BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780248|ref|YP_003064661.1| 30S ribosomal protein S14 [Candidatus Liberibacter asiaticus str. psy62] (101 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780248|ref|YP_003064661.1| 30S ribosomal protein S14 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 196 bits (499), Expect = 5e-53, Method: Compositional matrix adjust. Identities = 101/101 (100%), Positives = 101/101 (100%) Query: 1 MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV 60 MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV Sbjct: 1 MAKVSAVERNKRRLRVVAKQASKRLALKKIVMDKSVTLEERFDAMLQLGSLPRDGSRVRV 60 Query: 61 RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101 RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW Sbjct: 61 RNRCEISGRSRGVYRDFRLSRLALRELGGVGKIPGIIKSSW 101 >gi|254780238|ref|YP_003064651.1| 30S ribosomal protein S11 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 21.6 bits (44), Expect = 3.1, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Query: 51 LPRDGSRVRVRNRCEI-SGRSRGVYRDFRLSRLALRELGG 89 +P+ SR+R R R I SGR+ V F +R+ + + G Sbjct: 1 MPKSPSRIRNRERKNIVSGRAH-VVSTFNNTRITITDPHG 39 >gi|254780859|ref|YP_003065272.1| NADH dehydrogenase subunit G [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 21.2 bits (43), Expect = 3.9, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 31 VMDKSVTLEERFDAMLQLGSLPR 53 + + ++ E DAML +GS PR Sbjct: 365 IFNPTIQGIEEADAMLIIGSNPR 387 >gi|254780801|ref|YP_003065214.1| hypothetical protein CLIBASIA_03460 [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 20.8 bits (42), Expect = 5.1, Method: Compositional matrix adjust. Identities = 7/18 (38%), Positives = 12/18 (66%) Query: 63 RCEISGRSRGVYRDFRLS 80 C+++ S G+ RDF L+ Sbjct: 183 ECKLTKLSMGMTRDFELA 200 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.136 0.377 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,564 Number of Sequences: 1233 Number of extensions: 1811 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 101 length of database: 328,796 effective HSP length: 61 effective length of query: 40 effective length of database: 253,583 effective search space: 10143320 effective search space used: 10143320 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 32 (16.9 bits)