HHSEARCH alignment of GI: 254780252 and SCOP domain: d2uubq1

Alignment
>d2uubq1 b.40.4.5 (Q:2-101) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
Probab=99.97  E-value=2.8e-32  Score=195.49  Aligned_cols=76  Identities=57%  Similarity=0.889  Sum_probs=74.8

Q ss_pred             CCEEEEEEEEEECCCCEEEEEEEEEEECCCCCEEECCCEEEEECCCCCCCCCCCEEEEEECCCCCCCEEEEEEEEE
Q ss_conf             7347999999608986199999718878641308735103898688660406878999963775432039999764
Q gi|254780252|r    2 PKRVLQGMVVSDKSEKTIIVLVERRFSHPRFQKTIRRSKRYAVHDENNKYKVGDFVSIEESAPISKKKSWLVIDSE   77 (79)
Q Consensus         2 ~~k~l~G~Vvs~km~KTv~V~v~r~~~~~ky~K~~~~~kk~~vHD~~~~~~~GD~V~i~e~rPiSK~K~~~vve~~   77 (79)
                      |+|+|.|+|+|++|+|||+|+++|+++||+|+|+++++++|+||||+|+|++||.|.|.|||||||+|+|.|+|+.
T Consensus         1 pkr~l~G~Vvs~km~KTv~V~v~r~~~h~ky~K~~~r~kk~~vHD~~n~~k~GD~V~I~e~rPlSK~K~~~v~~Iv   76 (100)
T d2uubq1           1 PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLV   76 (100)
T ss_dssp             CCCEEEEEECCCCBTTEEEEEEEEEEEETTTEEEEEEEEEEEEECTTCCCCTTCEEEEEEEEEEETTEEEEEEEEE
T ss_pred             CCEEEEEEEEECCCCCCEEEEEEEEEECCCCCEEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEEE
T ss_conf             9818999999747997399999999954656789874079999998888999999999988678883579999998


SCOP domain information

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Ribosomal protein S17
species: Thermus thermophilus [TaxId: 274]