BLAST/PSIBLAST alignment of GI: 254780253 and GI: 167645586 at iteration 1
>gi|167645586|ref|YP_001683249.1| 50S ribosomal protein L29 [Caulobacter sp. K31] Length = 64
>gi|167348016|gb|ABZ70751.1| ribosomal protein L29 [Caulobacter sp. K31] Length = 64
 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 47/62 (75%)

Query: 1  MLKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNS 60
          M K +DI  M+ DQL E+L+ LKK+Q +LRFQ A+GQ+EK  R+ E+ ++IARIKT++ +
Sbjct: 1  MTKIQDIRGMTPDQLAEQLLNLKKEQFNLRFQAATGQVEKTHRVGEIRKEIARIKTVLRA 60

Query: 61 RV 62
          + 
Sbjct: 61 KA 62