RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780253|ref|YP_003064666.1| ribosomal protein L29 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|144430 pfam00831, Ribosomal_L29, Ribosomal L29 protein. Length = 58 Score = 62.1 bits (152), Expect = 3e-11 Identities = 30/57 (52%), Positives = 44/57 (77%) Query: 5 KDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNSR 61 K++ +S ++L EKL +LKK+ +LRFQKA+GQ+E P R++EV RDIARI T++ R Sbjct: 2 KELRELSDEELKEKLKELKKELFNLRFQKATGQLENPHRIKEVRRDIARILTVLRER 58 >gnl|CDD|88602 cd00427, Ribosomal_L29_HIP, Ribosomal L29 protein/HIP. L29 is a protein of the large ribosomal Subunit. A homolog, called heparin/heparan sulfate interacting protein (HIP), has also been identified in mammals. L29 is located on the surface of the large ribosomal subunit, where it participates in forming a protein ring that surrounds the polypeptide exit channel, providing structural support for the ribosome. L29 is involved in forming the translocon binding site, along with L19, L22, L23, L24, and L31e. In addition, L29 and L23 form the interaction site for trigger factor (TF) on the ribosomal surface, adjacent to the exit tunnel. L29 forms numerous interactions with L23 and with the 23S rRNA. In some eukaryotes, L29 is referred to as L35, which is distinct from L35 found in bacteria and some eukaryotes (primarily plastids and mitochondria). The mammalian homolog, HIP, is found on the surface of many tissues and cell lines. It is believed to play a role in cell adhesion and modulation of blood coagulation. It has also been shown to inhibit apoptosis in cancer cells.. Length = 57 Score = 57.0 bits (138), Expect = 1e-09 Identities = 30/57 (52%), Positives = 45/57 (78%) Query: 5 KDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNSR 61 K++ S ++L EKL +LKK+ +LRFQKA+GQ+E P R+R+V +DIARIKT++N + Sbjct: 1 KELREKSDEELQEKLDELKKELFNLRFQKATGQLENPHRIRKVRKDIARIKTVLNEK 57 >gnl|CDD|30604 COG0255, RpmC, Ribosomal protein L29 [Translation, ribosomal structure and biogenesis]. Length = 69 Score = 56.0 bits (135), Expect = 2e-09 Identities = 29/61 (47%), Positives = 44/61 (72%) Query: 1 MLKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNS 60 K K++ S+++L E+L +LKK+ +LRFQ A+GQ+E P R+REV RDIARI T++ Sbjct: 2 KAKRKELREKSVEELEEELRELKKELFNLRFQLATGQLENPHRIREVRRDIARILTVLRE 61 Query: 61 R 61 + Sbjct: 62 K 62 >gnl|CDD|177071 CHL00154, rpl29, ribosomal protein L29; Validated. Length = 67 Score = 33.6 bits (77), Expect = 0.013 Identities = 18/61 (29%), Positives = 37/61 (60%) Query: 1 MLKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQIEKPFRMREVSRDIARIKTMMNS 60 + K DI ++ +++E++I+ KK+ LR +KA+ Q KP + +A++ T+++S Sbjct: 3 LPKITDIIDLTDSEISEEIIKTKKELFDLRLKKATRQNFKPHLFKHKKHRLAQLLTLLSS 62 Query: 61 R 61 R Sbjct: 63 R 63 >gnl|CDD|38646 KOG3436, KOG3436, KOG3436, 60S ribosomal protein L35 [Translation, ribosomal structure and biogenesis]. Length = 123 Score = 25.0 bits (54), Expect = 4.9 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 2 LKFKDISVMSIDQLTEKLIQLKKDQMSLRFQKASGQI-EKPFRMREVSRDIARIKTMMNS 60 +K +++ S +QL ++L LK + LR K +G K +++ V + IAR+ T++N Sbjct: 4 IKARELRGKSKEQLLKQLDDLKVELAQLRVAKVTGGAASKLSKIKVVRKSIARVLTVINE 63 Query: 61 R 61 + Sbjct: 64 K 64 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.132 0.338 Gapped Lambda K H 0.267 0.0790 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 678,985 Number of extensions: 25001 Number of successful extensions: 79 Number of sequences better than 10.0: 1 Number of HSP's gapped: 79 Number of HSP's successfully gapped: 12 Length of query: 67 Length of database: 6,263,737 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,442,595 Effective search space: 157835255 Effective search space used: 157835255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 51 (23.3 bits)