BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780245|ref|YP_003064658.1| 50S ribosomal protein L18 [Candidatus Liberibacter asiaticus str. psy62] (120 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780245|ref|YP_003064658.1| 50S ribosomal protein L18 [Candidatus Liberibacter asiaticus str. psy62] Length = 120 Score = 235 bits (599), Expect = 2e-64, Method: Compositional matrix adjust. Identities = 120/120 (100%), Positives = 120/120 (100%) Query: 1 MATKKKVLARRISRIRRHLKSVSRGRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEP 60 MATKKKVLARRISRIRRHLKSVSRGRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEP Sbjct: 1 MATKKKVLARRISRIRRHLKSVSRGRLRLSVCRSSKHIYGQIIDDSIGHTLVSASSLNEP 60 Query: 61 LRSSLKTGANIVAATAVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGGVSF 120 LRSSLKTGANIVAATAVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGGVSF Sbjct: 61 LRSSLKTGANIVAATAVGNLLVERAVKVGVKSVYFDRGKHLYCGRIAALADAVRKGGVSF 120 >gi|255764462|ref|YP_003064709.2| methionyl-tRNA formyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 Score = 25.4 bits (54), Expect = 0.34, Method: Compositional matrix adjust. Identities = 9/35 (25%), Positives = 22/35 (62%) Query: 8 LARRISRIRRHLKSVSRGRLRLSVCRSSKHIYGQI 42 L+ +I + + +S+G R++ CRS+++++ I Sbjct: 192 LSPQIENGITYAEKISKGETRVNFCRSAENVHNHI 226 >gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 598 Score = 24.3 bits (51), Expect = 0.69, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Query: 62 RSSLKTGANIVAATAVGNLLVERAVKVGVKSVYF 95 R+ L G N+ A VGN++ A +GVK V+ Sbjct: 566 RNQLTAGINV--APMVGNIIRRSASMLGVKPVFL 597 >gi|254780521|ref|YP_003064934.1| flagellar biosynthesis repressor FlbT [Candidatus Liberibacter asiaticus str. psy62] Length = 153 Score = 22.7 bits (47), Expect = 2.3, Method: Compositional matrix adjust. Identities = 11/21 (52%), Positives = 12/21 (57%) Query: 57 LNEPLRSSLKTGANIVAATAV 77 +N PLR SLK G I AV Sbjct: 1 MNSPLRISLKAGERIFLNGAV 21 >gi|254780975|ref|YP_003065388.1| D-ribulose-5 phosphate 3-epimerase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Score = 21.6 bits (44), Expect = 4.2, Method: Compositional matrix adjust. Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 82 VERAVKVGVKSVYFDRGKHLYCGRIAALADAVR 114 + K G K ++FD + I+ AD +R Sbjct: 23 ISNITKAGAKQIHFDVMDGCFVPNISFGADVIR 55 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.134 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,899 Number of Sequences: 1233 Number of extensions: 2062 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 120 length of database: 328,796 effective HSP length: 64 effective length of query: 56 effective length of database: 249,884 effective search space: 13993504 effective search space used: 13993504 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 33 (17.3 bits)