Query gi|254780246|ref|YP_003064659.1| 50S ribosomal protein L6 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 177 No_of_seqs 130 out of 2146 Neff 6.6 Searched_HMMs 39220 Date Tue May 24 05:55:41 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780246.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK05498 rplF 50S ribosomal pr 100.0 0 0 468.9 18.9 177 1-177 1-177 (178) 2 CHL00140 rpl6 ribosomal protei 100.0 0 0 463.6 18.7 176 1-176 1-176 (178) 3 TIGR03654 L6_bact ribosomal pr 100.0 0 0 454.0 17.8 175 2-176 1-175 (175) 4 COG0097 RplF Ribosomal protein 100.0 0 0 413.1 17.7 175 1-176 1-176 (178) 5 PRK05518 rpl6p 50S ribosomal p 100.0 0 0 405.6 19.7 173 1-175 2-179 (181) 6 TIGR03653 arch_L6P archaeal ri 100.0 0 0 356.1 17.5 163 6-172 1-170 (170) 7 KOG3254 consensus 100.0 0 0 330.7 11.2 176 2-177 32-210 (211) 8 PTZ00179 60S ribosomal protein 100.0 0 0 287.9 15.4 170 1-173 1-183 (189) 9 PTZ00027 60S ribosomal protein 100.0 5.6E-45 0 281.9 15.4 166 5-173 6-184 (190) 10 pfam00347 Ribosomal_L6 Ribosom 99.7 1.1E-17 2.8E-22 122.9 8.2 75 90-164 1-75 (76) 11 KOG3255 consensus 99.6 2.5E-17 6.3E-22 120.8 -0.9 163 1-172 1-176 (179) 12 pfam00347 Ribosomal_L6 Ribosom 99.2 1.4E-11 3.5E-16 87.4 6.0 72 11-82 1-76 (76) 13 PRK05439 pantothenate kinase; 73.1 2.3 6E-05 22.2 2.0 62 79-141 123-204 (312) 14 COG1072 CoaA Panthothenate kin 57.8 8.2 0.00021 19.0 2.4 37 106-143 166-202 (283) 15 cd06497 ACD_alphaA-crystallin_ 53.5 17 0.00042 17.2 3.3 17 12-28 23-39 (86) 16 cd06475 ACD_HspB1_like Alpha c 46.0 24 0.0006 16.3 3.2 17 41-57 26-42 (86) 17 cd06481 ACD_HspB9_like Alpha c 43.0 21 0.00052 16.7 2.4 17 12-28 20-36 (87) 18 cd06480 ACD_HspB8_like Alpha-c 42.2 27 0.00069 16.0 3.5 18 12-29 28-45 (91) 19 PRK00901 methylated-DNA--prote 38.6 21 0.00053 16.6 1.9 76 21-99 1-78 (155) 20 cd06478 ACD_HspB4-5-6 Alpha-cr 38.4 29 0.00074 15.8 2.6 17 12-28 20-36 (83) 21 cd06498 ACD_alphaB-crystallin_ 38.3 30 0.00077 15.7 2.7 17 12-28 20-36 (84) 22 cd06476 ACD_HspB2_like Alpha c 37.0 33 0.00084 15.5 2.7 17 41-57 23-39 (83) 23 cd06477 ACD_HspB3_Like Alpha c 36.5 34 0.00085 15.4 2.8 18 12-29 20-37 (83) 24 smart00466 SRA SET and RING fi 35.1 31 0.00079 15.6 2.3 25 148-172 107-132 (155) 25 cd06526 metazoan_ACD Alpha-cry 34.3 25 0.00065 16.1 1.8 18 40-57 22-39 (83) 26 PRK13657 cyclic beta-1,2-gluca 33.6 38 0.00096 15.1 5.5 60 107-169 340-399 (585) 27 cd06470 ACD_IbpA-B_like Alpha- 32.7 28 0.00071 15.9 1.8 16 40-55 26-41 (90) 28 pfam10429 Mtr2 Nuclear pore RN 30.8 29 0.00073 15.8 1.6 31 59-89 117-157 (166) 29 pfam09288 UBA_3 Fungal ubiquit 28.6 18 0.00045 17.1 0.2 18 130-147 2-19 (55) 30 PRK13781 paaB phenylacetate-Co 23.5 30 0.00077 15.7 0.6 14 109-122 80-93 (95) 31 pfam11280 DUF3081 Protein of u 22.8 56 0.0014 14.1 1.9 35 78-112 18-57 (79) 32 PRK11176 lipid transporter ATP 22.7 59 0.0015 14.0 3.9 16 132-147 479-494 (581) 33 PTZ00319 NADH-cytochrome B5 re 22.0 61 0.0016 13.9 3.9 24 21-44 135-158 (303) 34 PRK10743 heat shock protein Ib 21.4 63 0.0016 13.8 2.0 18 40-57 60-77 (137) 35 cd03254 ABCC_Glucan_exporter_l 21.1 64 0.0016 13.8 5.8 22 11-32 18-40 (229) 36 TIGR00483 EF-1_alpha translati 21.1 24 0.0006 16.3 -0.3 43 67-109 94-145 (445) 37 PRK10790 putative multidrug tr 20.8 65 0.0016 13.8 4.1 61 107-170 346-406 (593) 38 TIGR01046 S10_Arc_S20_Euk ribo 20.8 65 0.0017 13.8 2.8 24 129-152 3-26 (99) 39 pfam00488 MutS_V MutS domain V 20.7 65 0.0017 13.7 3.4 22 11-32 31-53 (234) 40 PRK11597 heat shock chaperone 20.3 66 0.0017 13.7 2.2 61 39-108 57-120 (142) 41 cd03284 ABC_MutS1 MutS1 homolo 20.3 55 0.0014 14.2 1.4 28 5-32 5-41 (216) 42 TIGR01978 sufC FeS assembly AT 20.2 43 0.0011 14.8 0.9 132 10-156 14-198 (248) No 1 >PRK05498 rplF 50S ribosomal protein L6; Validated Probab=100.00 E-value=0 Score=468.94 Aligned_cols=177 Identities=58% Similarity=0.929 Sum_probs=175.7 Q ss_pred CCCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEECCCEEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEECC Q ss_conf 97444645107997589997998999906946999826863999707589985055432201338887521125897511 Q gi|254780246|r 1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVT 80 (177) Q Consensus 1 MSrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~~~v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GVt 80 (177) ||||||+||.||++|+|+++++.|+|+||+|+|++.+++++.++++++.+.+.+++++++.+|+|||+||||+|||+||+ T Consensus 1 MSrigk~pI~IP~gV~v~i~~~~v~vkGp~G~l~~~~~~~i~i~~~~~~I~v~~~~~~k~~kal~GT~rslI~NmI~GVs 80 (178) T PRK05498 1 MSRIGKKPIAIPAGVEVTINGNVVTVKGPKGELSRTLNPDVTVKVEDNELTVTRPDDSKEARALHGTTRALINNMVVGVT 80 (178) T ss_pred CCCCCCCCEECCCCCEEEEECCEEEEECCCEEEEEECCCCEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHC T ss_conf 98355686416999899997999999989957989869984999969989997668778899999999999878774323 Q ss_pred EEEEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCC Q ss_conf 00377787404763012204249999515676552588503899769988999957998987999874100747985787 Q gi|254780246|r 81 KGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGK 160 (177) Q Consensus 81 ~Gf~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGK 160 (177) +||+|+|+++|+||||+++|+.|.|+|||||||.++||+||+++|++||+|+|+|+|||.||||||+||++|+||||||| T Consensus 81 ~Gf~k~LelvGvGYra~~~g~~L~l~LGfSH~i~~~IP~~v~v~~~~~t~I~i~G~DKq~vgq~AA~Ir~~r~pepYKGK 160 (178) T PRK05498 81 EGFEKKLEIVGVGYRAQLQGKKLNLSLGYSHPVEYEIPEGITVEVPKPTEIVVKGIDKQLVGQVAAEIRSYRPPEPYKGK 160 (178) T ss_pred CCEEEEEEEEEEEEEEEECCCEEEEEECCCCCEECCCCCCEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCC T ss_conf 01589999996203888638789997346775601189983999489999999978999998999998636999896997 Q ss_pred CEEECCEEEEEEECCCC Q ss_conf 43453709997105669 Q gi|254780246|r 161 GIRYSGEVIIRKEGKKK 177 (177) Q Consensus 161 gI~~~~e~I~~KegKkK 177 (177) ||||+||+|.||||||| T Consensus 161 GI~~~~e~i~~K~gKkk 177 (178) T PRK05498 161 GIRYAGEVVRRKEGKKK 177 (178) T ss_pred CEEECCEEEEECCCCCC T ss_conf 77188869996175579 No 2 >CHL00140 rpl6 ribosomal protein L6; Validated Probab=100.00 E-value=0 Score=463.56 Aligned_cols=176 Identities=51% Similarity=0.842 Sum_probs=174.6 Q ss_pred CCCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEECCCEEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEECC Q ss_conf 97444645107997589997998999906946999826863999707589985055432201338887521125897511 Q gi|254780246|r 1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVT 80 (177) Q Consensus 1 MSrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~~~v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GVt 80 (177) ||||||+||.||++|+|+++++.++|+||+|+|++.+++.+.++++++++.+.+++++++.+|||||+||||+|||.||| T Consensus 1 MSrIgk~pI~IP~gV~V~i~~~~v~VkGpkG~L~~~~~~~v~v~~~~~~i~v~~~~~~k~~ka~~GT~RslI~NmI~GVt 80 (178) T CHL00140 1 MSRIGKLPIKIPENVNITIKDQVITVKGPKGTLSRTLPEGIKIEQQNNTLFVKPVEDTKKARKLHGLYRTLINNMVIGVS 80 (178) T ss_pred CCCCCCCCCCCCCCCEEEEECCEEEEECCCEEEEEECCCCEEEEEECCEEEEECCCCHHHHHHHHHHHHHHHHHHHEECC T ss_conf 97245676027999789997999999869968999868973999849989860466417899999999999854312220 Q ss_pred EEEEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCC Q ss_conf 00377787404763012204249999515676552588503899769988999957998987999874100747985787 Q gi|254780246|r 81 KGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGK 160 (177) Q Consensus 81 ~Gf~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGK 160 (177) +||+|+|+++|+||||+++|+.|.|+||||||+.++||+||+++++++|+|+|+|+|||.||||||+||++||||||||| T Consensus 81 ~Gf~k~LeivGvGyra~~~g~~L~l~LG~SH~i~~~iP~gI~v~~~~~t~I~i~G~DKq~Vgq~AA~Ir~~r~PEPYKGK 160 (178) T CHL00140 81 EGFEKKLELQGVGYRAQLQGKDLILNVGYSHPVKIKPPEGISVEVENNTTIIIKGIDKELVGQFAANIRSIRPPEPYKGK 160 (178) T ss_pred CCEEEEEEEEEEEEEEEECCCEEEECCCCCCCCCCCCCCCEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCC T ss_conf 57289999996128987069779993568787842298987999589999999968899999999997413899895898 Q ss_pred CEEECCEEEEEEECCC Q ss_conf 4345370999710566 Q gi|254780246|r 161 GIRYSGEVIIRKEGKK 176 (177) Q Consensus 161 gI~~~~e~I~~KegKk 176 (177) ||||+||+|+|||||. T Consensus 161 GI~y~~E~i~rK~gK~ 176 (178) T CHL00140 161 GIRYKGETIRRKAGKA 176 (178) T ss_pred CCCCCCEEEEECCCCC T ss_conf 9668784999547667 No 3 >TIGR03654 L6_bact ribosomal protein L6, bacterial type. Probab=100.00 E-value=0 Score=453.98 Aligned_cols=175 Identities=57% Similarity=0.947 Sum_probs=173.8 Q ss_pred CCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEECCCEEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEECCE Q ss_conf 74446451079975899979989999069469998268639997075899850554322013388875211258975110 Q gi|254780246|r 2 SRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTK 81 (177) Q Consensus 2 SrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~~~v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GVt~ 81 (177) |||||+||.||++|+|+++++.++|+||+|+|++.+++.++++++++.+.+++++++++.+|||||+||||+|||+||++ T Consensus 1 SriGk~pI~IP~gV~v~i~~~~v~vkGp~G~l~~~~~~~i~i~~~~~~i~v~~~~~~k~~ka~~GT~rslI~Nmi~GVt~ 80 (175) T TIGR03654 1 SRIGKKPIAIPAGVEVTIDGNVVTVKGPKGELSRTLHPGVTVKVEDGQLTVSRPNDSKEARALHGTTRALINNMVIGVSE 80 (175) T ss_pred CCCCCCCCCCCCCCEEEEECCEEEEECCCEEEEEECCCCEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 97666772079997899979999999799279898599749999399999998898889999999999999888734121 Q ss_pred EEEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCC Q ss_conf 03777874047630122042499995156765525885038997699889999579989879998741007479857874 Q gi|254780246|r 82 GYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKG 161 (177) Q Consensus 82 Gf~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGKg 161 (177) ||+|+|+++|+||||+++|+.|+|+|||||+|.++||+||+++++++|+|+|+|+|||.||||||+||++|+|||||||| T Consensus 81 Gf~k~LelvGvGYra~~~g~~L~l~LGfSH~i~~~IP~gv~v~v~k~t~I~i~G~DKq~Vgq~AA~Ir~~r~pepYKGKG 160 (175) T TIGR03654 81 GFEKKLEIVGVGYRAQLQGKKLNLSLGYSHPVEYEIPEGITVEVPKPTEIVVKGIDKQLVGQVAAEIRAFRKPEPYKGKG 160 (175) T ss_pred CEEEEEEEEEEEEEEEECCCEEEEECCCCCCEEEECCCCEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCC T ss_conf 35999999972059874385877751677757016999969995899999999789999989999986158998958989 Q ss_pred EEECCEEEEEEECCC Q ss_conf 345370999710566 Q gi|254780246|r 162 IRYSGEVIIRKEGKK 176 (177) Q Consensus 162 I~~~~e~I~~KegKk 176 (177) |||+||+|.|||||| T Consensus 161 I~~~~e~I~~K~gKK 175 (175) T TIGR03654 161 IRYAGEVVRRKEGKK 175 (175) T ss_pred CCCCCEEEEECCCCC T ss_conf 759785999427589 No 4 >COG0097 RplF Ribosomal protein L6P/L9E [Translation, ribosomal structure and biogenesis] Probab=100.00 E-value=0 Score=413.08 Aligned_cols=175 Identities=53% Similarity=0.872 Sum_probs=169.0 Q ss_pred CCCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEECCCE-EEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEEC Q ss_conf 97444645107997589997998999906946999826863-99970758998505543220133888752112589751 Q gi|254780246|r 1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGI-SVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGV 79 (177) Q Consensus 1 MSrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~~~v-~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GV 79 (177) |||||+.||.+|+||+++++++.++++||+|+|++.|++.+ .++.+++.+.+.+.+. ++.+|+|||+||||+|||+|| T Consensus 1 Msri~k~~i~~P~gV~V~i~~~~v~vkGpkGeL~~~~~~~~v~v~~~~~~~vv~~~~~-k~~~a~~Gt~rali~Nmv~GV 79 (178) T COG0097 1 MSRIGKRPIVIPAGVTVSIEGQVVTVKGPKGELTREFHDNVVKVEVEDNILVVRPVDG-KRKRALHGTVRALINNMVKGV 79 (178) T ss_pred CCCEEECCEECCCCEEEEEECCEEEEECCCEEEEEECCCCCEEEEECCCEEEEEECCC-CHHHHHHHHHHHHHHHHHHHC T ss_conf 9720112373599709998454999987880899990686059994299799964666-045788999999998776010 Q ss_pred CEEEEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCC Q ss_conf 10037778740476301220424999951567655258850389976998899995799898799987410074798578 Q gi|254780246|r 80 TKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKG 159 (177) Q Consensus 80 t~Gf~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKG 159 (177) |+||+|+|+++|+||||++.|+.|.|+||||||+.+.||+|+++++++||+|+|+|+|||+||||||+||++|+|||||| T Consensus 80 teGf~~kL~ivgvgyra~v~g~~l~l~LG~shp~~~~ip~gi~v~v~~~t~I~v~GidKe~VGQ~AA~Ir~~r~pepykg 159 (178) T COG0097 80 TEGFEKKLEIVGVGYRAQVVGGNLELFLGYSHPVVIEIPEGITVEVPGPTEIVVEGIDKELVGQVAANIRAARKPEPYKG 159 (178) T ss_pred CCCEEEEEEEEEECCEEEEECCEEEEEECCCCCEEEECCCCEEEEECCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCC T ss_conf 41529999999824135873466899122558768789998599926998899984889997688998873269989788 Q ss_pred CCEEECCEEEEEEECCC Q ss_conf 74345370999710566 Q gi|254780246|r 160 KGIRYSGEVIIRKEGKK 176 (177) Q Consensus 160 KgI~~~~e~I~~KegKk 176 (177) ||||||||||++||||. T Consensus 160 Kgi~ydge~I~~K~gK~ 176 (178) T COG0097 160 KGIRYDGEYIRRKEGKT 176 (178) T ss_pred CCEEECCEEEEEECCCC T ss_conf 61678688999835524 No 5 >PRK05518 rpl6p 50S ribosomal protein L6P; Reviewed Probab=100.00 E-value=0 Score=405.63 Aligned_cols=173 Identities=31% Similarity=0.476 Sum_probs=168.3 Q ss_pred CCCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEEC-CCEEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEEC Q ss_conf 97444645107997589997998999906946999826-86399970758998505543220133888752112589751 Q gi|254780246|r 1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMS-DGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGV 79 (177) Q Consensus 1 MSrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~-~~v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GV 79 (177) |||++|+||.||++|+|+++++.++|+||+|+|++.|+ +.+.++++++.+.+.+++++++.+|+|||+||||+|||.|| T Consensus 2 msr~~Kk~I~IP~gV~V~i~~~~i~VkGpkG~L~~~~~~~~v~i~~~~~~i~v~~~~~~kk~~a~~Gt~RslI~NMI~GV 81 (181) T PRK05518 2 VAAEIREEIEIPEGVTVEIEGNEVTVKGPKGEVERDFWYPGIKISVEDGKVVIETSFPRKKQKAIVGTFRSHIKNMIKGV 81 (181) T ss_pred CCHHCCCCCCCCCCCEEEEECCEEEEECCCEEEEEEECCCCEEEEEECCEEEEEECCCCHHHHHHHHHHHHHHHHEEEEE T ss_conf 41423788248999799998999999968958999944885899990997999808998889999999999986317995 Q ss_pred CEEEEEEEEEECCCC--EEEECCCEEEEE--ECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCC Q ss_conf 100377787404763--012204249999--5156765525885038997699889999579989879998741007479 Q gi|254780246|r 80 TKGYERKLEISGVGC--RAFMDGRNLKMS--LGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAE 155 (177) Q Consensus 80 t~Gf~~~L~lvgvgy--~v~~~g~~l~l~--LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pe 155 (177) |+||+++|+++|+|| +|+++|+.|.|. ||||||+.+++|+|+++++ ++|+|+|+|+|||.|||+||+||++|+|+ T Consensus 82 s~Gf~k~LeivGvGy~~~a~~~G~~l~l~n~lG~sh~i~~~iP~gv~v~v-~~~~I~i~G~DKq~VGq~AA~Ir~~rk~k 160 (181) T PRK05518 82 TEGFEYKMKIVYAHFPMQVKVKGDEVVIENFLGEKAPRRAKILGGVKVKV-KGEEVTVSGIDKEDVGQTAANIEQATKIK 160 (181) T ss_pred CCCEEEEEEEEEECCCEEEEECCCEEEEEEEEECCCCEEEECCCCCEEEE-CCCEEEEEECCHHHHHHHHHHHHHCCCCC T ss_conf 68879999999876506899939889997620513257876989949997-29999999788999859998643216798 Q ss_pred CCCCCCEEECCEEEEEEECC Q ss_conf 85787434537099971056 Q gi|254780246|r 156 PYKGKGIRYSGEVIIRKEGK 175 (177) Q Consensus 156 pYKGKgI~~~~e~I~~KegK 175 (177) ||++| ||||||||++|||| T Consensus 161 ~~~~r-if~dG~yi~~K~gk 179 (181) T PRK05518 161 GFDPR-VFQDGIYIVEKAVK 179 (181) T ss_pred CCCCC-EEECCEEEEECCCC T ss_conf 99977-93747899971766 No 6 >TIGR03653 arch_L6P archaeal ribosomal protein L6P. Members of this protein family are the archaeal ribosomal protein L6P. The top-scoring proteins not selected by this model are eukaryotic cytosolic ribosomal protein L9. Bacterial ribosomal protein L6 scores lower and is described by a distinct model. Probab=100.00 E-value=0 Score=356.14 Aligned_cols=163 Identities=32% Similarity=0.522 Sum_probs=154.8 Q ss_pred CCCCCCCCCCEEEEECCEEEEEECCCEEEEEEC-CCEEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEECCEEEE Q ss_conf 645107997589997998999906946999826-8639997075899850554322013388875211258975110037 Q gi|254780246|r 6 KKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMS-DGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYE 84 (177) Q Consensus 6 k~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~-~~v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GVt~Gf~ 84 (177) |+||.||++|+|+++++.++|+||+|+|++.++ +.+.+.++++.+.+++++++++++|||||+||||+|||.|||+||+ T Consensus 1 KkpI~IP~gV~v~i~~~~v~VkGpkG~L~~~~~~~~v~v~~~~~~i~v~~~~~~k~~~al~Gt~RslI~NmI~GVs~Gf~ 80 (170) T TIGR03653 1 REEIEIPEGVSVTIEGNIVTVKGPKGEVTRELWYPGIEISVEDGKVVIETDFARKKDKAMVGTYRSHIKNMIKGVTEGFE 80 (170) T ss_pred CCCEECCCCCEEEEECCEEEEECCCEEEEEEECCCCEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHHHHEEECCCEE T ss_conf 98417899989999899999990992899995387246897398899972799988999999999998643174137769 Q ss_pred EEEEEECCCC--EEEECCCEEEEE--ECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCC Q ss_conf 7787404763--012204249999--515676552588503899769988999957998987999874100747985787 Q gi|254780246|r 85 RKLEISGVGC--RAFMDGRNLKMS--LGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGK 160 (177) Q Consensus 85 ~~L~lvgvgy--~v~~~g~~l~l~--LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGK 160 (177) ++|+++|+|| +|+++|+.|.|. ||||||+.+++|+|++++++ +|+|+|+|+|||.|||+||+||++|+ |||| T Consensus 81 k~LeivgvGy~~~~~~~G~~l~l~n~lG~Sh~v~~~iP~gi~v~v~-~~~I~i~G~DKq~VGq~AA~Ir~~~k---~k~k 156 (170) T TIGR03653 81 YKMKVVYSHFPMQVKVEGNKVVIENFLGEKAPRRAKIPGGVKVKVK-GEEVIVTGIDKEDVGQTAANIEQATR---IKGR 156 (170) T ss_pred EEEEEEEECCEEEEEECCCEEEEECCCCCCCCEEEECCCCCEEEEE-CCEEEEEECCHHHHHHHHHHHHHHCC---CCCC T ss_conf 9999997553189999398999951376640478739899599985-99999997789998699987466255---6899 Q ss_pred CEE--ECCEEEEEE Q ss_conf 434--537099971 Q gi|254780246|r 161 GIR--YSGEVIIRK 172 (177) Q Consensus 161 gI~--~~~e~I~~K 172 (177) |+| +||+||.+| T Consensus 157 d~R~f~dGiyv~~K 170 (170) T TIGR03653 157 DPRVFQDGIYIVEK 170 (170) T ss_pred CCCEEECCEEEECC T ss_conf 77684156899719 No 7 >KOG3254 consensus Probab=100.00 E-value=0 Score=330.65 Aligned_cols=176 Identities=36% Similarity=0.608 Sum_probs=162.6 Q ss_pred CCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEECCCEEEEEEC--CEE-EEEECCCCCCCHHHHHHHHHEEEEEEEE Q ss_conf 7444645107997589997998999906946999826863999707--589-9850554322013388875211258975 Q gi|254780246|r 2 SRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSDGISVTLQE--GML-SVATINGSKKARAAWGMSRTMINNLFHG 78 (177) Q Consensus 2 SrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~~~v~i~~~~--~~i-~i~~~~~~k~~ka~~GT~rsli~Nmi~G 78 (177) +.+++..|..++...-++++..++++||+|+|+..+++++.++.++ ..+ ...-..+++++++||||+|||++||+.| T Consensus 32 v~~~~k~i~~~e~k~~~lege~l~vkGP~gel~l~~P~~l~L~~dkk~~g~~~~~k~~etkkqr~mwgt~R~l~~N~v~G 111 (211) T KOG3254 32 VYVGKKEIIVKENKQRDLEGEQLQVKGPHGELNLRFPNYLNLSNDKKKSGMDANIKKQETKKQRAMWGTFRALLANNVKG 111 (211) T ss_pred EEECCEEEEEEHHHCCCCCCCCEEEECCCCEEECCCCCCCCCCCHHHHCCEEEEECCHHHHHHHHHHHHHHHHHHCCCHH T ss_conf 56153268865120455436732761886335046874112220345415023420023278888888899987523000 Q ss_pred CCEEEEEEEEEECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCC Q ss_conf 11003777874047630122042499995156765525885038997699889999579989879998741007479857 Q gi|254780246|r 79 VTKGYERKLEISGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYK 158 (177) Q Consensus 79 Vt~Gf~~~L~lvgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYK 158 (177) ||+||.+.|.+||+||||+++|..|.++|||||++...||++|.|++|.||.++++|+|||.|+||||.+|+|+|||||| T Consensus 112 Vt~g~~k~l~lVGvGYRa~legk~l~lklG~S~~v~l~iP~~v~Vk~p~ptsl~~~G~dKq~V~qFAAkvRsfkpPEPYK 191 (211) T KOG3254 112 VTMGFLKILKLVGVGYRASLEGKFLHLKLGYSHDVLLSIPTDVQVKNPTPTSLVLRGIDKQKVTQFAAKVRSFKPPEPYK 191 (211) T ss_pred HHHHHHHEEEEEEEEEEEEECCCEEEEEECCCCCEEECCCCCEEEECCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCCC T ss_conf 21545300157741267774483599984255413303898658855899889996556899999999874358999847 Q ss_pred CCCEEECCEEEEEEECCCC Q ss_conf 8743453709997105669 Q gi|254780246|r 159 GKGIRYSGEVIIRKEGKKK 177 (177) Q Consensus 159 GKgI~~~~e~I~~KegKkK 177 (177) ||||.|+||.+.+|+||.+ T Consensus 192 GKGIyv~dE~vklK~kK~~ 210 (211) T KOG3254 192 GKGIYVDDEKVKLKAKKSI 210 (211) T ss_pred CCCEEECCCEEEECCCCCC T ss_conf 8745862610031003347 No 8 >PTZ00179 60S ribosomal protein L9; Provisional Probab=100.00 E-value=0 Score=287.87 Aligned_cols=170 Identities=20% Similarity=0.288 Sum_probs=151.9 Q ss_pred CCCCCCCCCCCCCCCEEEEECCEEEEEECCCEEEEEEC-CCEEEEE--ECCEEEEEECCCCCCCHHHHHHHHHEEEEEEE Q ss_conf 97444645107997589997998999906946999826-8639997--07589985055432201338887521125897 Q gi|254780246|r 1 MSRIGKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMS-DGISVTL--QEGMLSVATINGSKKARAAWGMSRTMINNLFH 77 (177) Q Consensus 1 MSrIgk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~-~~v~i~~--~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~ 77 (177) |-....+.|+||+||+|+++++.|+|+||+|+|+++|. ..+++.+ +++.+.+..|.++++++|++||++|||+|||+ T Consensus 1 m~i~~~e~I~IPegV~vtv~~~~VtVkGp~G~L~r~f~h~~v~i~i~~~~~~i~v~~~~~~rk~~A~igT~~shI~NMik 80 (189) T PTZ00179 1 MKIKSQDTITIPEDVTVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKNRTFTAVRWFGSKIPNSTINTALSHVRNMIT 80 (189) T ss_pred CCCCCCCEEECCCCCEEEEECCEEEEECCCCEEEEEEECCCEEEEEECCCCEEEEEECCCCHHHEEEHHHHHHHHHHHHH T ss_conf 91235516889999899998999999989958998955695799995797489998737874140004619999998775 Q ss_pred ECCEEEEEEEEEE--CCCCEEEECCCEEEE--EECCCCCCCCCCCCEEEEEEC----CCCEEEEEECCHHHHHHHHHHHH Q ss_conf 5110037778740--476301220424999--951567655258850389976----99889999579989879998741 Q gi|254780246|r 78 GVTKGYERKLEIS--GVGCRAFMDGRNLKM--SLGFSHDVLYTPLEGISIFVS----KPTEIIVSGIDKQKVGHVAAEIR 149 (177) Q Consensus 78 GVt~Gf~~~L~lv--gvgy~v~~~g~~l~l--~LG~sh~i~~~ip~~v~v~~~----k~~~I~i~G~dke~Vgq~AA~Ir 149 (177) |||+||+|+|+++ |||+.++++|+.+++ +||+.+++.+.+++||++... ++++|+|+|+|+|+|||+||+|+ T Consensus 81 GVT~Gf~Ykmk~vyaHFPi~v~v~G~~v~I~NFlGEK~~R~~~i~~gv~v~~~~~~~~kdei~i~G~d~E~V~qtAA~Ie 160 (189) T PTZ00179 81 GVTKGFRFKVRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADTVKVYRTDPSKVKDELVLEGNDLEQVSREAAVMH 160 (189) T ss_pred HCCCCEEEEEEEEEEECCEEEEECCCEEEEEECCCCCCCEEEECCCCCEEEEECCCCCCCEEEEECCCHHHHHHHHHHHH T ss_conf 30187499999998756569998698999981246520258876899589850565558789998178899657798877 Q ss_pred CCCCCCCCCCCC--EEECCEEEEEEE Q ss_conf 007479857874--345370999710 Q gi|254780246|r 150 SYRSAEPYKGKG--IRYSGEVIIRKE 173 (177) Q Consensus 150 ~~r~pepYKGKg--I~~~~e~I~~Ke 173 (177) +.++. |+|| +|+||+||.+|. T Consensus 161 q~t~v---k~kD~R~F~DGIYv~eK~ 183 (189) T PTZ00179 161 QLCLV---KKKDIRKFLDGIYVQTKT 183 (189) T ss_pred HHHCC---CCCCCCEECCCEEEEECC T ss_conf 64126---799665802677999755 No 9 >PTZ00027 60S ribosomal protein L6; Provisional Probab=100.00 E-value=5.6e-45 Score=281.89 Aligned_cols=166 Identities=24% Similarity=0.339 Sum_probs=149.9 Q ss_pred CCCCCCCCCCCEEEEECCEEEEEECCCEEEEEEC-CCEEEEEE--CCEEEEEECCCCCCCHHHHHHHHHEEEEEEEECCE Q ss_conf 4645107997589997998999906946999826-86399970--75899850554322013388875211258975110 Q gi|254780246|r 5 GKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMS-DGISVTLQ--EGMLSVATINGSKKARAAWGMSRTMINNLFHGVTK 81 (177) Q Consensus 5 gk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~-~~v~i~~~--~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GVt~ 81 (177) ..+.|+||+||+|+++++.++|+||+|+|+++|. ..+++.+. ++.+.+..|+++++++|+.||++|||+|||+|||+ T Consensus 6 ~~~~I~IPegV~vti~~~~VtVkGp~G~l~r~f~h~~v~i~~~~~~~~i~v~~~~~~rk~~A~v~T~~shI~NMikGVt~ 85 (190) T PTZ00027 6 SSQKLKIPEGVTVSVKSRKVTVKGKYGTLTRSFRHLPIDLRLSKDKKYVKVVMWFGTPSKIAAIRTVCSHIKNMMTGVTK 85 (190) T ss_pred ECEEEECCCCCEEEEECCEEEEECCCCEEEEEEECCCEEEEEECCCCEEEEEEECCCCHHEEEHHHHHHHHHHHHHHCCC T ss_conf 12189789997999978899999189479999405847999947998999999569700224425299999878853237 Q ss_pred EEEEEEEEE--CCCCEEEE--CCCEEE--EEECCCCCCCCCCCCEEEEEECC--CCEEEEEECCHHHHHHHHHHHHCCCC Q ss_conf 037778740--47630122--042499--99515676552588503899769--98899995799898799987410074 Q gi|254780246|r 82 GYERKLEIS--GVGCRAFM--DGRNLK--MSLGFSHDVLYTPLEGISIFVSK--PTEIIVSGIDKQKVGHVAAEIRSYRS 153 (177) Q Consensus 82 Gf~~~L~lv--gvgy~v~~--~g~~l~--l~LG~sh~i~~~ip~~v~v~~~k--~~~I~i~G~dke~Vgq~AA~Ir~~r~ 153 (177) ||+|+|+++ |||+.+++ +|+.++ .+||+..|+.++|++||+++... +++|+|+|+|+|+|||+||+|++.++ T Consensus 86 Gf~Ykmk~vyaHFPi~v~v~~~g~~veI~NFLGEK~~R~~~i~~gv~v~~~~~~kdeiiv~G~d~E~V~qtAA~Ieqat~ 165 (190) T PTZ00027 86 KFQYKMRLVHAHFPINSNIVDNGKVIEIRNFLGEKRVRVVKVLPGVVVEKSESVKDELILTGVDVENVSRSAALIHQSAL 165 (190) T ss_pred CCEEEEEEEEEECCCEEEEECCCCEEEEECCCCCCCCEEEECCCCEEEEECCCCCCEEEEECCCHHHHHHHHHHHHHHHC T ss_conf 80999999999878789992599599998234773045998889919998777685899982889997787988776410 Q ss_pred CCCCCCCC--EEECCEEEEEEE Q ss_conf 79857874--345370999710 Q gi|254780246|r 154 AEPYKGKG--IRYSGEVIIRKE 173 (177) Q Consensus 154 pepYKGKg--I~~~~e~I~~Ke 173 (177) . |+|| +|+||+||..|. T Consensus 166 v---k~kD~RvF~DGIYv~eKg 184 (190) T PTZ00027 166 V---RNKDIRKFLDGIYVSEKG 184 (190) T ss_pred C---CCCCCCEEECCEEEEEEE T ss_conf 6---799752810566999743 No 10 >pfam00347 Ribosomal_L6 Ribosomal protein L6. Probab=99.73 E-value=1.1e-17 Score=122.89 Aligned_cols=75 Identities=45% Similarity=0.638 Sum_probs=72.6 Q ss_pred ECCCCEEEECCCEEEEEECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCEEE Q ss_conf 047630122042499995156765525885038997699889999579989879998741007479857874345 Q gi|254780246|r 90 SGVGCRAFMDGRNLKMSLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRY 164 (177) Q Consensus 90 vgvgy~v~~~g~~l~l~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGKgI~~ 164 (177) ++.||+|+++|+.+.+.+|+||.+.+++|+++++++++++.+.++|+|++.|+|+||.|+++|+|+||++||+.+ T Consensus 1 ip~Gv~v~i~g~~l~~v~G~kg~l~~~i~~~v~i~~~~~~~~~~~~~dk~~v~~~aa~i~~~r~~~~n~~kGV~~ 75 (76) T pfam00347 1 IPVGVRVSIDGVNLVLVLGPKGELTREIPPGVTVKVEKITVIIVSGIDKEKVGQFAALIGTYRAPIPNMGKGVSY 75 (76) T ss_pred CCCCEEEEEECCEEEEEECCCCCEEEECCCCEEEEECCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCEEC T ss_conf 997689999699899938688368887899889997899789983698899899999987617998736548788 No 11 >KOG3255 consensus Probab=99.62 E-value=2.5e-17 Score=120.84 Aligned_cols=163 Identities=23% Similarity=0.320 Sum_probs=130.2 Q ss_pred CCCC-CCCCCCCCCCCEEEEECCEEEEEECCCEEEEEECC-CEEEEEECC---EEEEEECCCCCCCHHHHHHHHHEEEEE Q ss_conf 9744-46451079975899979989999069469998268-639997075---899850554322013388875211258 Q gi|254780246|r 1 MSRI-GKKAIQVPLGVDVAVEDHEIKVKGPKGQLSFMMSD-GISVTLQEG---MLSVATINGSKKARAAWGMSRTMINNL 75 (177) Q Consensus 1 MSrI-gk~~I~IP~~V~v~i~~~~i~vkGp~G~l~~~~~~-~v~i~~~~~---~i~i~~~~~~k~~ka~~GT~rsli~Nm 75 (177) |+.| -.+.+.||++|++++++..++++||.|++..++++ .+++....+ .+.+..|...++..|..-|..||++|| T Consensus 1 mk~Ilsn~tv~iPe~v~it~k~~v~~v~gprgtl~~d~~hi~~~~~~~~~~~~~ik~~~~~~~Rk~va~l~t~~s~ien~ 80 (179) T KOG3255 1 MKTILSNQTVHIPENVDITLKGHVVIVKGPRGTLWRDFNHINVELSLLGKKKKRLKIDKWWGTRKGVACLRTVVSHIENC 80 (179) T ss_pred CCEEEECEEEECCCCCEEEEEEEEEEEECCCCCEECCCCCCCHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH T ss_conf 95687143786478841788767999718875421355665422312105055443666403213089999999999999 Q ss_pred EEECCEEEEEEEEEECCCCEE--EECCC----EEEEEECCCCCCCCCCCCEEEEEE--CCCCEEEEEECCHHHHHHHHHH Q ss_conf 975110037778740476301--22042----499995156765525885038997--6998899995799898799987 Q gi|254780246|r 76 FHGVTKGYERKLEISGVGCRA--FMDGR----NLKMSLGFSHDVLYTPLEGISIFV--SKPTEIIVSGIDKQKVGHVAAE 147 (177) Q Consensus 76 i~GVt~Gf~~~L~lvgvgy~v--~~~g~----~l~l~LG~sh~i~~~ip~~v~v~~--~k~~~I~i~G~dke~Vgq~AA~ 147 (177) +.||+.||.|+|..+.-.|.+ ++..+ .+-.+||++-+......+|+.... .-++++.+.|.|.+.|+|.||. T Consensus 81 i~gvt~~~i~k~~av~a~f~in~~~~~~~~s~~i~n~l~~k~~~~~~~~~Gv~~~~~~~~~~~i~~~~~~~~~vs~~~a~ 160 (179) T KOG3255 81 IKGVTIGFIYKMRAVYAHFPINTVIQENGKSEEIRNFLGEKLVRRVEMRPGVTIVRSSKVKDEIVLEGNDLELVSQSAAL 160 (179) T ss_pred HHCCHHHHHHHHHHHHHHCCCCCEECCCCCCHHHHHHHHHHCCCEEECCCCEEEEEEHHCCHHHEECCCCHHHHHHHHHH T ss_conf 85302999997666874315463416998602333343331220575179758752010564432056535321147675 Q ss_pred HHCCCCCCCCCCCCEEECCEEEEEE Q ss_conf 4100747985787434537099971 Q gi|254780246|r 148 IRSYRSAEPYKGKGIRYSGEVIIRK 172 (177) Q Consensus 148 Ir~~r~pepYKGKgI~~~~e~I~~K 172 (177) ++.|.. +.+ +| |+.+| T Consensus 161 -~~~~~~---~~~---ld--yv~~k 176 (179) T KOG3255 161 -QQICTV---KNK---LD--YVSEK 176 (179) T ss_pred -HCCCEE---HHH---CC--HHHHC T ss_conf -164130---232---04--12210 No 12 >pfam00347 Ribosomal_L6 Ribosomal protein L6. Probab=99.24 E-value=1.4e-11 Score=87.44 Aligned_cols=72 Identities=28% Similarity=0.457 Sum_probs=60.1 Q ss_pred CCCCCEEEEEC-CEEEEEECCCEEEEEECCCEEEEEECCEEEEEECCCC---CCCHHHHHHHHHEEEEEEEECCEE Q ss_conf 79975899979-9899990694699982686399970758998505543---220133888752112589751100 Q gi|254780246|r 11 VPLGVDVAVED-HEIKVKGPKGQLSFMMSDGISVTLQEGMLSVATINGS---KKARAAWGMSRTMINNLFHGVTKG 82 (177) Q Consensus 11 IP~~V~v~i~~-~~i~vkGp~G~l~~~~~~~v~i~~~~~~i~i~~~~~~---k~~ka~~GT~rsli~Nmi~GVt~G 82 (177) ||.||++++++ +.++++||+|++++.+++.+.+..++..+.+....+. ....|+|||+|+++.||++||++| T Consensus 1 ip~Gv~v~i~g~~l~~v~G~kg~l~~~i~~~v~i~~~~~~~~~~~~~dk~~v~~~aa~i~~~r~~~~n~~kGV~~g 76 (76) T pfam00347 1 IPVGVRVSIDGVNLVLVLGPKGELTREIPPGVTVKVEKITVIIVSGIDKEKVGQFAALIGTYRAPIPNMGKGVSYG 76 (76) T ss_pred CCCCEEEEEECCEEEEEECCCCCEEEECCCCEEEEECCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCEECC T ss_conf 9976899996998999386883688878998899978997899836988998999999876179987365487887 No 13 >PRK05439 pantothenate kinase; Provisional Probab=73.07 E-value=2.3 Score=22.15 Aligned_cols=62 Identities=26% Similarity=0.331 Sum_probs=36.8 Q ss_pred CCEEEEEEEEE---EC----CCCEEEECCCEEE-----EE--------ECCCCCCCCCCCCEEEEEECCCCEEEEEECCH Q ss_conf 11003777874---04----7630122042499-----99--------51567655258850389976998899995799 Q gi|254780246|r 79 VTKGYERKLEI---SG----VGCRAFMDGRNLK-----MS--------LGFSHDVLYTPLEGISIFVSKPTEIIVSGIDK 138 (177) Q Consensus 79 Vt~Gf~~~L~l---vg----vgy~v~~~g~~l~-----l~--------LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dk 138 (177) .|.||.|.-.. .| -||+-+.+-..|. ++ ==|||.+ +.|.+|-...+..|+.++++|+|- T Consensus 123 TTDGFLypNa~L~~rglm~RKGFPESYD~~~Ll~Fl~~vKsG~~~v~aPvYSH~~-YDIvp~~~~~v~~PDILIvEGlNv 201 (312) T PRK05439 123 TTDGFLYPNAELKERGLMKRKGFPESYDMRALLRFLSDVKSGKPNVKAPVYSHLI-YDIVPGEYQTVDQPDILIVEGLNV 201 (312) T ss_pred ECCCCCCCCHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEECHHH-HHCCCCCEEEECCCCEEEEECHHH T ss_conf 3466557868998767712478985447999999999997699876640333677-642799706973799899915121 Q ss_pred HHH Q ss_conf 898 Q gi|254780246|r 139 QKV 141 (177) Q Consensus 139 e~V 141 (177) -.. T Consensus 202 LQ~ 204 (312) T PRK05439 202 LQT 204 (312) T ss_pred CCC T ss_conf 447 No 14 >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Probab=57.83 E-value=8.2 Score=18.96 Aligned_cols=37 Identities=22% Similarity=0.339 Sum_probs=28.6 Q ss_pred EECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHH Q ss_conf 95156765525885038997699889999579989879 Q gi|254780246|r 106 SLGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGH 143 (177) Q Consensus 106 ~LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq 143 (177) -=.|||.++-.+|.+-.+ ++.++.++++|++.-.-++ T Consensus 166 aPvysh~~yD~vp~~~~v-~~~pdIlI~EG~nvLq~~~ 202 (283) T COG1072 166 APVYSHLIYDPVPDAFQV-VPQPDILIVEGNNVLQDGE 202 (283) T ss_pred CCCCCCCCCCCCCCCEEE-CCCCCEEEEECHHHHCCCC T ss_conf 432331102567885020-5899889991526625898 No 15 >cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1. Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 does not belong to this group. Mutations inHspB4 have been associated with Autosomal Dominant Congenital Cataract (ADCC). The chaperone-like functions of HspB4 are considered important for maintaining lens transparency and preventing cataract. Probab=53.49 E-value=17 Score=17.19 Aligned_cols=17 Identities=29% Similarity=0.536 Sum_probs=6.2 Q ss_pred CCCCEEEEECCEEEEEE Q ss_conf 99758999799899990 Q gi|254780246|r 12 PLGVDVAVEDHEIKVKG 28 (177) Q Consensus 12 P~~V~v~i~~~~i~vkG 28 (177) |+.++|.+.++.|.|.| T Consensus 23 PEEi~Vkv~~~~l~V~g 39 (86) T cd06497 23 PEDLTVKVLDDYVEIHG 39 (86) T ss_pred CCCEEEEEECCEEEEEE T ss_conf 20059999899999997 No 16 >cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Hsp27 shows enhanced synthesis in response to stress. It is a molecular chaperone which interacts with a large number of different proteins. It is found in many types of human cells including breast, uterus, cervix, platelets and cancer cells. Hsp27 has diverse cellular functions including, chaperoning, regulation of actin polymerization, keratinocyte differentiation, regulation of inflammatory pathways in keratinocytes, and protection from oxidative stress through modulating glutathione levels. It is also a subunit of AUF1-containing protein complexes. It has been linked to several transduction pathways regulating cellular functions including differentiat Probab=45.99 E-value=24 Score=16.30 Aligned_cols=17 Identities=12% Similarity=0.380 Sum_probs=7.1 Q ss_pred EEEEEECCEEEEEECCC Q ss_conf 39997075899850554 Q gi|254780246|r 41 ISVTLQEGMLSVATING 57 (177) Q Consensus 41 v~i~~~~~~i~i~~~~~ 57 (177) +.+...++.+.+...++ T Consensus 26 i~Vk~~d~~l~V~gkhe 42 (86) T cd06475 26 LVVKTKDGVVEITGKHE 42 (86) T ss_pred CEEEECCCEEEEEEEEE T ss_conf 19999099999998770 No 17 >cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Human (h) HspB9 is expressed exclusively in the normal testis and in various tumor samples and is a cancer/testis antigen. hHspB9 interacts with TCTEL1 (T-complex testis expressed protein -1), a subunit of dynein. hHspB9 and TCTEL1 are co-expressed in similar cells within the testis and in tumor cells. Included in this group is Xenopus Hsp30, a developmentally-regulated heat-inducible molecular chaperone. Probab=43.00 E-value=21 Score=16.66 Aligned_cols=17 Identities=29% Similarity=0.573 Sum_probs=6.7 Q ss_pred CCCCEEEEECCEEEEEE Q ss_conf 99758999799899990 Q gi|254780246|r 12 PLGVDVAVEDHEIKVKG 28 (177) Q Consensus 12 P~~V~v~i~~~~i~vkG 28 (177) |++++|++.++.|+|.| T Consensus 20 Peei~Vkv~g~~l~V~g 36 (87) T cd06481 20 PEDLSVRVDGRKLVVTG 36 (87) T ss_pred HHHEEEEEECCEEEEEE T ss_conf 05659999799999998 No 18 >cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21.6 KDa small heat shock protein (sHsp) HspB8, also denoted as Hsp22 in humans, and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. A chaperone complex formed of HspB8 and Bag3 stimulates degradation of protein complexes by macroautophagy. HspB8 also forms complexes with Hsp27 (HspB1), MKBP (HspB2), HspB3, alphaB-crystallin (HspB5), Hsp20 (HspB6), and cvHsp (HspB7). These latter interactions may depend on phosphorylation of the respective partner sHsp. HspB8 may participate in the regulation of cell proliferation, cardiac hypertrophy, apoptosis, and carcinogenesis. Point mutations in HspB8 have been correlated with the development of several congenital neurological diseases, including Charcot Marie tooth disease and distal motor neuropathy type II. Probab=42.22 E-value=27 Score=15.95 Aligned_cols=18 Identities=28% Similarity=0.431 Sum_probs=8.1 Q ss_pred CCCCEEEEECCEEEEEEC Q ss_conf 997589997998999906 Q gi|254780246|r 12 PLGVDVAVEDHEIKVKGP 29 (177) Q Consensus 12 P~~V~v~i~~~~i~vkGp 29 (177) |+.++|.+.++.|.|.|. T Consensus 28 PEEi~Vk~~d~~l~V~gk 45 (91) T cd06480 28 PEELTVKTKDGFVEVSGK 45 (91) T ss_pred CCEEEEEEECCEEEEEEE T ss_conf 630699997999999988 No 19 >PRK00901 methylated-DNA--protein-cysteine methyltransferase; Provisional Probab=38.56 E-value=21 Score=16.64 Aligned_cols=76 Identities=11% Similarity=0.152 Sum_probs=51.1 Q ss_pred CCEEEEEECCCEEEEEECCC--EEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEECCEEEEEEEEEECCCCEEEE Q ss_conf 99899990694699982686--3999707589985055432201338887521125897511003777874047630122 Q gi|254780246|r 21 DHEIKVKGPKGQLSFMMSDG--ISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGVTKGYERKLEISGVGCRAFM 98 (177) Q Consensus 21 ~~~i~vkGp~G~l~~~~~~~--v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GVt~Gf~~~L~lvgvgy~v~~ 98 (177) +|.+..+.|+|.+...-... +.+...++.-.-.. ......++......+...+.|-..-|...|.+.|..|...+ T Consensus 1 ~n~~~f~SPlG~i~i~~~~~gl~~l~F~~~~~~~~~---~~~~~~~l~~a~~qL~~YF~g~~~~f~lpl~~~GT~FQ~~V 77 (155) T PRK00901 1 NNIYCYETPIGKIVIAENGTAITHLCFGEDIPKIDV---PILETDLLKEANKQLEEYFRGKRKKFDLPLAPQGTEFQKKV 77 (155) T ss_pred CCEEEEECCCCEEEEEECCCEEEEEEECCCCCCCCC---CCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHH T ss_conf 986998888314899992996899880899741114---54368999999999999985998655521268999999999 Q ss_pred C Q ss_conf 0 Q gi|254780246|r 99 D 99 (177) Q Consensus 99 ~ 99 (177) = T Consensus 78 W 78 (155) T PRK00901 78 W 78 (155) T ss_pred H T ss_conf 9 No 20 >cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1. Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 on the other hand is also expressed constitutively in other tissues including brain, heart, and type I and type IIa skeletal muscle fibers, and in several cancers including gliomas, renal cell carcinomas, basal-like and metaplastic breast carcinomas, and head and neck cancer. HspB5's functions include effects on the apoptotic pathway and on metastasis. Phosphorylation of HspB5 reduces its ol Probab=38.43 E-value=29 Score=15.79 Aligned_cols=17 Identities=24% Similarity=0.415 Sum_probs=6.9 Q ss_pred CCCCEEEEECCEEEEEE Q ss_conf 99758999799899990 Q gi|254780246|r 12 PLGVDVAVEDHEIKVKG 28 (177) Q Consensus 12 P~~V~v~i~~~~i~vkG 28 (177) |++++|++.++.|.|.| T Consensus 20 Peei~Vkv~~~~l~V~g 36 (83) T cd06478 20 PEELSVKVLGDFVEIHG 36 (83) T ss_pred CHHEEEEEECCEEEEEE T ss_conf 23369999899999999 No 21 >cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1. HspB4 does not belong to this group. HspB5 shows increased synthesis in response to stress. HspB5 is also expressed constitutively in other tissues including brain, heart, and type I and type IIa skeletal muscle fibers, and in several cancers including gliomas, renal cell carcinomas, basal-like and metaplastic breast carcinomas, and head and neck cancer. Its functions include effects on the apoptotic pathway and on metastasis. Phosphorylation of HspB5 reduces its oligomerization and anti-apoptotic activ Probab=38.31 E-value=30 Score=15.69 Aligned_cols=17 Identities=29% Similarity=0.432 Sum_probs=6.4 Q ss_pred CCCCEEEEECCEEEEEE Q ss_conf 99758999799899990 Q gi|254780246|r 12 PLGVDVAVEDHEIKVKG 28 (177) Q Consensus 12 P~~V~v~i~~~~i~vkG 28 (177) |+.++|.+.++.|.|.| T Consensus 20 Peei~Vkv~~~~l~V~g 36 (84) T cd06498 20 PEELKVKVLGDFIEIHG 36 (84) T ss_pred CHHEEEEEECCEEEEEE T ss_conf 20229999799999998 No 22 >cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB2 is preferentially and constitutively expressed in skeletal muscle and heart. HspB2 shows homooligomeric activity and forms aggregates in muscle cytosol. Although its expression is not induced by heat shock, it redistributes to the insoluble fraction in response to heat shock. In the mouse heart, HspB2 plays a role in maintaining energetic balance, by protecting cardiac energetics during ischemia/reperfusion, and allowing for increased work during acute inotropic challenge. hHspB2 [previously also known as myotonic dystrophy protein kinase (DMPK) binding protein (MKBP)] is selectively up-regulated in skeletal muscles from myotonic dystrophy patients. Probab=37.03 E-value=33 Score=15.48 Aligned_cols=17 Identities=24% Similarity=0.360 Sum_probs=6.4 Q ss_pred EEEEEECCEEEEEECCC Q ss_conf 39997075899850554 Q gi|254780246|r 41 ISVTLQEGMLSVATING 57 (177) Q Consensus 41 v~i~~~~~~i~i~~~~~ 57 (177) +.+...++.+.+...++ T Consensus 23 i~Vk~~d~~l~V~gkHe 39 (83) T cd06476 23 ITVRTVDNLLEVSARHP 39 (83) T ss_pred EEEEEECCEEEEEEEEC T ss_conf 29999699999997746 No 23 >cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB3 is expressed in adult skeletal muscle, smooth muscle, and heart, and in several other fetal tissues. In muscle cells HspB3 forms an oligomeric 150 kDa complex with myotonic dystrophy protein kinase-binding protein (MKBP/ HspB2), this complex may comprise one of two independent muscle-cell specific chaperone systems. The expression of HspB3 is induced during muscle differentiation controlled by the myogenic factor MyoD. HspB3 may also interact with Hsp22 (HspB8). Probab=36.53 E-value=34 Score=15.42 Aligned_cols=18 Identities=22% Similarity=0.316 Sum_probs=8.8 Q ss_pred CCCCEEEEECCEEEEEEC Q ss_conf 997589997998999906 Q gi|254780246|r 12 PLGVDVAVEDHEIKVKGP 29 (177) Q Consensus 12 P~~V~v~i~~~~i~vkGp 29 (177) |+.++|.+.++.|.|.|. T Consensus 20 PeEi~Vkv~d~~l~V~gk 37 (83) T cd06477 20 PEDIIIQVFEGWLLIKGQ 37 (83) T ss_pred CCCEEEEEECCEEEEEEE T ss_conf 551499996998999975 No 24 >smart00466 SRA SET and RING finger associated domain. Domain of unknown function in SET domain containing proteins and in Deinococcus radiodurans DRA1533. Domain in SET domain containing proteins and in Deinococcus radiodurans DRA1533. Probab=35.06 E-value=31 Score=15.63 Aligned_cols=25 Identities=32% Similarity=0.538 Sum_probs=18.0 Q ss_pred HHCCCCCCCCC-CCCEEECCEEEEEE Q ss_conf 41007479857-87434537099971 Q gi|254780246|r 148 IRSYRSAEPYK-GKGIRYSGEVIIRK 172 (177) Q Consensus 148 Ir~~r~pepYK-GKgI~~~~e~I~~K 172 (177) ||.++..++|. ++|.+|||.|-+.+ T Consensus 107 iRg~~~~~~~~p~~gyrYDGLY~V~~ 132 (155) T smart00466 107 VRGMKGYSKYAPGKGYIYDGLYRIVD 132 (155) T ss_pred EEEECCCCCCCCCCCEEECCEEEEEE T ss_conf 97100577768887678484689999 No 25 >cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. Probab=34.34 E-value=25 Score=16.12 Aligned_cols=18 Identities=17% Similarity=0.241 Sum_probs=10.7 Q ss_pred CEEEEEECCEEEEEECCC Q ss_conf 639997075899850554 Q gi|254780246|r 40 GISVTLQEGMLSVATING 57 (177) Q Consensus 40 ~v~i~~~~~~i~i~~~~~ 57 (177) .+.+..+++.+.++...+ T Consensus 22 di~V~v~~~~L~I~g~~~ 39 (83) T cd06526 22 ELKVKVSDNKLVVEGKHE 39 (83) T ss_pred HEEEEEECCEEEEEEEEE T ss_conf 929999999999999983 No 26 >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Probab=33.56 E-value=38 Score=15.14 Aligned_cols=60 Identities=22% Similarity=0.292 Sum_probs=24.0 Q ss_pred ECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCEEECCEEE Q ss_conf 515676552588503899769988999957998987999874100747985787434537099 Q gi|254780246|r 107 LGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVI 169 (177) Q Consensus 107 LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGKgI~~~~e~I 169 (177) +.|+++-.-++.+++..+++.+..+-|-|.+=-==+-.+.-| .|..+|+.|. |++||.-| T Consensus 340 VsF~Y~~~~~vL~~isl~i~~Ge~vaiVG~SGsGKSTL~~LL--~gly~p~~G~-I~idg~di 399 (585) T PRK13657 340 VSFSYDNSRQAVEDVSFEAKPGQTVAIVGPTGAGKSTLINLL--HRVFDPQSGR-IRIDGTDI 399 (585) T ss_pred EEEECCCCCCCCCCCEEEECCCCEEEEECCCCCCHHHHHHHH--HHHCCCCCCC-EEECCEEC T ss_conf 798679998753670389759988999889898699999998--6015788796-75898961 No 27 >cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins. IbpA and IbpB are 16 kDa small heat shock proteins (sHsps). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. IbpA and IbpB are produced during high-level production of various heterologous proteins, specifically human prorenin, renin and bovine insulin-like growth factor 2 (bIGF-2), and are strongly associated with inclusion bodies containing these heterologous proteins. IbpA and IbpB work as an integrated system to stabilize thermally aggregated proteins in a disaggregation competent state. The chaperone activity of IbpB is also significantly elevated as the temperature increases from normal to heat shock. The high temperature results in the disassociation of 2-3-MDa IbpB oligomers into smaller approximately 6 Probab=32.66 E-value=28 Score=15.89 Aligned_cols=16 Identities=13% Similarity=0.339 Sum_probs=10.0 Q ss_pred CEEEEEECCEEEEEEC Q ss_conf 6399970758998505 Q gi|254780246|r 40 GISVTLQEGMLSVATI 55 (177) Q Consensus 40 ~v~i~~~~~~i~i~~~ 55 (177) .+.|+++++.++++.. T Consensus 26 di~V~~~~~~LtI~g~ 41 (90) T cd06470 26 DLEIEVENNQLTVTGK 41 (90) T ss_pred HEEEEEECCEEEEEEE T ss_conf 9599999999999998 No 28 >pfam10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2. Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts. Transport across the nuclear-cytoplasmic membrane is via the macro-molecular membrane-spanning nuclear pore complex, NPC. The pore is lined by a subset of NPC members called nucleoporins that present FG (Phe-Gly) receptors, characteristically GLFG and FXFG motifs, for shuttling RNAs and proteins. RNA cargo is bound to soluble transport proteins (nuclear export factors) such as Mex67 in yeasts, and TAP in metazoa, which pass along the pore by binding to successive FG receptors. Mtr2 when bound to Mex67 maximises this FG-binding. Mtr2 also acts independently of Mex67 in transporting the large ribosomal RNA subunit through the pore. Probab=30.75 E-value=29 Score=15.80 Aligned_cols=31 Identities=23% Similarity=0.452 Sum_probs=24.0 Q ss_pred CCCHHHHHHHHHEEEEEE----------EECCEEEEEEEEE Q ss_conf 220133888752112589----------7511003777874 Q gi|254780246|r 59 KKARAAWGMSRTMINNLF----------HGVTKGYERKLEI 89 (177) Q Consensus 59 k~~ka~~GT~rsli~Nmi----------~GVt~Gf~~~L~l 89 (177) .+.|++||+|-.+=-||+ -||-.+|-|.+-. T Consensus 117 ~~~Rp~Wgs~fGvslqlVvDeri~~nd~~~vIssfnYr~vy 157 (166) T pfam10429 117 DKPRPIWGSYFGVSLQLVLDERIFRNDENGVINSFNYRIVY 157 (166) T ss_pred CCCCCCCCCCCCEEEEEEEECHHHCCCCCCCEEECEEEEEE T ss_conf 88886430332236899985034447752200322046997 No 29 >pfam09288 UBA_3 Fungal ubiquitin-associated domain. Members of this family of ubiquitin binding domains adopt a structure consisting of a three alpha-helix bundle. They are predominantly found in fungal ubiquitin-protein ligases. Probab=28.59 E-value=18 Score=17.06 Aligned_cols=18 Identities=28% Similarity=0.470 Sum_probs=15.3 Q ss_pred EEEEEECCHHHHHHHHHH Q ss_conf 899995799898799987 Q gi|254780246|r 130 EIIVSGIDKQKVGHVAAE 147 (177) Q Consensus 130 ~I~i~G~dke~Vgq~AA~ 147 (177) +.-+.|+|.+.|.||++. T Consensus 2 eaaLyGid~~~V~qF~~~ 19 (55) T pfam09288 2 EAQLYGIDRDLVDQFVSQ 19 (55) T ss_pred HHHHHCCCHHHHHHHHHC T ss_conf 388827889999999984 No 30 >PRK13781 paaB phenylacetate-CoA oxygenase subunit PaaB; Provisional Probab=23.52 E-value=30 Score=15.67 Aligned_cols=14 Identities=21% Similarity=0.555 Sum_probs=7.9 Q ss_pred CCCCCCCCCCCEEE Q ss_conf 56765525885038 Q gi|254780246|r 109 FSHDVLYTPLEGIS 122 (177) Q Consensus 109 ~sh~i~~~ip~~v~ 122 (177) |.||.+|++|++|+ T Consensus 80 YRhptfy~~p~~v~ 93 (95) T PRK13781 80 YRHPTFYTLPDEVG 93 (95) T ss_pred CCCCCCCCCCCCCC T ss_conf 35876131876547 No 31 >pfam11280 DUF3081 Protein of unknown function (DUF3081). This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. Probab=22.82 E-value=56 Score=14.11 Aligned_cols=35 Identities=20% Similarity=0.227 Sum_probs=24.7 Q ss_pred ECCEEEEEEEEEE-----CCCCEEEECCCEEEEEECCCCC Q ss_conf 5110037778740-----4763012204249999515676 Q gi|254780246|r 78 GVTKGYERKLEIS-----GVGCRAFMDGRNLKMSLGFSHD 112 (177) Q Consensus 78 GVt~Gf~~~L~lv-----gvgy~v~~~g~~l~l~LG~sh~ 112 (177) |-.....|.++=+ .=||.+.+.++.+.|.+||-.. T Consensus 18 Ge~~~~~y~~~Gi~A~~D~DGYtv~L~~~~VtL~~~FHnt 57 (79) T pfam11280 18 GEKLDGGYKLEGITAWTDYDGYTCWLADNDVTLTLMFHNT 57 (79) T ss_pred CCCCCCCEEEEEEEEEECCCCCEEEEECCCEEEEEEECCC T ss_conf 9306991798208998659986899936978999996261 No 32 >PRK11176 lipid transporter ATP-binding/permease protein; Provisional Probab=22.67 E-value=59 Score=13.98 Aligned_cols=16 Identities=25% Similarity=0.385 Sum_probs=5.4 Q ss_pred EEEECCHHHHHHHHHH Q ss_conf 9995799898799987 Q gi|254780246|r 132 IVSGIDKQKVGHVAAE 147 (177) Q Consensus 132 ~i~G~dke~Vgq~AA~ 147 (177) .++|=-+|.+.-.-|- T Consensus 479 ~LSgGQrQRialARal 494 (581) T PRK11176 479 LLSGGQRQRIAIARAL 494 (581) T ss_pred CCCHHHHHHHHHHHHH T ss_conf 7899999999999999 No 33 >PTZ00319 NADH-cytochrome B5 reductase; Provisional Probab=22.02 E-value=61 Score=13.91 Aligned_cols=24 Identities=17% Similarity=0.580 Sum_probs=14.6 Q ss_pred CCEEEEEECCCEEEEEECCCEEEE Q ss_conf 998999906946999826863999 Q gi|254780246|r 21 DHEIKVKGPKGQLSFMMSDGISVT 44 (177) Q Consensus 21 ~~~i~vkGp~G~l~~~~~~~v~i~ 44 (177) +..+.++||.|.+.+.-+..+.+. T Consensus 135 Gd~v~~kGP~G~~~Y~~ng~~~i~ 158 (303) T PTZ00319 135 GEKVEMRGPVGKFEYLGNGTYTVK 158 (303) T ss_pred CCEEEEECCCCCEEECCCCCEEEC T ss_conf 899999778423078179726750 No 34 >PRK10743 heat shock protein IbpA; Provisional Probab=21.36 E-value=63 Score=13.83 Aligned_cols=18 Identities=22% Similarity=0.390 Sum_probs=12.0 Q ss_pred CEEEEEECCEEEEEECCC Q ss_conf 639997075899850554 Q gi|254780246|r 40 GISVTLQEGMLSVATING 57 (177) Q Consensus 40 ~v~i~~~~~~i~i~~~~~ 57 (177) .++|..+++.++++.... T Consensus 60 di~I~~~~~~LtI~g~~~ 77 (137) T PRK10743 60 ELEITAQDNLLVVKGAHA 77 (137) T ss_pred HEEEEEECCEEEEEEECC T ss_conf 938999889899997427 No 35 >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins. Probab=21.14 E-value=64 Score=13.80 Aligned_cols=22 Identities=18% Similarity=0.521 Sum_probs=14.3 Q ss_pred CCCCCEEEEEC-CEEEEEECCCE Q ss_conf 79975899979-98999906946 Q gi|254780246|r 11 VPLGVDVAVED-HEIKVKGPKGQ 32 (177) Q Consensus 11 IP~~V~v~i~~-~~i~vkGp~G~ 32 (177) +=++|+.+++. ..+.+-||-|+ T Consensus 18 vL~~inl~i~~Ge~vaivG~sGs 40 (229) T cd03254 18 VLKDINFSIKPGETVAIVGPTGA 40 (229) T ss_pred EEECEEEEECCCCEEEEECCCCC T ss_conf 87462999879999999999998 No 36 >TIGR00483 EF-1_alpha translation elongation factor EF-1, subunit alpha; InterPro: IPR004539 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta). This entry represents EF1A proteins found primarily in eukaryotic (eEF1A) and archaeal (aEF1A) organisms, these proteins being more closely related to one another than to EF1A (or EF-Tu) found in bacteria (IPR004541 from INTERPRO). More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm. Probab=21.06 E-value=24 Score=16.30 Aligned_cols=43 Identities=19% Similarity=0.306 Sum_probs=27.1 Q ss_pred HHHHEEEEEEEECCEEEEEEEEEE-C---CCCEEEECCCE-----EEEEECC Q ss_conf 875211258975110037778740-4---76301220424-----9999515 Q gi|254780246|r 67 MSRTMINNLFHGVTKGYERKLEIS-G---VGCRAFMDGRN-----LKMSLGF 109 (177) Q Consensus 67 T~rsli~Nmi~GVt~Gf~~~L~lv-g---vgy~v~~~g~~-----l~l~LG~ 109 (177) =.|--|+|||+|.|+-=.--|-+- . ++--+++++++ |...||- T Consensus 94 GHRDFiKNMITGaSQADaAvLv~~v~~~~~~ag~~~~pQTrEH~~La~TLGi 145 (445) T TIGR00483 94 GHRDFIKNMITGASQADAAVLVVAVDDGEFEAGISVQPQTREHVFLARTLGI 145 (445) T ss_pred CCCHHHHHCCCCCCCCCEEEEEEECCCCCCCCCEEECCCCHHHHHHHHHHCC T ss_conf 8701343112667512427999952544102401217860577888775032 No 37 >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Probab=20.84 E-value=65 Score=13.76 Aligned_cols=61 Identities=16% Similarity=0.158 Sum_probs=28.2 Q ss_pred ECCCCCCCCCCCCEEEEEECCCCEEEEEECCHHHHHHHHHHHHCCCCCCCCCCCCEEECCEEEE Q ss_conf 5156765525885038997699889999579989879998741007479857874345370999 Q gi|254780246|r 107 LGFSHDVLYTPLEGISIFVSKPTEIIVSGIDKQKVGHVAAEIRSYRSAEPYKGKGIRYSGEVII 170 (177) Q Consensus 107 LG~sh~i~~~ip~~v~v~~~k~~~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGKgI~~~~e~I~ 170 (177) +-|+++-.-.+.+++...++.++.+-|-|.+=-==+-.+.-|. |..+|.+|. |++||.-|. T Consensus 346 VsF~Y~~~~~vL~~is~~I~~Ge~vaIVG~SGsGKSTL~~LL~--rly~p~~G~-I~idG~di~ 406 (593) T PRK10790 346 VSFAYRDDNLVLKNINLSVPSRNFVALVGHTGSGKSTLASLLM--GYYPLTEGE-IRLDGRPLS 406 (593) T ss_pred EEEECCCCCHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHH--HHCCCCCCC-CCCCCEECC T ss_conf 8984599980142601044899789987999886899999999--855678994-165993244 No 38 >TIGR01046 S10_Arc_S20_Euk ribosomal protein S10; InterPro: IPR005729 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . This model describes the archaeal ribosomal protein and its equivalents in eukaryotes.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015935 small ribosomal subunit. Probab=20.79 E-value=65 Score=13.76 Aligned_cols=24 Identities=13% Similarity=0.289 Sum_probs=16.7 Q ss_pred CEEEEEECCHHHHHHHHHHHHCCC Q ss_conf 889999579989879998741007 Q gi|254780246|r 129 TEIIVSGIDKQKVGHVAAEIRSYR 152 (177) Q Consensus 129 ~~I~i~G~dke~Vgq~AA~Ir~~r 152 (177) -.|.|+|.|-..+-.+|++|+..- T Consensus 3 ~RI~L~s~n~~~L~~vc~qi~~iA 26 (99) T TIGR01046 3 ARIKLTSTNVRSLEEVCEQIKEIA 26 (99) T ss_pred EEEEECCCCHHHHHHHHHHHHHHH T ss_conf 568861589578899999998877 No 39 >pfam00488 MutS_V MutS domain V. This domain is found in proteins of the MutS family (DNA mismatch repair proteins) and is found associated with pfam01624, pfam05188, pfam05192 and pfam05190. The mutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair; other members of the family included the eukaryotic MSH 1,2,3, 4,5 and 6 proteins. These have various roles in DNA repair and recombination. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. The aligned region corresponds with domain V of Thermus aquaticus MutS, which contains a Walker A motif, and is structurally similar to the ATPase domain of ABC transporters. Probab=20.66 E-value=65 Score=13.74 Aligned_cols=22 Identities=27% Similarity=0.428 Sum_probs=10.3 Q ss_pred CCCCCEEEEEC-CEEEEEECCCE Q ss_conf 79975899979-98999906946 Q gi|254780246|r 11 VPLGVDVAVED-HEIKVKGPKGQ 32 (177) Q Consensus 11 IP~~V~v~i~~-~~i~vkGp~G~ 32 (177) +|.++...-+. +.+.+.||... T Consensus 31 VpNdi~l~~~~~~~~iiTGpN~s 53 (234) T pfam00488 31 VPNDVSLGKERSRILLITGPNMG 53 (234) T ss_pred ECCEEEECCCCEEEEEEECCCCC T ss_conf 87658977996169999788777 No 40 >PRK11597 heat shock chaperone IbpB; Provisional Probab=20.30 E-value=66 Score=13.69 Aligned_cols=61 Identities=13% Similarity=0.218 Sum_probs=28.8 Q ss_pred CCEEEEEECCEEEEEECCCCCCCHHHHHHHHHEEEEEEEEC-CEEEEEEEEEE-CCC-CEEEECCCEEEEEEC Q ss_conf 86399970758998505543220133888752112589751-10037778740-476-301220424999951 Q gi|254780246|r 39 DGISVTLQEGMLSVATINGSKKARAAWGMSRTMINNLFHGV-TKGYERKLEIS-GVG-CRAFMDGRNLKMSLG 108 (177) Q Consensus 39 ~~v~i~~~~~~i~i~~~~~~k~~ka~~GT~rsli~Nmi~GV-t~Gf~~~L~lv-gvg-y~v~~~g~~l~l~LG 108 (177) ..++|+.+++.+++........... +-.-.|+ ...|+....|- ++- -.|.++.-.|.+.|- T Consensus 57 ~di~I~~~~~~LtI~g~~~~~~~~~---------~ylhrGIa~r~F~r~F~L~e~veV~~A~l~nGlL~I~L~ 120 (142) T PRK11597 57 EDLDIQLEGTRLTVKGTPEQPEKEK---------KWLHQGLVNQPFSLSFTLAENMEVSGATFVNGLLHIDLI 120 (142) T ss_pred HHEEEEEECCEEEEECCCCCCCCCC---------EEEEECCCCCCEEEEEECCCCEEECCEEEECCEEEEEEE T ss_conf 7789999789999971578876411---------267741203726999998887399654971788999997 No 41 >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam Probab=20.26 E-value=55 Score=14.16 Aligned_cols=28 Identities=21% Similarity=0.469 Sum_probs=21.5 Q ss_pred CCCCCC---------CCCCCEEEEECCEEEEEECCCE Q ss_conf 464510---------7997589997998999906946 Q gi|254780246|r 5 GKKAIQ---------VPLGVDVAVEDHEIKVKGPKGQ 32 (177) Q Consensus 5 gk~~I~---------IP~~V~v~i~~~~i~vkGp~G~ 32 (177) |++|+- +|.++...-+++.+.+.||... T Consensus 5 ~RHPlle~~~~~~~~VpNdi~l~~~~~~~iiTGpN~s 41 (216) T cd03284 5 GRHPVVEQVLDNEPFVPNDTELDPERQILLITGPNMA 41 (216) T ss_pred CCCCEEEEECCCCCEECCEEEECCCCEEEEEECCCCC T ss_conf 8686385105889777656897898459999899877 No 42 >TIGR01978 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems. The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly . The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets. In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen . This entry represents SufC, which acts as an ATPase in the SUF system. SufC belongs to the ATP-binding cassette transporter family (IPR003439 from INTERPRO) but is no longer thought to be part of a transporter. The complex is reported as cytosolic or associated with the membrane.; GO: 0005524 ATP binding, 0006810 transport. Probab=20.16 E-value=43 Score=14.80 Aligned_cols=132 Identities=26% Similarity=0.387 Sum_probs=80.9 Q ss_pred CCCCCCEEEEECCEEEEE-ECCCE----EEEEECCCEEEEEECCEEEEEECCC---CCCCHHHHHHHHHEEEEEEEECCE Q ss_conf 079975899979989999-06946----9998268639997075899850554---322013388875211258975110 Q gi|254780246|r 10 QVPLGVDVAVEDHEIKVK-GPKGQ----LSFMMSDGISVTLQEGMLSVATING---SKKARAAWGMSRTMINNLFHGVTK 81 (177) Q Consensus 10 ~IP~~V~v~i~~~~i~vk-Gp~G~----l~~~~~~~v~i~~~~~~i~i~~~~~---~k~~ka~~GT~rsli~Nmi~GVt~ 81 (177) .|=.||+.++..+.+.+= ||.|+ |+..+...=++.+..|+|.+.-.+= ....||-. |+=. T Consensus 14 ~IL~gvnL~v~~GE~HAiMGPNGsGKSTL~~~iaGhp~y~vt~G~I~f~G~Dll~l~~~ERAR~------------GlFL 81 (248) T TIGR01978 14 EILKGVNLTVKKGEIHAIMGPNGSGKSTLSKTIAGHPKYEVTSGTILFKGQDLLELEPDERARA------------GLFL 81 (248) T ss_pred ECCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEEEEEECCEECCCCCHHHHHCC------------CCEE T ss_conf 6167867621685179986889984788877761799337842089877652001896556405------------6510 Q ss_pred EEEEEEEEECCCCEEEEC----------CCE-EE----------------------------EEECCCCC--CCCCCCCE Q ss_conf 037778740476301220----------424-99----------------------------99515676--55258850 Q gi|254780246|r 82 GYERKLEISGVGCRAFMD----------GRN-LK----------------------------MSLGFSHD--VLYTPLEG 120 (177) Q Consensus 82 Gf~~~L~lvgvgy~v~~~----------g~~-l~----------------------------l~LG~sh~--i~~~ip~~ 120 (177) .|.|..|+=||-..-.+. |.. |. ++.|||== =+.+| T Consensus 82 aFQ~P~EIPGV~~~~FlR~A~NA~R~~~G~~~l~~~~F~~~l~~~~~~l~m~~~~d~~l~R~lNeGFSGGEKKrnEI--- 158 (248) T TIGR01978 82 AFQYPEEIPGVSNLEFLRSALNARREARGEEPLDLLDFEKLLKEKLALLDMDELSDEFLNRSLNEGFSGGEKKRNEI--- 158 (248) T ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCCCCCCCHHHHH--- T ss_conf 15888556885778899999999998638998798899999999999856883138871177874543871157689--- Q ss_pred EEEEECCCCEEEE----EECCHHHHHHHHHHHHCCCCCCC Q ss_conf 3899769988999----95799898799987410074798 Q gi|254780246|r 121 ISIFVSKPTEIIV----SGIDKQKVGHVAAEIRSYRSAEP 156 (177) Q Consensus 121 v~v~~~k~~~I~i----~G~dke~Vgq~AA~Ir~~r~pep 156 (177) .+..+-+|...+| ||-|--.+--+|.-|.+||.+-| T Consensus 159 LQm~~L~P~laiLDE~DSGLDiDALk~V~~~in~lr~~~P 198 (248) T TIGR01978 159 LQMALLEPKLAILDEIDSGLDIDALKIVAEGINRLREEHP 198 (248) T ss_pred HHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCC T ss_conf 9887519957986068887637888999999998730689 Done!