HHsearch results for GI: 254780253 and protein with PDBid: 2wwb_N

>2wwb_N 60S ribosomal protein L35; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Triticum aestivum} PDB: 1s1i_X 2wwa_N 2ww9_N
Probab=99.69  E-value=7.6e-18  Score=125.90  Aligned_cols=62  Identities=27%  Similarity=0.375  Sum_probs=60.1

Q ss_pred             CCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8889997299999999999999999999999953786546999999999999999999999853
Q gi|254780253|r    2 LKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNSRVFKN   65 (67)
Q Consensus         2 mk~~elr~~s~~eL~~~l~~l~~el~~lrfq~~~gql~np~~ir~~Rk~IARi~Tvl~er~~~~   65 (67)
                      ||+.|||++|.+||.++|.+++.|||+||||+++|+  +||+|+.+||+||||+||++|++.++
T Consensus         4 mKa~ELR~ks~eEL~~~L~eLK~EL~~LR~qk~TG~--~~skIk~vRK~IARvlTVinqkqke~   65 (120)
T 2wwb_N            4 VKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRP--SLPKIKTVRKSIACVLTVINEQQREA   65 (120)
T ss_dssp             CSSHHHHTCCSHHHHHHHHHHHHHHHHTCSSCCCSC--CCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             878999719999999999999999999899999788--80789999999999999984999999