BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780247|ref|YP_003064660.1| 30S ribosomal protein S8 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780247|ref|YP_003064660.1| 30S ribosomal protein S8 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 264 bits (675), Expect = 3e-73, Method: Compositional matrix adjust. Identities = 129/129 (100%), Positives = 129/129 (100%) Query: 1 MSCLGDMLTRIRNANLRYKPSVVIPFSRLHARVLDVLKTEGYIGEYCEIDAGKGRIQLKV 60 MSCLGDMLTRIRNANLRYKPSVVIPFSRLHARVLDVLKTEGYIGEYCEIDAGKGRIQLKV Sbjct: 1 MSCLGDMLTRIRNANLRYKPSVVIPFSRLHARVLDVLKTEGYIGEYCEIDAGKGRIQLKV 60 Query: 61 DLKYHNGASVIRKIDCVSKPGRRLYSSFKDIPQVCNGLGIMIVTTSKGVMAGHQARECKV 120 DLKYHNGASVIRKIDCVSKPGRRLYSSFKDIPQVCNGLGIMIVTTSKGVMAGHQARECKV Sbjct: 61 DLKYHNGASVIRKIDCVSKPGRRLYSSFKDIPQVCNGLGIMIVTTSKGVMAGHQARECKV 120 Query: 121 GGEVLCSVF 129 GGEVLCSVF Sbjct: 121 GGEVLCSVF 129 >gi|254781206|ref|YP_003065619.1| hypothetical protein CLIBASIA_05565 [Candidatus Liberibacter asiaticus str. psy62] Length = 1246 Score = 22.7 bits (47), Expect = 2.2, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 83 RLYSSFKDIPQVCNGLGIMIVTTSKGVMAG 112 RLY F+DIPQ L I++ S+ ++ G Sbjct: 787 RLYGIFQDIPQEQPPL-YTIISGSEKILQG 815 >gi|254780335|ref|YP_003064748.1| colicin V production protein [Candidatus Liberibacter asiaticus str. psy62] Length = 156 Score = 22.3 bits (46), Expect = 3.4, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 97 GLGIMIVTTSKGVMAGHQARE 117 GL ++I+TTS + H++RE Sbjct: 111 GLFLLIITTSCWNLIVHESRE 131 >gi|254780924|ref|YP_003065337.1| potassium-efflux system protein [Candidatus Liberibacter asiaticus str. psy62] Length = 609 Score = 21.2 bits (43), Expect = 6.8, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 22 VVIPFSRLHARVLDVLKTEGYIGEYCEIDAGKG 54 VVI F R A L + + IGE+ I A G Sbjct: 331 VVIAFGRSVATALTIAASLSQIGEFSFILANLG 363 >gi|254780939|ref|YP_003065352.1| type I signal peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 248 Score = 20.8 bits (42), Expect = 8.2, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 55 RIQLKVDLKYHNGASVIRKID 75 RI L+ + Y NGA V+R ++ Sbjct: 114 RISLEKGIIYINGAPVVRHME 134 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.141 0.426 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,642 Number of Sequences: 1233 Number of extensions: 3253 Number of successful extensions: 11 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 6 length of query: 129 length of database: 328,796 effective HSP length: 65 effective length of query: 64 effective length of database: 248,651 effective search space: 15913664 effective search space used: 15913664 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 33 (17.3 bits)