HHsearch alignment for GI: 254780252 and conserved domain: KOG1740

>KOG1740 consensus.
Probab=99.92  E-value=1.5e-26  Score=166.49  Aligned_cols=74  Identities=36%  Similarity=0.682  Sum_probs=71.6

Q ss_pred             CEEEEEEEEEECCCCEEEEEEEEEEECCCCCEEECCCEEEEECCCCCCCCCCCEEEEEECCCCCCCEEEEEEEE
Q ss_conf             34799999960898619999971887864130873510389868866040687899996377543203999976
Q gi|254780252|r    3 KRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDS   76 (79)
Q Consensus         3 ~k~l~G~Vvs~km~KTv~V~v~r~~~~~ky~K~~~~~kk~~vHD~~~~~~~GD~V~i~e~rPiSK~K~~~vve~   76 (79)
T Consensus         2 m~~~vg~VvS~kmqKTv~V~V~rl~~n~~ynryv~~~~kymahD~~n~cnvGD~VrlepsRPlSk~K~f~i~eI   75 (107)
T KOG1740           2 MKNVVGTVVSNKMQKTVKVRVDRLFFNPKYNRYVKRTSKYMAHDDKNQCNVGDRVRLEPSRPLSKTKHFIIAEI   75 (107)
T ss_pred             CCCCEEEEEECCCCCEEEEEEEECCCCHHHHHHHHHHHHEEECCCCCCCCCCCEEEECCCCCCCCCCEEEHHHH
T ss_conf             76520001331467406898640102678888988764103307634355465577546885553430445999