RPSBLAST alignment for GI: 254780244 and conserved domain: KOG0877

>gnl|CDD|36095 KOG0877, KOG0877, KOG0877, 40S ribosomal protein S2/30S ribosomal protein S5 [Translation, ribosomal structure and biogenesis]. Length = 213
 Score = 63.1 bits (153), Expect = 4e-11
 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 8/142 (5%)

Query: 20  NSIVDRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAK 79
            S+ D ++ I  V      G+R  F   V +GD    VG     ++EV  A+R A   AK
Sbjct: 49  ASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILAK 108

Query: 80  RNMISVSLLDGR-------TLHHDGVGRHGAGKVIMRSAMAGTGVIAGGAIRAVCEVLGM 132
            +++ V             T+     G  G+  V +  A  GTG+++    + +  + G+
Sbjct: 109 LSIVPVRRGYWGNKIGKPHTVPCKVTGDCGSVLVRLIPAPRGTGIVSAPVPKKLLMMAGI 168

Query: 133 HDVVAKSIGSSNPH-NVIRATF 153
            D    + G +    N  +ATF
Sbjct: 169 DDCYTSARGCTATLGNFAKATF 190