RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780250|ref|YP_003064663.1| 50S ribosomal protein L24 [Candidatus Liberibacter asiaticus str. psy62] (102 letters) >gnl|CDD|30547 COG0198, RplX, Ribosomal protein L24 [Translation, ribosomal structure and biogenesis]. Length = 104 Score = 77.3 bits (190), Expect = 8e-16 Identities = 55/105 (52%), Positives = 75/105 (71%), Gaps = 6/105 (5%) Query: 1 MEKIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQR-QTPNKEAGIISK 59 K++ GD V V+AGKDKGK G+V+ V+ K + V+GVN+VK+H + N E GII+K Sbjct: 2 KMKVKKGDTVKVIAGKDKGKEGKVLKVLPK--KVVVEGVNVVKKHIKPSQENPEGGIINK 59 Query: 60 EASIHLSNLSLID--KDGKQVRVGFSFV-DGKKIRIAKRSGEPID 101 EA IH+SN+++ID K GK RVG+ DGKK+R+AK+SGE ID Sbjct: 60 EAPIHISNVAIIDPNKTGKPTRVGYKVEEDGKKVRVAKKSGEVID 104 >gnl|CDD|36920 KOG1708, KOG1708, KOG1708, Mitochondrial/chloroplast ribosomal protein L24 [Translation, ribosomal structure and biogenesis]. Length = 236 Score = 66.2 bits (161), Expect = 2e-12 Identities = 41/99 (41%), Positives = 55/99 (55%), Gaps = 4/99 (4%) Query: 7 GDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAGIISK-EASIHL 65 GD V VL GKDKGK G+V V+R V+G+N RH E G I K EA +H+ Sbjct: 76 GDTVEVLVGKDKGKQGEVTQVIRHRSWVVVKGLNTKYRHMGSEKEGEPGTIVKSEAPLHV 135 Query: 66 SN-LSLIDKDGKQV-RVGFSFV-DGKKIRIAKRSGEPID 101 S + L+D + Q V + F DG+K+R++ RSG I Sbjct: 136 SKQVMLVDPEDDQPTEVEWRFTEDGEKVRVSTRSGRIIP 174 >gnl|CDD|177063 CHL00141, rpl24, ribosomal protein L24; Validated. Length = 83 Score = 56.2 bits (136), Expect = 2e-09 Identities = 27/73 (36%), Positives = 46/73 (63%), Gaps = 1/73 (1%) Query: 3 KIRTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQGVNIVKRHQRQTPNKEAG-IISKEA 61 ++ GD V +++G DKGK G+V+ +++KS + V+G+NI +H + E G I EA Sbjct: 8 HVKIGDTVKIISGSDKGKIGEVLKIIKKSNKVIVKGINIKFKHIKPNKENEVGEIKQFEA 67 Query: 62 SIHLSNLSLIDKD 74 IH SN+ L +++ Sbjct: 68 PIHSSNVMLYNEE 80 >gnl|CDD|144165 pfam00467, KOW, KOW motif. This family has been extended to coincide with ref. The KOW (Kyprides, Ouzounis, Woese) motif is found in a variety of ribosomal proteins and NusG. Length = 32 Score = 28.6 bits (65), Expect = 0.44 Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 7 GDRVLVLAGKDKGKAGQVMGVVRKSGRAFV 36 GD V V++G KGK G+V+ V R V Sbjct: 2 GDVVRVISGPFKGKKGKVVEVDDSKARVHV 31 >gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cycle progression. No cellular function has yet been ascribed to CNK4. Length = 256 Score = 27.5 bits (61), Expect = 0.74 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 16/80 (20%) Query: 17 DKGKAGQVMGVVRKS-GRAFV-QGVNIVK--RHQRQTPNKEAGIISKEASIHLSNLSLID 72 KG G V VVRK+ R + + +++ K R +R+ EA +++K S ++ Sbjct: 9 GKGSFGVVFKVVRKADKRVYAMKQIDLSKMNRREREEAIDEARVLAKLDSSYI------- 61 Query: 73 KDGKQVRVGFSFVDGKKIRI 92 +R SF+D K+ I Sbjct: 62 -----IRYYESFLDKGKLNI 76 >gnl|CDD|36641 KOG1428, KOG1428, KOG1428, Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]. Length = 3738 Score = 26.2 bits (57), Expect = 1.9 Identities = 11/43 (25%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Query: 34 AFVQGVNIVKRHQRQTPNKEAGIISKEASIHLSNLSLIDKDGK 76 A V R +R P+ I+ AS H+ + ++GK Sbjct: 549 ASVDDKKRNGRLRRLVPSNRRKIVHVCASGHV--YGYVSENGK 589 >gnl|CDD|36124 KOG0906, KOG0906, KOG0906, Phosphatidylinositol 3-kinase VPS34, involved in signal transduction [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 843 Score = 25.0 bits (54), Expect = 4.6 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Query: 64 HLSNLSLIDKDGKQVRVGFSFVDGK 88 HL NL L+ KDGK + F ++ G+ Sbjct: 702 HLDNL-LLTKDGKLFHIDFGYILGR 725 >gnl|CDD|39516 KOG4315, KOG4315, KOG4315, G-patch nucleic acid binding protein [General function prediction only]. Length = 455 Score = 24.3 bits (52), Expect = 7.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 5 RTGDRVLVLAGKDKGKAGQVMGVVRKSGRAFVQ 37 R G++V+V++GK KG G ++ V+ Sbjct: 395 RGGEKVMVVSGKHKGVYGSLLSKDLDKETGVVR 427 >gnl|CDD|146721 pfam04234, CopC, Copper resistance protein CopC. CopC is a bacterial blue copper protein that binds 1 atom of copper per protein molecule. Along with CopA, CopC mediates copper resistance by sequestration of copper in the periplasm. Length = 120 Score = 23.7 bits (52), Expect = 10.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Query: 65 LSNLSLIDKDGKQVRVGFSFVDGKK 89 S+++L D DGK V +G + VDG Sbjct: 57 FSSVTLTDADGKGVALGKATVDGDP 81 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.137 0.373 Gapped Lambda K H 0.267 0.0762 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,122,274 Number of extensions: 49959 Number of successful extensions: 176 Number of sequences better than 10.0: 1 Number of HSP's gapped: 171 Number of HSP's successfully gapped: 20 Length of query: 102 Length of database: 6,263,737 Length adjustment: 69 Effective length of query: 33 Effective length of database: 4,772,716 Effective search space: 157499628 Effective search space used: 157499628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (23.4 bits)