HHsearch results for GI: 254780253 and protein with PDBid: 2j01_2

>2j01_2 50S ribosomal protein L29; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: a.2.2.1 PDB: 1vsp_W 1vsa_W 2j03_2 2jl6_2 2jl8_2 2v47_2 2v49_2 2wdi_2 2wdj_2 2wdl_2 2wdn_2 2wh2_2 2wh4_2 2wrj_2 2wrl_2 2wro_2 2wrr_2 2x9s_2 2x9u_2 2xg0_2 ...
Probab=99.62  E-value=2.5e-19  Score=134.71  Aligned_cols=65  Identities=28%  Similarity=0.469  Sum_probs=62.6

Q ss_pred             CCCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98889997299999999999999999999999953786546999999999999999999999853
Q gi|254780253|r    1 MLKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNSRVFKN   65 (67)
Q Consensus         1 mmk~~elr~~s~~eL~~~l~~l~~el~~lrfq~~~gql~np~~ir~~Rk~IARi~Tvl~er~~~~   65 (67)
                      +|+++|||++|++||.+++.+++++||+||||+++||++|||+|+.+||+||||+||++|+..++
T Consensus         7 ~~k~~eir~ls~~eL~~~l~elk~elf~lRfq~~~gql~n~~~i~~~Rk~IARi~Tvl~ek~~~~   71 (72)
T 2j01_2            7 RKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQN   71 (72)
T ss_dssp             -----CCTTTHHHHHHHHHHHHHHHSSSSCCTTSSTTTGGGTTSSSSSCCCCCCC----------
T ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             87699998399999999999999999999999987788762899999999999999999987654