HHSEARCH alignment of GI: 254780253 and SCOP domain: d1r73a_

Alignment
>d1r73a_ a.2.2.1 (A:) Ribosomal protein L29 (L29p) {Thermotoga maritima [TaxId: 2336]}
Probab=99.79  E-value=9.6e-20  Score=135.82  Aligned_cols=65  Identities=32%  Similarity=0.455  Sum_probs=62.6

Q ss_pred             CCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             88899972999999999999999999999999537865469999999999999999999998532
Q gi|254780253|r    2 LKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNSRVFKNN   66 (67)
Q Consensus         2 mk~~elr~~s~~eL~~~l~~l~~el~~lrfq~~~gql~np~~ir~~Rk~IARi~Tvl~er~~~~~   66 (67)
                      ||++|||++|++||.+.+.+++++||+||||+++||++|||+|+.+||+||||+||++|++...+
T Consensus         1 MK~~elr~ls~~eL~~~l~~l~~el~~LRfq~~~gql~~~~~i~~~Rk~IARi~Tvl~er~~~~~   65 (66)
T d1r73a_           1 MKASELRNYTDEELKNLLEEKKRQLMELRFQLAMGQLKNTSLIKLTKRDIARIKTILRERELGIR   65 (66)
T ss_dssp             CCCSHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             CCHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             98798873899999999999999999999999877887718999989999999999999986657


SCOP domain information

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Ribosomal protein L29 (L29p)
family: Ribosomal protein L29 (L29p)
domain: Ribosomal protein L29 (L29p)
species: Thermotoga maritima [TaxId: 2336]