RPSBLAST alignment of GI: 254780244 and SCOP domain: d2uube2

Alignment
>d2uube2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 69
 Score = 82.7 bits (205), Expect = 2e-17
 Identities = 30/66 (45%), Positives = 41/66 (62%)

Query: 24 DRIVAINRVSTALPGGRRFAFSVLVVVGDTKSKVGFAHSTAREVPEAVRKATEAAKRNMI 83
          ++++ I R +    GGRRF F  LVVVGD + +VG     A EVP AV+KA   A+RNM+
Sbjct: 4  EKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMV 63

Query: 84 SVSLLD 89
           V L +
Sbjct: 64 EVPLQN 69

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: dsRBD-like
superfamily: dsRNA-binding domain-like
family: Ribosomal S5 protein, N-terminal domain
domain: Ribosomal S5 protein, N-terminal domain
species: Thermus thermophilus [TaxId: 274]