribosomal protein S5 [Ruminococcus albus 8]
 gi|324109723|gb|EGC03929.1| ribosomal protein S5 [Ruminococcus albus 8]
          Length = 167

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/159 (45%), Positives = 101/159 (63%), Gaps = 1/159 (0%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
             + +++VAINRVS  + GGR   FS LVVVGD    VGF    + EVP+A+RKA + AK
Sbjct: 10  EELQEKVVAINRVSKTVKGGRIMKFSALVVVGDGNGIVGFGIGKSGEVPDAIRKAIQDAK 69

Query: 80  RNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKS 139
           +N++ VSL  G T+ H+ VG+ GAG+V+++ A  GTG+IAGG +RAV E  G+ D+ AKS
Sbjct: 70  KNLVRVSL-KGTTIPHEIVGKFGAGEVLLKPAAPGTGIIAGGTVRAVVEAAGIRDIRAKS 128

Query: 140 IGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + S+NP+N +RAT   L S      +A  RG     +  
Sbjct: 129 LRSNNPYNAVRATINGLTSVRSAEAIAELRGKTVKEIFE 167


>gi|256544523|ref|ZP_05471896.1| 30S ribosomal protein S5 [Anaerococcus vaginalis ATCC 51170]
 gi|256399848|gb|EEU13452.1| 30S ribosomal protein S5 [Anaerococcus vaginalis ATCC 51170]
          Length = 168

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 68/164 (41%), Positives = 99/164 (60%), Gaps = 1/164 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
            ++    ++ DR+V+INRV+  + GGR   F+ LVVVGD    VG     A EVPEA+RK
Sbjct: 5   KQDVDKLNLEDRVVSINRVAKTVKGGRNMRFAALVVVGDQNGHVGVGTGKATEVPEAIRK 64

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           ATE  K++M++V +++  T+ H  +   GAG V++  A  GTG+IAGG +RA+CE+ G  
Sbjct: 65  ATEDGKKHMVTVPIVN-TTVPHRILANKGAGSVLLMPAKEGTGIIAGGPVRAICELAGYK 123

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           D+ AK++GSSNP N+I A  +   S     +VA  RG       
Sbjct: 124 DIRAKNLGSSNPKNIINACLKAFASMKTVEEVARLRGKSIEEFD 167


>gi|332170576|gb|AEE19831.1| ribosomal protein S5 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 174

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/168 (42%), Positives = 103/168 (61%), Gaps = 1/168 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
            N +  +     + DR+V + RV+    GGR F FS +VVVGD    VG     ++EV  
Sbjct: 6   KNVELVKPSGLDLKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGHGLGKSKEVAS 65

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A+ KA E AK+N++ + L +  T+ H+  G+ G  +V++  A AGTGVIAGGAIRAV E 
Sbjct: 66  AIAKAMEDAKKNLVRIPL-NKATIPHEQKGKFGGARVLLLPAAAGTGVIAGGAIRAVLES 124

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           +G+HDV++K+ GSSNPHNV++ATF+ L        VA +RGI    + 
Sbjct: 125 VGIHDVLSKNQGSSNPHNVVKATFDALLKLRSAETVAKQRGITLDKVF 172


>gi|228472303|ref|ZP_04057069.1| ribosomal protein S5 [Capnocytophaga gingivalis ATCC 33624]
 gi|228276506|gb|EEK15230.1| ribosomal protein S5 [Capnocytophaga gingivalis ATCC 33624]
          Length = 174

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/171 (42%), Positives = 104/171 (60%), Gaps = 1/171 (0%)

Query: 7   SQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTARE 66
               N +  +     + DR+V + RV+    GGR F FS +VVVGD    VG     ++E
Sbjct: 3   QNYKNVEYVKPSGLELKDRLVGVQRVTKVTKGGRAFGFSAIVVVGDENGVVGQGLGKSKE 62

Query: 67  VPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAV 126
           V EA+ KA E AK+N++ + L +G TL H+  G+ G  +V ++ A  GTGVIAGG +RAV
Sbjct: 63  VSEAIAKAVEDAKKNLVRIPL-NGTTLPHEQKGKFGGARVYLQPAAEGTGVIAGGVVRAV 121

Query: 127 CEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
            E LG+H+V++KS GSSNPHNV++ATF+ L      + +A +RGI    + 
Sbjct: 122 LESLGVHNVLSKSQGSSNPHNVVKATFDALLRLRSAKTIAQQRGISLDKMF 172


>gi|45658686|ref|YP_002772.1| 30S ribosomal protein S5 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|294827727|ref|NP_710937.2| 30S ribosomal protein S5 [Leptospira interrogans serovar Lai str.
           56601]
 gi|302393811|sp|Q72NH8|RS5_LEPIC RecName: Full=30S ribosomal protein S5
 gi|302393812|sp|Q9XD19|RS5_LEPIN RecName: Full=30S ribosomal protein S5
 gi|45601930|gb|AAS71409.1| 30S ribosomal protein S5 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|293385570|gb|AAN47955.2| 30S ribosomal protein S5 [Leptospira interrogans serovar Lai str.
           56601]
          Length = 168

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 64/165 (38%), Positives = 108/165 (65%), Gaps = 1/165 (0%)

Query: 15  REERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKA 74
           ++E      +++V I+RV+  + GGRRF+F+ L VVGD + KVG     A EVP+A+RK+
Sbjct: 4   QDEESKEYSEKVVKIDRVAKVVKGGRRFSFNALSVVGDQRGKVGIGFGKANEVPDAIRKS 63

Query: 75  TEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHD 134
            E+AK++++ ++   G T+ H+ +G+  + +VI++ + AGTG+IAG ++R++ E  G+ D
Sbjct: 64  IESAKKHLVKINF-KGHTIPHEVIGKFKSARVILKPSTAGTGIIAGASVRSIVEKAGIQD 122

Query: 135 VVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           V+ KS GSSNP N+++AT + L     P   A +RGI  + L  +
Sbjct: 123 VLTKSWGSSNPVNIVKATLDALEQLETPILAAKKRGISLNKLFGK 167


>gi|258406168|ref|YP_003198910.1| 30S ribosomal protein S5 [Desulfohalobium retbaense DSM 5692]
 gi|257798395|gb|ACV69332.1| ribosomal protein S5 [Desulfohalobium retbaense DSM 5692]
          Length = 163

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/159 (44%), Positives = 113/159 (71%), Gaps = 1/159 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E+ D  +++++V +NRV+  + GGR F+F+ LVVVGD   KVGF H  A +VP+A+RKAT
Sbjct: 2   EQNDLGLIEKVVYLNRVAKVVKGGRNFSFAALVVVGDGNGKVGFGHGKANQVPDAIRKAT 61

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           + AK++M  V+LL+  TL ++ +G +GAG+V+++ A  GTG+IAGG +RAV E +G+ D+
Sbjct: 62  DRAKKDMFDVALLE-GTLPYEVIGHYGAGRVMLKPASEGTGIIAGGPVRAVMEAVGVRDI 120

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           + K+IG++NP+NV++AT   L+S     +V   RG +  
Sbjct: 121 LTKAIGTNNPYNVLKATIAGLQSLRSAEEVGRLRGKQLQ 159


>gi|311693288|gb|ADP96161.1| 30S ribosomal protein S5 [marine bacterium HP15]
          Length = 169

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/169 (44%), Positives = 110/169 (65%), Gaps = 1/169 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
           +     E++   + +++V +NRV+  + GGR FAF+ L VVGD K +VGF    AREVP 
Sbjct: 2   EKMSVNEQKAPELQEKLVQVNRVAKVVKGGRIFAFTALTVVGDGKGRVGFGRGKAREVPV 61

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           A++KA EAA++NM+ V L DG TL +    +HG  KV M+ A  GTG+IAGGA+RAV EV
Sbjct: 62  AIQKAMEAARKNMVEVPL-DGTTLQYPVKAQHGGSKVYMQPASEGTGIIAGGAMRAVLEV 120

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            G+ +V++K  GS+NP NV+R+T + L++   P D+A +RG     +  
Sbjct: 121 AGVQNVLSKCYGSTNPVNVVRSTIKGLQATQAPEDIAAKRGKTVEEILG 169


>gi|254461021|ref|ZP_05074437.1| ribosomal protein S5 [Rhodobacterales bacterium HTCC2083]
 gi|206677610|gb|EDZ42097.1| ribosomal protein S5 [Rhodobacteraceae bacterium HTCC2083]
          Length = 189

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 99/162 (61%), Positives = 122/162 (75%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
                 DR+VAINRVS  + GG+RF F+ LVVVGD K +VGF    A+EVPEA+RKATE 
Sbjct: 14  ETPEFADRLVAINRVSKTVKGGKRFGFAALVVVGDQKGRVGFGKGKAKEVPEAIRKATEQ 73

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           AKR MI V+L +GRTLHHD  GRHGAGKV+MR+A  GTG+IAGG +RAV E+LG+ DVVA
Sbjct: 74  AKRQMIRVALREGRTLHHDVEGRHGAGKVVMRTAPQGTGIIAGGPMRAVFEMLGVQDVVA 133

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           KSIGS NP+N+IRAT + L+ +S PR VA RRG K + +  +
Sbjct: 134 KSIGSQNPYNMIRATMDGLKKESSPRSVAQRRGKKVADILKK 175


>gi|160872208|ref|ZP_02062340.1| ribosomal protein S5 [Rickettsiella grylli]
 gi|159121007|gb|EDP46345.1| ribosomal protein S5 [Rickettsiella grylli]
          Length = 167

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/165 (44%), Positives = 112/165 (67%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
           ++  + + + ++++A+NR +  + GGR F+F+  VVVGD K ++GF+   AREV  A++K
Sbjct: 4   DQSTKSDGLQEKLIAVNRHAKVVKGGRIFSFAAGVVVGDGKGRIGFSKRPAREVSVAMQK 63

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E A+R+M+ V L +  T+ H  +GRHGA KVI+  A+ GTG+IAGG +RA+ EVLG+ 
Sbjct: 64  ALEKARRDMLYVEL-NNHTVFHPLIGRHGATKVIILPAIEGTGIIAGGPMRAIFEVLGIK 122

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           +V+AK IGSSN  NV+RAT + L S S P  +A++RG     +  
Sbjct: 123 NVIAKIIGSSNRINVVRATLKALSSMSTPEMIADKRGKSIKEIYE 167


>gi|306823551|ref|ZP_07456926.1| 30S ribosomal protein S5 [Bifidobacterium dentium ATCC 27679]
 gi|309802901|ref|ZP_07697002.1| ribosomal protein S5 [Bifidobacterium dentium JCVIHMP022]
 gi|304553258|gb|EFM41170.1| 30S ribosomal protein S5 [Bifidobacterium dentium ATCC 27679]
 gi|308220368|gb|EFO76679.1| ribosomal protein S5 [Bifidobacterium dentium JCVIHMP022]
          Length = 243

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/178 (40%), Positives = 108/178 (60%), Gaps = 1/178 (0%)

Query: 19  DNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAA 78
           +N ++DR+V INRVS    GGR F+F+ LVVVGD    VG  +  +REVP A+ K    A
Sbjct: 52  ENEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQLDA 111

Query: 79  KRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAK 138
           K++M +V  +   T+ H  +G   AG V++R A  GTGVIAGGA+RAV E  G+ DV+ K
Sbjct: 112 KKHMFTVPRVK-GTVTHPVIGHDAAGTVLLRPAAPGTGVIAGGAVRAVMECAGITDVLTK 170

Query: 139 SIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRDSKNK 196
           S+GS+   NV+RAT + L+    P ++A RRG+    +    ++ +++   +   K +
Sbjct: 171 SMGSATAVNVVRATVDALKKLEEPEEIAARRGMSLEEVAPDALLRARAEGIAEARKAR 228


>gi|325280951|ref|YP_004253493.1| ribosomal protein S5 [Odoribacter splanchnicus DSM 20712]
 gi|324312760|gb|ADY33313.1| ribosomal protein S5 [Odoribacter splanchnicus DSM 20712]
          Length = 168

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 75/165 (45%), Positives = 103/165 (62%), Gaps = 1/165 (0%)

Query: 13  QNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVR 72
           Q     D  + DR+VAINRV+    GGR F+F+ +VVVGD    VG+    A EV  A+ 
Sbjct: 3   QKVNNTDLELKDRLVAINRVTKVTKGGRTFSFAAIVVVGDENGIVGWGLGKANEVTTAIS 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           K  EAAK+N+I V +L   T+ H+ V R    +V M+ A +GTG++AGGA+RAV E  G+
Sbjct: 63  KGIEAAKKNLIKVPVLK-GTIPHEQVARFSGSEVYMQPASSGTGLVAGGAMRAVLESAGI 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           HDV+AKS GSSNPHN+++AT   L+     R +A +RGI    + 
Sbjct: 122 HDVLAKSKGSSNPHNLVKATIAALKEMRDARTIAAQRGISLDKVF 166


>gi|224542255|ref|ZP_03682794.1| hypothetical protein CATMIT_01430 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524797|gb|EEF93902.1| hypothetical protein CATMIT_01430 [Catenibacterium mitsuokai DSM
           15897]
          Length = 191

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 70/158 (44%), Positives = 97/158 (61%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
               R+V INRV+  + GGR+  F+ LVV+GD K +VGF    A EVP+A+RKA EAAKR
Sbjct: 35  EFETRVVTINRVTKVVKGGRKMRFAALVVIGDRKGRVGFGTGKANEVPDAIRKAEEAAKR 94

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N+I+V  ++  T+ H+  G   +G V +R A  GTG+IAGG +RAV E+ G  D+++K +
Sbjct: 95  NLITVPNIN-GTIPHEITGNFKSGSVFLRPAAKGTGIIAGGPVRAVVELAGYSDILSKCL 153

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS  P N++RAT E L S      VA  R I    +  
Sbjct: 154 GSRTPINMVRATIEGLASLKTAEQVAELRDITVEKIYG 191


>gi|307107911|gb|EFN56152.1| hypothetical protein CHLNCDRAFT_35091 [Chlorella variabilis]
          Length = 237

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 67/168 (39%), Positives = 102/168 (60%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
           + + + E++++  +R+V I RV+  + GG++ +F  +VVVGD    VG    +A EV +A
Sbjct: 67  DEEEQYEKEDNFQERVVQIRRVTKVVKGGKQLSFRAVVVVGDENGTVGVGCDSAGEVVQA 126

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           VRKA   AKRN++SV L    +  H   G  GA KV++R A  GTGVIAGGA+R V E+ 
Sbjct: 127 VRKAVVDAKRNLVSVPLNKNNSFPHKVDGIFGAAKVMLRPAAEGTGVIAGGAVRVVLELA 186

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           G+ +   K +G++NP N  RAT E ++S    + V++ RGI  + L  
Sbjct: 187 GVKNGFGKQLGTANPLNNARATLEGIKSMRTFQQVSDLRGIPVADLMG 234


>gi|30248435|ref|NP_840505.1| 30S ribosomal protein S5 [Nitrosomonas europaea ATCC 19718]
 gi|73919079|sp|Q82X75|RS5_NITEU RecName: Full=30S ribosomal protein S5
 gi|30138321|emb|CAD84329.1| Ribosomal protein S5 [Nitrosomonas europaea ATCC 19718]
          Length = 177

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/179 (39%), Positives = 114/179 (63%), Gaps = 2/179 (1%)

Query: 1   MAQKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFA 60
           M +  +S  +     E + + + +++V++NRV+  + GGR   F+ L VVGD K  VG  
Sbjct: 1   MTKTTKSA-NTKTPDEVKTDGLKEKMVSVNRVTKVVKGGRILGFAALTVVGDGKGSVGMG 59

Query: 61  HSTAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAG 120
              +REVP AV+KA + A++ M+ V+L++  TLHH  +GRHGA +V M+ A  GTG+IAG
Sbjct: 60  KGKSREVPLAVQKAMDEARQRMVRVNLIN-GTLHHSVIGRHGAARVYMQPASEGTGIIAG 118

Query: 121 GAIRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           G +RA+ EV+G+H+++AK +GS+NP+N++RAT + L     P  +A +RG     +   
Sbjct: 119 GPMRAIFEVMGVHNILAKCLGSTNPYNIVRATLDGLSKVQTPAMIAAKRGKSIDEITGA 177


>gi|289579125|ref|YP_003477752.1| ribosomal protein S5 [Thermoanaerobacter italicus Ab9]
 gi|297545312|ref|YP_003677614.1| ribosomal protein S5 [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|289528838|gb|ADD03190.1| ribosomal protein S5 [Thermoanaerobacter italicus Ab9]
 gi|296843087|gb|ADH61603.1| ribosomal protein S5 [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 167

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 77/166 (46%), Positives = 105/166 (63%), Gaps = 2/166 (1%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGD-TKSKVGFAHSTAREVPEAVR 72
             +     + +R+V+INRV+  + GGR F FSV VVVGD  K  VG     A E+P+A+R
Sbjct: 3   RVDWTKLDLKERVVSINRVAKVVKGGRNFRFSVTVVVGDAEKGYVGVGRGKAAEIPDAIR 62

Query: 73  KATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
           KA E AK+++I V ++ G T+ H+ +G  GAGKV+++ A  GTGVIAGG +RAV E  G+
Sbjct: 63  KAIEDAKKHLIKVPIV-GTTIPHEVIGEFGAGKVLLKPAKEGTGVIAGGPVRAVLESAGI 121

Query: 133 HDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
            DV+ KS+GSSN  N++ AT E L+      DVA  RGI  S L  
Sbjct: 122 KDVLTKSLGSSNATNMVYATMEGLKRLRTAEDVARLRGIPVSQLFE 167


>gi|183601961|ref|ZP_02963330.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|241190450|ref|YP_002967844.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241195856|ref|YP_002969411.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|183218846|gb|EDT89488.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|240248842|gb|ACS45782.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240250410|gb|ACS47349.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|295793437|gb|ADG32972.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 234

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/172 (39%), Positives = 104/172 (60%), Gaps = 1/172 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
             +N ++DR+V INRVS    GGR F+F+ LVVVGD    VG  +  +REVP A+ K   
Sbjct: 43  NHENEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQL 102

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK+++ +V  +   T+ H   G   AG V++R A  GTGVIAG A+RAV E  G+ D++
Sbjct: 103 DAKKHLFNVPRIR-GTVTHPVTGHDHAGTVMLRPAAPGTGVIAGSAVRAVMECAGITDIL 161

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            KS+GS+   NV+RAT + L+    P ++A RRG+    +   +++  +++ 
Sbjct: 162 TKSMGSATAVNVVRATVDALKQLEEPEEIAARRGLSVQEVAPDQLLRERAAG 213


>gi|150392143|ref|YP_001322192.1| ribosomal protein S5 [Alkaliphilus metalliredigens QYMF]
 gi|171460828|sp|A6TWG5|RS5_ALKMQ RecName: Full=30S ribosomal protein S5
 gi|149952005|gb|ABR50533.1| ribosomal protein S5 [Alkaliphilus metalliredigens QYMF]
          Length = 169

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/167 (40%), Positives = 99/167 (59%), Gaps = 1/167 (0%)

Query: 12  WQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAV 71
            +  +     + +++V I RV+  + GGR F F+ LVVVGD    VG     A E+P+A+
Sbjct: 4   NKRIDANQLDMKEQVVDIRRVTKVVKGGRNFRFAALVVVGDENGHVGVGTGKAMEIPDAI 63

Query: 72  RKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLG 131
           RK  +AAK+N++ V  + G T+ H+ +G  GAG V++  A  GTG+IAGG +RAV E+ G
Sbjct: 64  RKGIQAAKKNLLLVPTV-GTTVPHEVIGHFGAGNVLIMPAKEGTGIIAGGPVRAVLELAG 122

Query: 132 MHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           + DV AKS+G++N  N++ AT + LR      DVA  RG     L  
Sbjct: 123 IKDVRAKSLGTNNSRNMVSATMDGLRQLKRAEDVAKLRGKSVEELLG 169


>gi|218885204|ref|YP_002434525.1| 30S ribosomal protein S5 [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226703347|sp|B8DNB3|RS5_DESVM RecName: Full=30S ribosomal protein S5
 gi|218756158|gb|ACL07057.1| ribosomal protein S5 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 163

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 81/159 (50%), Positives = 114/159 (71%), Gaps = 1/159 (0%)

Query: 16  EERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKAT 75
           E+ +  +V++IV +NRV+  + GGRRF+FS LVVVGD K  VGF    A+EVPEA+RKAT
Sbjct: 2   EQNEFGLVEKIVYLNRVAKVVKGGRRFSFSALVVVGDAKGAVGFGLGKAQEVPEALRKAT 61

Query: 76  EAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDV 135
           E AK++M+ + L+D  TL ++ +G  GAG V+++ A  GTG+IAGGA+RAV E +G+ DV
Sbjct: 62  ERAKKDMVQIPLVD-GTLPYEILGEFGAGCVMLKPASKGTGIIAGGAVRAVMEAVGVTDV 120

Query: 136 VAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHS 174
           +AK+IG++NPHNV+RAT   L S      V+  RG+K  
Sbjct: 121 LAKAIGTNNPHNVLRATMAGLTSLRSAEYVSQLRGMKLE 159


>gi|121592830|ref|YP_984726.1| 30S ribosomal protein S5 [Acidovorax sp. JS42]
 gi|222109610|ref|YP_002551874.1| 30S ribosomal protein s5 [Acidovorax ebreus TPSY]
 gi|171769443|sp|A1W325|RS5_ACISJ RecName: Full=30S ribosomal protein S5
 gi|254765691|sp|B9MBV4|RS5_DIAST RecName: Full=30S ribosomal protein S5
 gi|120604910|gb|ABM40650.1| SSU ribosomal protein S5P [Acidovorax sp. JS42]
 gi|221729054|gb|ACM31874.1| ribosomal protein S5 [Acidovorax ebreus TPSY]
          Length = 173

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 78/170 (45%), Positives = 112/170 (65%), Gaps = 1/170 (0%)

Query: 10  DNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPE 69
                 E +D+ + ++++A+NRV+  + GGR   F+ L VVGD   +VG     ++EVP 
Sbjct: 5   QPKVQSEGQDDGLREKMIAVNRVTKVVKGGRILGFAALTVVGDGDGRVGMGKGKSKEVPA 64

Query: 70  AVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEV 129
           AV+KA E A+RNM+ VSL +  T+HH+  G HGA  V+M  A  GTG+IAGG +RAV EV
Sbjct: 65  AVQKAMEEARRNMVKVSLKN-GTIHHNVTGHHGAAVVMMAPAPKGTGIIAGGPMRAVFEV 123

Query: 130 LGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQAR 179
           +G+ D+VAKS GSSNP+N++RATF+ L + + P +VA +RG     L A 
Sbjct: 124 MGITDIVAKSHGSSNPYNMVRATFDALTNSTTPAEVAAKRGKTVEDLFAA 173


>gi|219682874|ref|YP_002469257.1| 30S ribosomal protein S5 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|254764628|sp|B8DW30|RS5_BIFA0 RecName: Full=30S ribosomal protein S5
 gi|219620524|gb|ACL28681.1| ribosomal protein S5 [Bifidobacterium animalis subsp. lactis AD011]
 gi|289178174|gb|ADC85420.1| SSU ribosomal protein S5P [Bifidobacterium animalis subsp. lactis
           BB-12]
          Length = 243

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/172 (39%), Positives = 104/172 (60%), Gaps = 1/172 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
             +N ++DR+V INRVS    GGR F+F+ LVVVGD    VG  +  +REVP A+ K   
Sbjct: 52  NHENEMLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQL 111

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK+++ +V  +   T+ H   G   AG V++R A  GTGVIAG A+RAV E  G+ D++
Sbjct: 112 DAKKHLFNVPRIR-GTVTHPVTGHDHAGTVMLRPAAPGTGVIAGSAVRAVMECAGITDIL 170

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            KS+GS+   NV+RAT + L+    P ++A RRG+    +   +++  +++ 
Sbjct: 171 TKSMGSATAVNVVRATVDALKQLEEPEEIAARRGLSVQEVAPDQLLRERAAG 222


>gi|167973073|ref|ZP_02555350.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 5 str. ATCC
           27817]
 gi|167974850|ref|ZP_02557127.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 11 str. ATCC
           33695]
 gi|167975987|ref|ZP_02558264.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 12 str. ATCC
           33696]
 gi|167988486|ref|ZP_02570157.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 7 str. ATCC
           27819]
 gi|168362019|ref|ZP_02695198.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 13 str. ATCC
           33698]
 gi|195867625|ref|ZP_03079627.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 9 str. ATCC
           33175]
 gi|198273599|ref|ZP_03206134.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 4 str. ATCC
           27816]
 gi|209554268|ref|YP_002284647.1| 30S ribosomal protein S5 [Ureaplasma urealyticum serovar 10 str.
           ATCC 33699]
 gi|225550732|ref|ZP_03771681.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 2 str. ATCC
           27814]
 gi|225551645|ref|ZP_03772591.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 8 str. ATCC
           27618]
 gi|226703394|sp|B5ZB57|RS5_UREU1 RecName: Full=30S ribosomal protein S5
 gi|171903604|gb|EDT49893.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 13 str. ATCC
           33698]
 gi|184209060|gb|EDU06103.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 5 str. ATCC
           27817]
 gi|188018890|gb|EDU56930.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 7 str. ATCC
           27819]
 gi|188997782|gb|EDU66879.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 11 str. ATCC
           33695]
 gi|195659614|gb|EDX52994.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 12 str. ATCC
           33696]
 gi|195660682|gb|EDX53937.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 9 str. ATCC
           33175]
 gi|198249627|gb|EDY74408.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 4 str. ATCC
           27816]
 gi|209541769|gb|ACI59998.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 10 str. ATCC
           33699]
 gi|225379460|gb|EEH01825.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 8 str. ATCC
           27618]
 gi|225379886|gb|EEH02248.1| ribosomal protein S5 [Ureaplasma urealyticum serovar 2 str. ATCC
           27814]
          Length = 203

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 69/174 (39%), Positives = 98/174 (56%)

Query: 3   QKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHS 62
           ++    +     RE   ++  +R+V I R+S    GGR   FS LVV+GD    VGF   
Sbjct: 30  KENTQPKAKTFKRETTTSNFEERVVKIKRISKTTKGGRMMRFSALVVIGDKNGTVGFGMG 89

Query: 63  TAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGA 122
            + EVP+A++KA + A  N+I V      +++HD  GRHGA KV++  A  GTG+IAGG 
Sbjct: 90  KSIEVPDAIKKAIKNANNNLIKVKQTKKGSIYHDVNGRHGAAKVMLLPAPEGTGIIAGGP 149

Query: 123 IRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +RAV E+ G  D+  KS G++ P NVIRAT   L  Q  P+++A  R      L
Sbjct: 150 VRAVVELAGFTDIYTKSRGANAPMNVIRATINGLLQQLTPQEIARLRDKSLKEL 203


>gi|297625799|ref|YP_003687562.1| 30S ribosomal protein S5 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921564|emb|CBL56118.1| 30S ribosomal protein S5 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 226

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/172 (41%), Positives = 102/172 (59%), Gaps = 1/172 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
             ++R+V INRV+  + GGRRF+F+ LVVVGD +  VG  +  A+EVP A+ K  E AK+
Sbjct: 56  QYLERVVTINRVAKVVQGGRRFSFTALVVVGDGEGTVGVGYGKAKEVPAAIAKGVEEAKK 115

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
           N   V ++  R++ H   G   AG V++R A  GTGVIAGGA RAV E  G+ DV+AKS+
Sbjct: 116 NFFKVPMV-QRSIPHPVQGEKAAGVVMLRPASPGTGVIAGGACRAVLECAGIQDVLAKSL 174

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSSYSRD 192
           GS N  NV+ AT   L+    P  +A RRG   + +    ++ ++     + 
Sbjct: 175 GSPNAINVVHATVAALKMLEEPEQIAKRRGKSVADVTPAALLRARQEVEVKA 226


>gi|224370674|ref|YP_002604838.1| RpsE [Desulfobacterium autotrophicum HRM2]
 gi|223693391|gb|ACN16674.1| RpsE [Desulfobacterium autotrophicum HRM2]
          Length = 164

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/163 (47%), Positives = 109/163 (66%), Gaps = 1/163 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
                D+ ++D++V INRV+  + GGR F+FS LVVVGD +  VG+    A EVPEA+RK
Sbjct: 3   QNHAEDSLLIDKVVKINRVAKVVKGGRNFSFSALVVVGDGEGSVGYGLGKAGEVPEAIRK 62

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
             E AK++M  VS+LD  T+  + VGR GAG+V+++ A  GTGVIAGG +RAV E  G+ 
Sbjct: 63  GLEKAKKSMTKVSILD-GTIPFEIVGRAGAGRVMLKPASPGTGVIAGGGVRAVLEAAGVT 121

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           D++ K IG++N HNV+RAT   L+S     +VA RRG++   +
Sbjct: 122 DILTKCIGTNNTHNVVRATMAGLKSLETKDEVARRRGLRPEDI 164


>gi|148381404|ref|YP_001255945.1| ribosomal protein S5 [Clostridium botulinum A str. ATCC 3502]
 gi|153931344|ref|YP_001385779.1| 30S ribosomal protein S5 [Clostridium botulinum A str. ATCC 19397]
 gi|153935616|ref|YP_001389186.1| 30S ribosomal protein S5 [Clostridium botulinum A str. Hall]
 gi|153938963|ref|YP_001392817.1| 30S ribosomal protein S5 [Clostridium botulinum F str. Langeland]
 gi|168178849|ref|ZP_02613513.1| ribosomal protein S5 [Clostridium botulinum NCTC 2916]
 gi|168181881|ref|ZP_02616545.1| 30S ribosomal protein S5 [Clostridium botulinum Bf]
 gi|187776593|ref|ZP_02993066.1| hypothetical protein CLOSPO_00107 [Clostridium sporogenes ATCC
           15579]
 gi|226950916|ref|YP_002806007.1| ribosomal protein S5 [Clostridium botulinum A2 str. Kyoto]
 gi|237796925|ref|YP_002864477.1| 30S ribosomal protein S5 [Clostridium botulinum Ba4 str. 657]
 gi|171769166|sp|A7FQ40|RS5_CLOB1 RecName: Full=30S ribosomal protein S5
 gi|171769267|sp|A7GJ57|RS5_CLOBL RecName: Full=30S ribosomal protein S5
 gi|172047870|sp|A5I7I9|RS5_CLOBH RecName: Full=30S ribosomal protein S5
 gi|148290888|emb|CAL85024.1| 30S ribosomal protein S5 [Clostridium botulinum A str. ATCC 3502]
 gi|152927388|gb|ABS32888.1| 30S ribosomal protein S5 [Clostridium botulinum A str. ATCC 19397]
 gi|152931530|gb|ABS37029.1| 30S ribosomal protein S5 [Clostridium botulinum A str. Hall]
 gi|152934859|gb|ABS40357.1| 30S ribosomal protein S5 [Clostridium botulinum F str. Langeland]
 gi|182669899|gb|EDT81875.1| ribosomal protein S5 [Clostridium botulinum NCTC 2916]
 gi|182674866|gb|EDT86827.1| 30S ribosomal protein S5 [Clostridium botulinum Bf]
 gi|187775252|gb|EDU39054.1| hypothetical protein CLOSPO_00107 [Clostridium sporogenes ATCC
           15579]
 gi|226842115|gb|ACO84781.1| ribosomal protein S5 [Clostridium botulinum A2 str. Kyoto]
 gi|229262322|gb|ACQ53355.1| 30S ribosomal protein S5 [Clostridium botulinum Ba4 str. 657]
 gi|295320797|gb|ADG01175.1| 30S ribosomal protein S5 [Clostridium botulinum F str. 230613]
 gi|322807789|emb|CBZ05364.1| SSU ribosomal protein S5p (S2e) [Clostridium botulinum H04402 065]
          Length = 165

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/165 (43%), Positives = 102/165 (61%), Gaps = 1/165 (0%)

Query: 14  NREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRK 73
             +    ++ +++V INRV+  + GGR F FSVLVVVGD    VG     + E+PEA+RK
Sbjct: 2   RIDPSTLNLKEKVVHINRVAKVVKGGRNFRFSVLVVVGDEAGHVGVGTGKSIEIPEAIRK 61

Query: 74  ATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMH 133
           A E AK+N++ V  + G T+ HD +G+ G G+V++ +A  GTGVIAGG +RAV E+ G+ 
Sbjct: 62  AIEDAKKNIVEVKTV-GTTVPHDIIGKFGKGEVLIMTAKEGTGVIAGGPVRAVLELAGLK 120

Query: 134 DVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           DV AKS GS+NP N++ AT + L       D+A  RG     +  
Sbjct: 121 DVRAKSKGSNNPTNMVNATIDGLARLRTVEDIAKLRGKTVEEILG 165


>gi|23466147|ref|NP_696750.1| 30S ribosomal protein S5 [Bifidobacterium longum NCC2705]
 gi|46190257|ref|ZP_00206391.1| COG0098: Ribosomal protein S5 [Bifidobacterium longum DJO10A]
 gi|239621027|ref|ZP_04664058.1| 30S ribosomal protein S5 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|26399343|sp|P59122|RS5_BIFLO RecName: Full=30S ribosomal protein S5
 gi|23326884|gb|AAN25386.1| ribosomal protein S5 [Bifidobacterium longum NCC2705]
 gi|239516128|gb|EEQ55995.1| 30S ribosomal protein S5 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
          Length = 233

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 70/172 (40%), Positives = 104/172 (60%), Gaps = 1/172 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
              + ++DR+V INRVS    GGR F+F+ LVVVGD    VG  +  +REVP A+ K   
Sbjct: 40  NHGDELLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQL 99

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++M SV  +   T+ H   G   AG V++R A  GTGVIAGG++RAV E  G+ DV+
Sbjct: 100 DAKKHMFSVPRVR-GTITHPVQGHDAAGTVLLRPAAPGTGVIAGGSVRAVMECAGITDVL 158

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            KS+GS+   NV+RAT + L+    P ++A RRG+    +    ++ ++++ 
Sbjct: 159 TKSMGSATAVNVVRATVDALKQLEEPEEIAARRGLALDEVAPDALLRARAAG 210


>gi|288942055|ref|YP_003444295.1| 30S ribosomal protein S5 [Allochromatium vinosum DSM 180]
 gi|288897427|gb|ADC63263.1| ribosomal protein S5 [Allochromatium vinosum DSM 180]
          Length = 168

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 80/161 (49%), Positives = 111/161 (68%), Gaps = 1/161 (0%)

Query: 18  RDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEA 77
             + +++++VA+NRV+  + GGR+F F+ L VVGD K +VGF    AREVP A++KA E 
Sbjct: 9   EGDDLLEKLVAVNRVAKVVKGGRQFGFAALTVVGDGKGRVGFGRGKAREVPIAIQKAMEN 68

Query: 78  AKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVA 137
           A++NMI V L +G TL +   G+HGA KV M+ A  GTG+IAGGA+RAV EVLG+ +V+A
Sbjct: 69  ARKNMIEVKL-NGSTLQYPLQGKHGAAKVFMQPASEGTGIIAGGAMRAVFEVLGVQNVLA 127

Query: 138 KSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           K IG++NP NV+RAT   LR+ S P  VA +RG     +  
Sbjct: 128 KCIGTNNPINVVRATVNGLRAMSDPATVAAKRGKSVEEILG 168


>gi|189440586|ref|YP_001955667.1| 30S ribosomal protein S5 [Bifidobacterium longum DJO10A]
 gi|213693071|ref|YP_002323657.1| ribosomal protein S5 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227546493|ref|ZP_03976542.1| ribosomal protein S5 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|312133891|ref|YP_004001230.1| rpse [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483433|ref|ZP_07942423.1| ribosomal protein S5 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689912|ref|YP_004209646.1| 30S ribosomal protein S5 [Bifidobacterium longum subsp. infantis
           157F]
 gi|322691853|ref|YP_004221423.1| 30S ribosomal protein S5 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|226703328|sp|B3DQD1|RS5_BIFLD RecName: Full=30S ribosomal protein S5
 gi|254764629|sp|B7GNC3|RS5_BIFLI RecName: Full=30S ribosomal protein S5
 gi|189429021|gb|ACD99169.1| Ribosomal protein S5 [Bifidobacterium longum DJO10A]
 gi|213524532|gb|ACJ53279.1| ribosomal protein S5 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|227213042|gb|EEI80921.1| ribosomal protein S5 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|311773185|gb|ADQ02673.1| RpsE [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915119|gb|EFV36551.1| ribosomal protein S5 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456709|dbj|BAJ67331.1| 30S ribosomal protein S5 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320459249|dbj|BAJ69870.1| 30S ribosomal protein S5 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|320461248|dbj|BAJ71868.1| 30S ribosomal protein S5 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 243

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 70/172 (40%), Positives = 104/172 (60%), Gaps = 1/172 (0%)

Query: 17  ERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATE 76
              + ++DR+V INRVS    GGR F+F+ LVVVGD    VG  +  +REVP A+ K   
Sbjct: 50  NHGDELLDRVVTINRVSKTHKGGRTFSFAALVVVGDGNGTVGVGYGKSREVPAAIAKGQL 109

Query: 77  AAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVV 136
            AK++M SV  +   T+ H   G   AG V++R A  GTGVIAGG++RAV E  G+ DV+
Sbjct: 110 DAKKHMFSVPRVR-GTITHPVQGHDAAGTVLLRPAAPGTGVIAGGSVRAVMECAGITDVL 168

Query: 137 AKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKSSS 188
            KS+GS+   NV+RAT + L+    P ++A RRG+    +    ++ ++++ 
Sbjct: 169 TKSMGSATAVNVVRATVDALKQLEEPEEIAARRGLALDEVAPDALLRARAAG 220


>gi|330718956|ref|ZP_08313556.1| 30S ribosomal protein S5 [Leuconostoc fallax KCTC 3537]
          Length = 168

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 75/158 (47%), Positives = 102/158 (64%), Gaps = 1/158 (0%)

Query: 21  SIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKR 80
            + + +VAINRV+  + GGRR  F+ LVVVGD    VGF    A+EVPEA+RKA E AKR
Sbjct: 12  ELEENVVAINRVTKVVKGGRRLRFAALVVVGDKDGHVGFGTGKAQEVPEAIRKAVEDAKR 71

Query: 81  NMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSI 140
            +I+V  +   T+ H+ +G  G GK++++ A  G+GV AGGA RAV E+ G+ DV AKS+
Sbjct: 72  KLITVPTV-QTTIPHEVLGEWGGGKILVKPAEEGSGVAAGGAARAVMELAGIADVTAKSL 130

Query: 141 GSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQA 178
           GS+ P NV+RATF+ L S     +VA  RG+    L  
Sbjct: 131 GSATPVNVVRATFDALISLKDAEEVAKLRGVSLEHLAE 168


>gi|294155432|ref|YP_003559816.1| 30S ribosomal protein S5 [Mycoplasma crocodyli MP145]
 gi|291600167|gb|ADE19663.1| 30S ribosomal protein S5 [Mycoplasma crocodyli MP145]
          Length = 254

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 65/174 (37%), Positives = 105/174 (60%), Gaps = 1/174 (0%)

Query: 3   QKERSQRDNWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHS 62
           Q+    R N + +E+      +++V I RV+  + GGRRF+FS  VVVG+ K +VG+ H 
Sbjct: 81  QRRDGSRPNNRVKEDAFPDFSEKVVDIARVTKVVKGGRRFSFSAFVVVGNKKGRVGYGHG 140

Query: 63  TAREVPEAVRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGA 122
            A EVP+A++KA + A+ N+I+VS+++  T+ H+   +  A KV+++ A  G G+IA G 
Sbjct: 141 KANEVPDAIKKAIKDAQNNLINVSVIN-GTVPHEIQAKFLASKVMLKPAPKGKGLIASGT 199

Query: 123 IRAVCEVLGMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLL 176
           +RAV E+ G  D+V K+ GS +  N ++AT E L++   P  +A  R      L
Sbjct: 200 VRAVVELAGYTDIVTKTYGSRSKSNTVKATVEALKNLRTPEQIAFIRDKDVKEL 253


>gi|291298727|ref|YP_003510005.1| 30S ribosomal protein S5 [Stackebrandtia nassauensis DSM 44728]
 gi|290567947|gb|ADD40912.1| ribosomal protein S5 [Stackebrandtia nassauensis DSM 44728]
          Length = 208

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/164 (43%), Positives = 111/164 (67%), Gaps = 1/164 (0%)

Query: 23  VDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNM 82
           ++++V+INRV+  + GGRRF+F+ LVVVGD   +VG  +  A+EVP A+ K  E AK+N 
Sbjct: 42  IEKVVSINRVAKVVKGGRRFSFTALVVVGDGNGQVGVGYGKAKEVPAAIAKGVEEAKKNY 101

Query: 83  ISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGMHDVVAKSIGS 142
            +V  + G T+ H  +GR  AG+V+++ A AGTGVIAGG++RAV E  G+HDV++KS+GS
Sbjct: 102 FTVPRI-GGTIPHPIIGRDAAGEVLLKPASAGTGVIAGGSVRAVLECAGIHDVLSKSLGS 160

Query: 143 SNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQARRVVSSKS 186
            N  N++ AT + L++   P  VA RRG+    +    ++ +++
Sbjct: 161 DNAINIVHATVKALKTLEGPETVAARRGLPIEDVAPAAMLRARA 204


>gi|160896488|ref|YP_001562070.1| 30S ribosomal protein S5 [Delftia acidovorans SPH-1]
 gi|226703346|sp|A9BRW8|RS5_DELAS RecName: Full=30S ribosomal protein S5
 gi|160362072|gb|ABX33685.1| ribosomal protein S5 [Delftia acidovorans SPH-1]
          Length = 173

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/167 (46%), Positives = 111/167 (66%), Gaps = 1/167 (0%)

Query: 11  NWQNREERDNSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEA 70
                E RD+ + ++++A+NRV+  + GGR   F+ L VVGD   +VG     ++EVP A
Sbjct: 6   PKVQDEGRDDGLREKMIAVNRVTKVVKGGRILGFAALTVVGDGDGRVGMGKGKSKEVPAA 65

Query: 71  VRKATEAAKRNMISVSLLDGRTLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVL 130
           V+KA E ++RNMI VSL    T+HH  +G+HGA  V++  A  GTG+IAGG +RAV EVL
Sbjct: 66  VQKAMEESRRNMIKVSL-KHGTIHHTVMGQHGAASVMLNPAPKGTGIIAGGPMRAVFEVL 124

Query: 131 GMHDVVAKSIGSSNPHNVIRATFEVLRSQSHPRDVANRRGIKHSLLQ 177
           G+ D+VAKS GSSNP+N++RATF+ L+  + P +VA +RG     + 
Sbjct: 125 GITDIVAKSHGSSNPYNMVRATFDALKHSTTPSEVAAKRGKSVEDIF 171


>gi|169350812|ref|ZP_02867750.1| hypothetical protein CLOSPI_01586 [Clostridium spiroforme DSM 1552]
 gi|169292398|gb|EDS74531.1| hypothetical protein CLOSPI_01586 [Clostridium spiroforme DSM 1552]