RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780245|ref|YP_003064658.1| 50S ribosomal protein L18 [Candidatus Liberibacter asiaticus str. psy62] (120 letters) >gnl|CDD|177061 CHL00139, rpl18, ribosomal protein L18; Validated. Length = 109 Score = 105 bits (264), Expect = 3e-24 Identities = 51/108 (47%), Positives = 72/108 (66%), Gaps = 1/108 (0%) Query: 13 SRIRRHLKSVSRGRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEPLRSSLKTGANIV 72 R+R+ +K + R RLSV RS+KHIY QIIDD+ G TLV+ S+L ++SSL + + Sbjct: 3 ERVRKKIKGTAE-RPRLSVFRSNKHIYAQIIDDTNGKTLVACSTLEPDVKSSLSSTSTCD 61 Query: 73 AATAVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGGVSF 120 A+ VG L ++++K G+ V FDRG LY GRI ALA+A R+ G+ F Sbjct: 62 ASKLVGQKLAKKSLKKGITKVVFDRGGKLYHGRIKALAEAAREAGLQF 109 >gnl|CDD|144453 pfam00861, Ribosomal_L18p, Ribosomal L18p/L5e family. This family includes ribosomal proteins from the large subunit. This family includes L18 from bacteria and L5 from eukaryotes. It has been shown that the amino terminal 93 amino acids of the rat 60S ribosomal protein L5 are necessary and sufficient to bind 5S rRNA in vitro. Suggesting that the entire family has a function in rRNA binding. Length = 119 Score = 100 bits (252), Expect = 8e-23 Identities = 57/120 (47%), Positives = 76/120 (63%), Gaps = 3/120 (2%) Query: 3 TKKKVLARRISRIRRHLKSVSRGRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEPLR 62 K++ R+ R+RR LK + R RL V RS+KHIY QIIDD+ G TLVSAS+L++ L+ Sbjct: 1 GKRRRRRRKRLRVRRKLKGTA-ERPRLVVRRSNKHIYAQIIDDTKGGTLVSASTLSKELK 59 Query: 63 SS--LKTGANIVAATAVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGGVSF 120 G N AA VG LL +RA+K G+ V FDRG + Y GR+ ALA R+ G++F Sbjct: 60 KYGLKGGGNNTAAAYLVGLLLAKRALKKGIAVVVFDRGGYTYHGRVFALAKGAREAGLNF 119 >gnl|CDD|30605 COG0256, RplR, Ribosomal protein L18 [Translation, ribosomal structure and biogenesis]. Length = 125 Score = 100 bits (250), Expect = 1e-22 Identities = 57/122 (46%), Positives = 76/122 (62%), Gaps = 3/122 (2%) Query: 1 MATKKKVLARRISRIRRHLKSVSRGRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEP 60 + +++ +R RIR+ L S GR RL V RS++HIY QIIDD G TL SAS+L++ Sbjct: 5 VKFRRRRRGKRAYRIRKKLLGTS-GRPRLVVRRSNRHIYAQIIDDVKGGTLASASTLSKE 63 Query: 61 LRS--SLKTGANIVAATAVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGGV 118 LR G N AA VG L+ ERA+ G++ V FDRG + Y GR+AALAD R+ G+ Sbjct: 64 LRKYGKKGGGGNTEAAYLVGKLIAERALAKGIEEVVFDRGGYKYHGRVAALADGAREAGL 123 Query: 119 SF 120 F Sbjct: 124 EF 125 >gnl|CDD|88603 cd00432, Ribosomal_L18_L5e, Ribosomal L18/L5e: L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit. L18 binds 5S rRNA and induces a conformational change that stimulates the binding of L5 to 5S rRNA. Association of 5S rRNA with 23S rRNA depends on the binding of L18 and L5 to 5S rRNA. L18/L5e is generally described as L18 in prokaryotes and archaea, and as L5e (or L5) in eukaryotes. In bacteria, the CP proteins L5, L18, and L25 are required for the ribosome to incorporate 5S rRNA into the large subunit, one of the last steps in ribosome assembly. In archaea, both L18 and L5 bind 5S rRNA; in eukaryotes, only the L18 homolog (L5e) binds 5S rRNA but a homolog to L5 is also identified.. Length = 103 Score = 95.6 bits (238), Expect = 3e-21 Identities = 51/103 (49%), Positives = 69/103 (66%) Query: 16 RRHLKSVSRGRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEPLRSSLKTGANIVAAT 75 RR + ++ R RL V +S+KHIY QIIDDS TLVSAS+L ++ L +G N+ AA Sbjct: 1 RRRKRLGTQERPRLVVRKSNKHIYAQIIDDSGDKTLVSASTLELAIKGVLGSGNNVEAAY 60 Query: 76 AVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGGV 118 VG LL +RA++ G+K V FDRG + Y GR+ ALA R+GG+ Sbjct: 61 LVGRLLAKRALEKGIKKVVFDRGGYRYHGRVKALAKGAREGGL 103 >gnl|CDD|133279 cd01878, HflX, HflX subfamily. A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms. Length = 204 Score = 25.9 bits (58), Expect = 2.9 Identities = 7/22 (31%), Positives = 16/22 (72%) Query: 5 KKVLARRISRIRRHLKSVSRGR 26 ++++ RI+++RR L+ V + R Sbjct: 8 RRLIRERIAKLRRELEKVKKQR 29 >gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L. 10-formyltetrahydrofolate dehydrogenase (FTHFDH, EC=1.5.1.6), also known as aldehyde dehydrogenase family 1 member L1 (ALDH1L1) in humans, is a multi-domain homotetramer with an N-terminal formyl transferase domain and a C-terminal ALDH domain. FTHFDH catalyzes an NADP+-dependent dehydrogenase reaction resulting in the conversion of 10-formyltetrahydrofolate to tetrahydrofolate and CO2. The ALDH domain is also capable of the oxidation of short chain aldehydes to their corresponding acids. Length = 486 Score = 25.5 bits (56), Expect = 3.2 Identities = 9/26 (34%), Positives = 22/26 (84%), Gaps = 1/26 (3%) Query: 82 VERAVKVGVKSVYFDRGKH-LYCGRI 106 +++AV++G+ SV+F++G++ + GR+ Sbjct: 272 MDKAVRMGMSSVFFNKGENCIAAGRL 297 >gnl|CDD|113840 pfam05085, DUF685, Protein of unknown function (DUF685). This family consists of several uncharacterized proteins from Borrelia burgdorferi (Lyme disease spirochete). There is some evidence to suggest that the proteins may be outer surface proteins. Length = 265 Score = 25.2 bits (55), Expect = 4.5 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 36 KHIYGQIIDDSIGHTLVSASSLNEPLRSSLKTGANIVAAT 75 + IY +IID I + + S+L ++S L I +AT Sbjct: 81 EKIYTKIIDKLINNDSTNLSNLFSKIKSRLTDS--ISSAT 118 >gnl|CDD|37663 KOG2452, KOG2452, KOG2452, Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism]. Length = 881 Score = 25.0 bits (54), Expect = 5.4 Identities = 15/64 (23%), Positives = 36/64 (56%), Gaps = 8/64 (12%) Query: 47 IGHTLVSASSLNEPLRSSLKTGAN---IVAATAVGNLLVERAVKVGVKSVYFDRGKH-LY 102 +G ++ + +++ + SL+ G I+ A + +AV++G+ SV+F +G++ + Sbjct: 633 VGKHIMKSCAISNVKKVSLELGGESPFIIFADCD----LNKAVQMGMSSVFFSKGENCIA 688 Query: 103 CGRI 106 GR+ Sbjct: 689 AGRL 692 >gnl|CDD|38742 KOG3534, KOG3534, KOG3534, p53 inducible protein PIR121 [General function prediction only]. Length = 1253 Score = 25.0 bits (54), Expect = 5.9 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 6/50 (12%) Query: 25 GRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEPLRSSLKTGANIVAA 74 GR+ + + + D I TL EPLR ++K +++A+ Sbjct: 461 GRMESVFNNAIRKTVYAELQDFIQVTL------REPLRKAVKKKKDLLAS 504 >gnl|CDD|153090 cd08025, RNR_PFL_like_DUF711, Uncharacterized proteins with similarity to Ribonucleotide reductase and Pyruvate formate lyase. This subfamily contains Streptococcus pneumoniae Sp0239 and similar uncharacterized proteins. Sp0239 is structurally similar to ribonucleotide reductase (RNR) and pyruvate formate lyase (PFL), which are believed to have diverged from a common ancestor. RNR and PFL possess a ten-stranded alpha-beta barrel domain that hosts the active site, and are radical enzymes. RNRs are found in all organisms and provide the only mechanism by which nucleotides are converted to deoxynucleotides. PFL is an essential enzyme in anaerobic bacteria that catalyzes the conversion of pyruvate and CoA to acteylCoA and formate. Length = 400 Score = 24.6 bits (54), Expect = 7.5 Identities = 11/18 (61%), Positives = 12/18 (66%), Gaps = 3/18 (16%) Query: 104 GRIAALA---DAVRKGGV 118 G AALA DAV+KGG Sbjct: 296 GTTAALALLNDAVKKGGA 313 >gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain. Length = 324 Score = 24.3 bits (53), Expect = 8.9 Identities = 14/45 (31%), Positives = 17/45 (37%), Gaps = 8/45 (17%) Query: 73 AATAVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGG 117 AA +G+LLV+ A G V G A VR G Sbjct: 151 AAGGLGSLLVQLAKAAGATVVGAAGG--------PAKTALVRALG 187 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.134 0.371 Gapped Lambda K H 0.267 0.0617 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,270,015 Number of extensions: 55578 Number of successful extensions: 169 Number of sequences better than 10.0: 1 Number of HSP's gapped: 165 Number of HSP's successfully gapped: 21 Length of query: 120 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 38 Effective length of database: 4,491,799 Effective search space: 170688362 Effective search space used: 170688362 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.7 bits)