BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780251|ref|YP_003064664.1| 50S ribosomal protein L14 [Candidatus Liberibacter asiaticus str. psy62] (122 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780251|ref|YP_003064664.1| 50S ribosomal protein L14 [Candidatus Liberibacter asiaticus str. psy62] Length = 122 Score = 236 bits (603), Expect = 6e-65, Method: Compositional matrix adjust. Identities = 122/122 (100%), Positives = 122/122 (100%) Query: 1 MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA 60 MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA Sbjct: 1 MIQMQTSLSISDNSGARLVKCIKVLGGSKRKCASIGDTVVVAVKEVIPRSKVKKGSVQKA 60 Query: 61 IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE 120 IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE Sbjct: 61 IIVRVSYGIRRSDGSVVRFDKNAAVLIDNKKDLLASRVFGPVPRELRIKGHLKILSLAAE 120 Query: 121 VV 122 VV Sbjct: 121 VV 122 >gi|254780780|ref|YP_003065193.1| histidine triad (HIT) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 23.1 bits (48), Expect = 1.7, Method: Compositional matrix adjust. Identities = 7/29 (24%), Positives = 17/29 (58%) Query: 22 IKVLGGSKRKCASIGDTVVVAVKEVIPRS 50 IK++ C D +++A+ +++PR+ Sbjct: 16 IKIIRNETNACRVYEDDILLAIMDIMPRN 44 >gi|254780558|ref|YP_003064971.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 21.9 bits (45), Expect = 3.7, Method: Compositional matrix adjust. Identities = 9/33 (27%), Positives = 18/33 (54%) Query: 59 KAIIVRVSYGIRRSDGSVVRFDKNAAVLIDNKK 91 + ++ R+ Y +RR G + A+L+ NK+ Sbjct: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283 >gi|254780660|ref|YP_003065073.1| hypothetical protein CLIBASIA_02735 [Candidatus Liberibacter asiaticus str. psy62] Length = 244 Score = 21.9 bits (45), Expect = 4.1, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 90 KKDLLASRVFGPVPRELRIKGHL 112 +KD L S++F + RE+ + L Sbjct: 16 RKDALKSKIFSKLSREITVSAKL 38 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 21.6 bits (44), Expect = 5.2, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 15/22 (68%) Query: 76 VVRFDKNAAVLIDNKKDLLASR 97 V +FDKN+ +LI + L+ ++ Sbjct: 1402 VSKFDKNSQILIKSHDSLMKAQ 1423 >gi|254780264|ref|YP_003064677.1| elongation factor G [Candidatus Liberibacter asiaticus str. psy62] Length = 701 Score = 21.2 bits (43), Expect = 5.6, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 61 IIVRVSYGIRRSDGSVVRFDKNAAV 85 + V IR +DG++ D NA V Sbjct: 93 FTMEVERSIRVTDGAIALLDSNAGV 117 >gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 503 Score = 20.4 bits (41), Expect = 9.8, Method: Compositional matrix adjust. Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 65 VSYGIRRSDGSVVRF 79 VSY I +S GS+ F Sbjct: 231 VSYSIGKSKGSITHF 245 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.135 0.363 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,937 Number of Sequences: 1233 Number of extensions: 2299 Number of successful extensions: 9 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 122 length of database: 328,796 effective HSP length: 64 effective length of query: 58 effective length of database: 249,884 effective search space: 14493272 effective search space used: 14493272 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 33 (17.3 bits)