BLAST/PSIBLAST alignment of GI: 254780253 and GI: 197104704 at iteration 1
>gi|197104704|ref|YP_002130081.1| 50S ribosomal protein L29 [Phenylobacterium zucineum HLK1] Length = 64
>gi|226699270|sp|B4R8M5|RL29_PHEZH RecName: Full=50S ribosomal protein L29 Length = 64
>gi|196478124|gb|ACG77652.1| 50S ribosomal protein L29 [Phenylobacterium zucineum HLK1] Length = 64
 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 47/60 (78%)

Query: 2  LKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNSR 61
          +K  ++  M+ DQL E+L+ LKK+Q +LRFQKA+GQIEK  R+ EV +DIARIKT++ ++
Sbjct: 1  MKIDEVRGMTPDQLNEQLVALKKEQFNLRFQKATGQIEKTHRVDEVRKDIARIKTVLRAK 60