Query gi|254780254|ref|YP_003064667.1| 50S ribosomal protein L16 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 138 No_of_seqs 112 out of 1127 Neff 5.2 Searched_HMMs 39220 Date Tue May 24 09:51:30 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780254.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK09203 rplP 50S ribosomal pr 100.0 0 0 375.7 14.2 137 2-138 1-137 (138) 2 CHL00044 rpl16 ribosomal prote 100.0 0 0 376.0 13.8 135 2-136 1-135 (136) 3 TIGR01164 rplP_bact ribosomal 100.0 0 0 365.6 10.0 126 3-128 1-126 (126) 4 COG0197 RplP Ribosomal protein 100.0 0 0 326.9 14.1 137 1-137 1-139 (146) 5 pfam00252 Ribosomal_L16 Riboso 100.0 0 0 315.3 12.5 128 5-132 1-129 (129) 6 KOG3422 consensus 100.0 0 0 288.4 11.7 136 2-137 39-178 (221) 7 cd01433 Ribosomal_L16_L10e Rib 100.0 3.9E-41 1.4E-45 255.7 11.7 110 24-133 1-112 (112) 8 PRK04199 rpl10e 50S ribosomal 99.8 4.7E-18 1.2E-22 123.8 10.4 102 34-135 48-165 (173) 9 PTZ00173 60S ribosomal protein 99.6 4.7E-15 1.2E-19 106.7 9.7 101 34-134 51-167 (215) 10 TIGR00279 L10e ribosomal prote 98.8 1.1E-08 2.7E-13 70.4 6.6 104 33-136 50-169 (183) 11 KOG0857 consensus 98.2 1E-06 2.6E-11 59.1 3.8 100 34-133 51-167 (212) 12 pfam05963 Cytomega_US3 Cytomeg 70.5 3.9 9.9E-05 21.4 2.6 82 14-106 55-139 (187) 13 KOG2778 consensus 65.0 5.4 0.00014 20.6 2.4 35 77-111 143-179 (328) 14 KOG0107 consensus 52.0 15 0.00039 18.0 3.0 46 75-120 22-68 (195) 15 COG1566 EmrA Multidrug resista 47.6 22 0.00056 17.1 3.2 24 97-120 74-97 (352) 16 PRK10559 p-hydroxybenzoic acid 44.6 26 0.00066 16.7 3.2 13 34-46 184-196 (310) 17 pfam12053 DUF3534 Domain of un 39.2 29 0.00074 16.4 2.7 78 27-106 4-116 (145) 18 PRK10476 multidrug resistance 36.7 33 0.00085 16.1 2.7 16 97-112 71-86 (348) 19 TIGR00998 8a0101 efflux pump m 34.1 40 0.001 15.6 3.0 21 97-117 64-84 (379) 20 TIGR02062 RNase_B exoribonucle 33.9 19 0.00048 17.5 1.1 63 26-88 52-120 (664) 21 pfam01088 Peptidase_C12 Ubiqui 32.1 36 0.00092 15.9 2.3 22 89-110 160-181 (211) 22 pfam06183 DinI DinI-like famil 29.3 45 0.0012 15.3 2.4 32 44-82 2-33 (65) 23 TIGR01843 type_I_hlyD type I s 26.0 56 0.0014 14.8 2.4 18 97-114 64-81 (434) 24 pfam02505 MCR_D Methyl-coenzym 25.3 58 0.0015 14.7 9.2 78 48-132 13-105 (153) 25 PRK05783 hypothetical protein; 22.2 67 0.0017 14.4 6.3 43 94-136 34-81 (84) 26 COG4055 McrD Methyl coenzyme M 22.0 68 0.0017 14.3 4.4 78 49-132 22-113 (165) 27 KOG3093 consensus 21.6 24 0.00062 16.9 -0.2 58 65-129 129-187 (200) 28 TIGR02166 dmsA_ynfE anaerobic 21.0 29 0.00075 16.4 0.2 16 74-89 226-242 (849) 29 TIGR03260 met_CoM_red_D methyl 20.5 73 0.0018 14.2 9.2 77 48-132 12-103 (150) 30 COG4725 IME4 Transcriptional a 20.1 74 0.0019 14.1 2.6 45 40-88 60-104 (198) No 1 >PRK09203 rplP 50S ribosomal protein L16; Reviewed Probab=100.00 E-value=0 Score=375.71 Aligned_cols=137 Identities=63% Similarity=1.005 Sum_probs=134.9 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCC Q ss_conf 98887755106789897234778753121310327405313259999999999997426784689875498607862154 Q gi|254780254|r 2 LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTE 81 (138) Q Consensus 2 ml~Pk~~KyrK~~kgr~~g~~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e 81 (138) ||+||+|||||+||||++|.++++|+|+||+|||+|+|+||||++||||||++|+|+|+++|++|||||||.|||+||+| T Consensus 1 mL~PKrtKyrK~~kgr~~g~~~~g~~l~fG~yGL~ale~g~it~~qiEa~R~~i~R~lkr~gk~wirifP~~pvTkKp~e 80 (138) T PRK09203 1 MLQPKRTKYRKQHKGRNRGLAKRGNTVSFGEFGLKALERGRITARQIEAARRAMTRHIKRGGKVWIRIFPDKPITKKPAE 80 (138) T ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCEECCCCEEEEECCCCEECHHHHHHHHHHHHHHHCCCCEEEEEECCCCCEECCCCC T ss_conf 98887675123457888876777888711412457761770669999999999998741176189996798541217632 Q ss_pred CCCCCCCCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEEECC Q ss_conf 400144788110699832150899974979999999999985438951799998629 Q gi|254780254|r 82 VRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAAKLSVVTKFIQRVVE 138 (138) Q Consensus 82 ~RMGkGKG~~~~wv~~Vk~G~ilfEi~gi~~~~a~~al~~a~~KLP~k~k~i~k~~~ 138 (138) +|||+|||++|||||+|+||+||||++|+++++|++||++|++|||++|+||+|+.+ T Consensus 81 ~RMGkGKG~~~~wv~~Vk~G~IlfEi~gv~~~~a~~al~~a~~KLP~ktk~I~r~~~ 137 (138) T PRK09203 81 VRMGKGKGSPEYWVAVVKPGRILFEIAGVSEELAREALRLAAAKLPIKTKFVKRGEE 137 (138) T ss_pred CCCCCCCCCHHHEEEEECCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCC T ss_conf 657789898557799967995899967999999999999998638974799972577 No 2 >CHL00044 rpl16 ribosomal protein L16 Probab=100.00 E-value=0 Score=375.99 Aligned_cols=135 Identities=52% Similarity=0.934 Sum_probs=134.0 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCC Q ss_conf 98887755106789897234778753121310327405313259999999999997426784689875498607862154 Q gi|254780254|r 2 LRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTE 81 (138) Q Consensus 2 ml~Pk~~KyrK~~kgr~~g~~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e 81 (138) ||+||+|||+|+||||++|.++++|+|.||+|||+|+|+++||++||||||++|+|+|+++|++|||||||.|||+||+| T Consensus 1 mL~Pkr~K~rK~~kgr~~G~~~~g~~l~fG~yGLkale~g~it~~qiEa~R~~i~R~ikr~gk~wirvfP~~pvT~Kp~e 80 (136) T CHL00044 1 MLSPKRTKFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAMTRYARRGGKIWIRIFPDKPVTVRPAE 80 (136) T ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCEECHHHHHHHHHHHHHHHHHCCEEEEEECCCCCEEECCCC T ss_conf 98888674245467888875778888864015678860880469999999999999864276299996899651306622 Q ss_pred CCCCCCCCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEEE Q ss_conf 4001447881106998321508999749799999999999854389517999986 Q gi|254780254|r 82 VRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAAKLSVVTKFIQRV 136 (138) Q Consensus 82 ~RMGkGKG~~~~wv~~Vk~G~ilfEi~gi~~~~a~~al~~a~~KLP~k~k~i~k~ 136 (138) +|||+|||++||||++|+||+||||++|+++++|++||++|++|||++|+||+|+ T Consensus 81 ~RMGkGKG~~~~wv~~Vk~G~IlFEi~gv~~~~a~~al~~aa~KLP~k~k~I~k~ 135 (136) T CHL00044 81 TRMGSGKGSPEYWVAVVKPGRILYEMGGVSENIARAAIKIAAYKMPIKTQFIISE 135 (136) T ss_pred CCCCCCCCCHHHEEEEECCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECC T ss_conf 5477887885367999679969999689999999999999975289607998637 No 3 >TIGR01164 rplP_bact ribosomal protein L16; InterPro: IPR000114 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . Ribosomal protein L16 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L16 is known to bind directly the 23S rRNA and to be located at the A site of the peptidyltransferase centre. L16 is a protein of 133 to 185 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome. Probab=100.00 E-value=0 Score=365.60 Aligned_cols=126 Identities=56% Similarity=0.944 Sum_probs=125.3 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCC Q ss_conf 88877551067898972347787531213103274053132599999999999974267846898754986078621544 Q gi|254780254|r 3 RQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTEV 82 (138) Q Consensus 3 l~Pk~~KyrK~~kgr~~g~~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e~ 82 (138) |+||+|||||.|+|+++|.+.+||.|.||+|||+|+|..|||++||||||.||+|+++++|++|||||||.|+|.||+|| T Consensus 1 L~Pkr~kyRK~~~G~~~G~a~~G~~~~FG~ygl~a~e~~wit~rQIEaaR~A~~R~~kr~Gk~WIRiFPd~p~T~KP~Et 80 (126) T TIGR01164 1 LSPKRTKYRKQQRGRLKGKAKRGNTVAFGEYGLQALEPAWITARQIEAARVAMTRYIKRGGKLWIRIFPDKPYTKKPAET 80 (126) T ss_pred CCCCCEEEEECEECCEEEEECCCCEECCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCC T ss_conf 99971035313001213320159840015322222034202268889999999886520670689967888832788852 Q ss_pred CCCCCCCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCC Q ss_conf 0014478811069983215089997497999999999998543895 Q gi|254780254|r 83 RMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAAKLSV 128 (138) Q Consensus 83 RMGkGKG~~~~wv~~Vk~G~ilfEi~gi~~~~a~~al~~a~~KLP~ 128 (138) |||+|||+|||||+.|++|+||||+.||+|++|.+||++|++|||+ T Consensus 81 RMG~GKG~~E~Wva~vk~G~vlFE~~Gv~e~~A~~A~~~A~~KLPi 126 (126) T TIGR01164 81 RMGKGKGSPEYWVAVVKPGKVLFEIAGVPEEVAREALRLAASKLPI 126 (126) T ss_pred CCCCCCCCCCEEEEEECCCCEEEEECCCHHHHHHHHHHHHHHCCCC T ss_conf 2588779976147873488079886186088899999985431789 No 4 >COG0197 RplP Ribosomal protein L16/L10E [Translation, ribosomal structure and biogenesis] Probab=100.00 E-value=0 Score=326.86 Aligned_cols=137 Identities=58% Similarity=0.916 Sum_probs=134.6 Q ss_pred CCCCCCCCCCCCCCCCCCCCC--CCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEE Q ss_conf 998887755106789897234--778753121310327405313259999999999997426784689875498607862 Q gi|254780254|r 1 MLRQPKNTKYPKQFKGRIKGV--AKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAK 78 (138) Q Consensus 1 mml~Pk~~KyrK~~kgr~~g~--~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkK 78 (138) |||+|++|||+|+|+++..|. +..||.+.||+|||+|+|++|||++||||||++++|+|++.+++|||||||+|+|+| T Consensus 1 ~ml~Pk~tk~rk~~~g~~~~~~~~~~G~~~~fg~~gL~a~e~~~It~~qiEAARia~~R~lkr~g~~wIRvfP~~~~~~k 80 (146) T COG0197 1 HMLQPKRTKYRKQHKGRGPGITIAKGGNKVFFGEYGLVALEPGQITARQIEAARIAANRYLKRGGGLWIRVFPDKPLTEK 80 (146) T ss_pred CCCCCCCCHHHHCCCCCCCCCEECCCCCCCCCEEEEEEECCCCEECHHHHHHHHHHHHHHHHHCCCEEEEECCCCEEEEC T ss_conf 98678740000114799987422148976551588999855310518899999999999826528779998599504527 Q ss_pred CCCCCCCCCCCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEEEC Q ss_conf 15440014478811069983215089997497999999999998543895179999862 Q gi|254780254|r 79 PTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAAKLSVVTKFIQRVV 137 (138) Q Consensus 79 p~e~RMGkGKG~~~~wv~~Vk~G~ilfEi~gi~~~~a~~al~~a~~KLP~k~k~i~k~~ 137 (138) |.|+|||+|||+|++|||+|+||++|||+.|++++.|+|||++|++|||++|+|+.++. T Consensus 81 p~e~Rmg~GkG~pegwaArVkpG~vlfei~g~~e~~A~EAlr~Aa~KLP~~~~~v~~~~ 139 (146) T COG0197 81 PGEDRMGKGKGKPEGWAARVKPGRVLFEIAGVPEELAREALRRAAAKLPVKTKFVIRIE 139 (146) T ss_pred CCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEEEC T ss_conf 88510048989864789996699689999458689999999998611998558999970 No 5 >pfam00252 Ribosomal_L16 Ribosomal protein L16p/L10e. Probab=100.00 E-value=0 Score=315.27 Aligned_cols=128 Identities=59% Similarity=0.947 Sum_probs=125.8 Q ss_pred CCCCCCCCCCCCCC-CCCCCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCCC Q ss_conf 87755106789897-23477875312131032740531325999999999999742678468987549860786215440 Q gi|254780254|r 5 PKNTKYPKQFKGRI-KGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTEVR 83 (138) Q Consensus 5 Pk~~KyrK~~kgr~-~g~~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e~R 83 (138) |+++||||+|++|+ .+.++++|+|.||+|||+|+|+++|+++||||||++|+|+|++++++|||||||+|||+||+|+| T Consensus 1 P~r~kyrK~~k~r~~~~~~~~g~~l~~G~~gL~a~e~~~i~~~qiEa~R~~i~r~lkk~~~~~irv~P~~~vt~kp~e~r 80 (129) T pfam00252 1 PKRTKYRKYQKGRLEYGGAVPGNKLAFGDYGLKALEPGRITARQIEAARIAINRYLKRGGKLWIRVFPDKPVTKKPAETR 80 (129) T ss_pred CCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCEECHHHHHHHHHHHHHHHHHCCEEEEEECCCCCEECCHHHHC T ss_conf 99775476455866788677788886512689987087795999999999999986328559999679810250805511 Q ss_pred CCCCCCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEE Q ss_conf 0144788110699832150899974979999999999985438951799 Q gi|254780254|r 84 MGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFRLGAAKLSVVTKF 132 (138) Q Consensus 84 MGkGKG~~~~wv~~Vk~G~ilfEi~gi~~~~a~~al~~a~~KLP~k~k~ 132 (138) ||+|||+||||||+|++|+||||++|+++++|++||++|++|||++|+| T Consensus 81 mG~GKG~~~~~~a~Vk~G~ilfEi~~~~~~~a~~al~~a~~KLP~k~ki 129 (129) T pfam00252 81 MGKGKGKPEGWAARVKPGQILFEIGGVSEEVAKEALRRAASKLPIKTKI 129 (129) T ss_pred CCCCCCCCCEEEEEECCCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEC T ss_conf 6799997238999978998999987869899999999886218986569 No 6 >KOG3422 consensus Probab=100.00 E-value=0 Score=288.36 Aligned_cols=136 Identities=40% Similarity=0.737 Sum_probs=131.0 Q ss_pred CCCCCCCCCCCCCCCCC-CCCCCCCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHC--CCCCEEEEEECCCCEEEEE Q ss_conf 98887755106789897-23477875312131032740531325999999999999742--6784689875498607862 Q gi|254780254|r 2 LRQPKNTKYPKQFKGRI-KGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGM--KRAGRVWICVFPDVPVTAK 78 (138) Q Consensus 2 ml~Pk~~KyrK~~kgr~-~g~~~~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~l--kk~gkiwirv~P~~pvTkK 78 (138) +++|+++||+|.||||+ +|.+.+||+|.||+|||+|++.|++++.|+|++|.++.|++ +++|++|.|++||.|||.| T Consensus 39 ~~~P~r~k~rk~~rgr~~rG~s~~gt~L~~g~Ygl~a~~~g~l~~~~~e~~r~~~~r~~~~~~~~~iWrr~~p~~Pvt~K 118 (221) T KOG3422 39 VYAPERTKYRKIQRGRVPRGGSERGTELIFGRYGLRAKSGGILDSAQFEAMRLTRARKMNPRNNGKIWRRPAPNLPVTVK 118 (221) T ss_pred CCCCCCHHHHHHHCCCCCCCCCCCCCEEEECHHHHEECCCCEEEHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEC T ss_conf 22653024557660665667765665664011221014674565788999999998730712375079885699864626 Q ss_pred CCCCCCCCCCCCCCEEEEEECCCEEEEEECC-CCHHHHHHHHHHHHHHCCCEEEEEEEEC Q ss_conf 1544001447881106998321508999749-7999999999998543895179999862 Q gi|254780254|r 79 PTEVRMGKGKGNVEKWVCRVKPGRILFEIDG-VSEEVARRAFRLGAAKLSVVTKFIQRVV 137 (138) Q Consensus 79 p~e~RMGkGKG~~~~wv~~Vk~G~ilfEi~g-i~~~~a~~al~~a~~KLP~k~k~i~k~~ 137 (138) |.|||||+|||+|||||++|++|+||||++| +++.+|++||.+|++|||++++||+.+. T Consensus 119 ~~etRMG~GKGa~d~wva~V~~GrIl~EmgG~~~~~~Ar~al~~aa~klp~~~efVs~~~ 178 (221) T KOG3422 119 GNETRMGGGKGAIDHWVARVKAGRILFEMGGDVEEEEARQALLQAAHKLPFKYEFVSEEM 178 (221) T ss_pred CCCEECCCCCCCCCEEEEEECCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEEEHHH T ss_conf 762133688888653588741780899947845489999999998742896478766765 No 7 >cd01433 Ribosomal_L16_L10e Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, mitochondria, and chloroplasts. Large subunits that lack L16 are defective in peptidyl transferase activity, peptidyl-tRNA hydrolysis activity, association with the 30S subunit, binding of aminoacyl-tRNA and interaction with antibiotics. L16 is required for the function of elongation factor P (EF-P), a protein involved in peptide bond synthesis through the stimulation of peptidyl transferase activity by the ribosome. Mutations in L16 and the adjoining bases of 23S rRNA confer antibiotic resistance in bacteria, suggesting a role for L16 in the formation of the antibiotic binding site. The GTPase RbgA (YlqF) is essential for the assembly of the large subunit, and it is believed to regulate the incorporation of L16. L10e is the archaeal and eukaryotic cytosolic homolog of bacterial L16. L16 and L10e exhibit structural differences at the N-terminus. Probab=100.00 E-value=3.9e-41 Score=255.74 Aligned_cols=110 Identities=55% Similarity=0.941 Sum_probs=106.6 Q ss_pred CCCCCCHHHCCEEECCCEEECHHHHHHHHHHHHHHCCCC-CEEEEEECCCCEEEEECCCCCCCCCCCCCCEEEEEECCCE Q ss_conf 875312131032740531325999999999999742678-4689875498607862154400144788110699832150 Q gi|254780254|r 24 GGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRA-GRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGR 102 (138) Q Consensus 24 ~~~~l~fG~yGL~a~e~g~it~~qiEaaR~~i~R~lkk~-gkiwirv~P~~pvTkKp~e~RMGkGKG~~~~wv~~Vk~G~ 102 (138) +++++.||+|||+|+|+++|+++|||++|++|+|+|++. +++|||+|||+|||+||+|+|||+|||+++|||++|++|+ T Consensus 1 ~~~~~~~g~~gL~a~e~~~i~~~~lEa~R~~i~r~l~k~~~~~~ir~~p~~~vt~k~~~~rMGkGKG~~~~~~~~vk~G~ 80 (112) T cd01433 1 KGNKLFFGEYGLVALEPGRITAEQLEAARIAINRYLKKKGGKLWIRVFPDHPVTKKPLETRMGKGKGKPEGWVARVKPGQ 80 (112) T ss_pred CCCEEEECCEEEEECCCCEECHHHHHHHHHHHHHHHHHCCEEEEEEECCCEEEEECCCCCCCCCCCCCCEEEEEEECCCC T ss_conf 99796304216998608779699999999999874342435999996685627977523536788899008999987998 Q ss_pred EEEEECCCC-HHHHHHHHHHHHHHCCCEEEEE Q ss_conf 899974979-9999999999854389517999 Q gi|254780254|r 103 ILFEIDGVS-EEVARRAFRLGAAKLSVVTKFI 133 (138) Q Consensus 103 ilfEi~gi~-~~~a~~al~~a~~KLP~k~k~i 133 (138) +|||+.+++ +++|++||+++++|||++++|| T Consensus 81 iifEi~~~~~~~~a~~al~~a~~Klp~~~k~i 112 (112) T cd01433 81 ILFEVRGVPEEEVAKEALRRAAKKLPIKTKIV 112 (112) T ss_pred EEEEEECCCCHHHHHHHHHHHHHHCCCCEEEC T ss_conf 99999674757999999998863089967979 No 8 >PRK04199 rpl10e 50S ribosomal protein L10e; Reviewed Probab=99.76 E-value=4.7e-18 Score=123.81 Aligned_cols=102 Identities=25% Similarity=0.331 Sum_probs=90.0 Q ss_pred CEEECCCEEECHHHHHHHHHHHHHHCCC-----CCEEEEEECCCCEEEEECCCC---------CCCCCCCCCCEEEEEEC Q ss_conf 3274053132599999999999974267-----846898754986078621544---------00144788110699832 Q gi|254780254|r 34 ALKAQEANRIGSSEIEAARRAISRGMKR-----AGRVWICVFPDVPVTAKPTEV---------RMGKGKGNVEKWVCRVK 99 (138) Q Consensus 34 GL~a~e~g~it~~qiEaaR~~i~R~lkk-----~gkiwirv~P~~pvTkKp~e~---------RMGkGKG~~~~wv~~Vk 99 (138) -|.+.|..+|++++|||||++.||+|.+ ++.++||+|||..+...+..+ .|-.--|.+.+.+|+|+ T Consensus 48 ~Lv~~e~~QIr~~ALEAaRi~aNkyl~k~~G~~~y~~rir~yPhhVlReNKm~s~AGADRlq~GMR~aFGKp~G~aARV~ 127 (173) T PRK04199 48 SLVVKEPCQIRHNALEAARIAANKYLTKTVGRSNYYLKIRVYPHHVLRENKMATGAGADRVSDGMRLAFGKPVGTAARVE 127 (173) T ss_pred EEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCEEEEECHHHCCCCHHHHHCCCCCCCCCCCEEEEEEC T ss_conf 99865511220889999999999999985275662699984364025641222022134552034333578650599965 Q ss_pred CCEEEEEECCCCH--HHHHHHHHHHHHHCCCEEEEEEE Q ss_conf 1508999749799--99999999985438951799998 Q gi|254780254|r 100 PGRILFEIDGVSE--EVARRAFRLGAAKLSVVTKFIQR 135 (138) Q Consensus 100 ~G~ilfEi~gi~~--~~a~~al~~a~~KLP~k~k~i~k 135 (138) +|++||++....+ +.|++||+.|++|||.+|+|+-- T Consensus 128 ~Gq~i~si~~~~~~~~~akeALrrA~~KlP~~~kI~v~ 165 (173) T PRK04199 128 PGQKIFTVRVNPEHLEAAKEALRRAAMKLPTPCRIVVE 165 (173) T ss_pred CCCEEEEEEECHHHHHHHHHHHHHHHCCCCCCEEEEEE T ss_conf 99989999976571899999999741538997799996 No 9 >PTZ00173 60S ribosomal protein L10; Provisional Probab=99.61 E-value=4.7e-15 Score=106.66 Aligned_cols=101 Identities=24% Similarity=0.234 Sum_probs=88.6 Q ss_pred CEEECCCEEECHHHHHHHHHHHHHHC-----CCCCEEEEEECCCCEEEEECC---------CCCCCCCCCCCCEEEEEEC Q ss_conf 32740531325999999999999742-----678468987549860786215---------4400144788110699832 Q gi|254780254|r 34 ALKAQEANRIGSSEIEAARRAISRGM-----KRAGRVWICVFPDVPVTAKPT---------EVRMGKGKGNVEKWVCRVK 99 (138) Q Consensus 34 GL~a~e~g~it~~qiEaaR~~i~R~l-----kk~gkiwirv~P~~pvTkKp~---------e~RMGkGKG~~~~wv~~Vk 99 (138) -|.+.|..+|++++|||||++.||+| +.++.+.+|+||+..+..... .+.|-.--|+|.+-||+|. T Consensus 51 ~Lv~~e~~Qir~~ALEAaRi~aNkyl~k~~Gk~~fhlrir~~P~hVlReNKmls~AGADRlq~GMr~afGKP~GtaARV~ 130 (215) T PTZ00173 51 HVVSRELEQISSEALEAARIQANKYMVKRAGKDVFHMRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKPNGTCARVR 130 (215) T ss_pred EEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCHHEEEECHHHCCCCHHHHHHCCCCCCCCCCEEEEEEC T ss_conf 99865410030678999999988999985175651589984341215541111244424443134212378540588850 Q ss_pred CCEEEEEECC--CCHHHHHHHHHHHHHHCCCEEEEEE Q ss_conf 1508999749--7999999999998543895179999 Q gi|254780254|r 100 PGRILFEIDG--VSEEVARRAFRLGAAKLSVVTKFIQ 134 (138) Q Consensus 100 ~G~ilfEi~g--i~~~~a~~al~~a~~KLP~k~k~i~ 134 (138) .||+|+.+.. -+.+.|+|||++|.+|||.+++|+. T Consensus 131 iGQvI~Sirtk~~~~~~~iEALrRAkfKfPG~qki~i 167 (215) T PTZ00173 131 IGQILLSMRTKEAYVPQALEALRRAKMKFPGRQKIVV 167 (215) T ss_pred CCCEEEEEEECHHHHHHHHHHHHHHCCCCCCCEEEEE T ss_conf 7987999986667389999999761057899608998 No 10 >TIGR00279 L10e ribosomal protein L10.e; InterPro: IPR001197 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . A variety of eukaryotic and plant ribosomal L10e proteins can be grouped. This family consists of vertebrate L10 (QM) , plant L10, Caenorhabditis elegans L10, yeast L10 (QSR1) and Methanococcus jannaschii MJ0543.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome. Probab=98.82 E-value=1.1e-08 Score=70.37 Aligned_cols=104 Identities=24% Similarity=0.296 Sum_probs=89.5 Q ss_pred CCEEECCCEEECHHHHHHHHHHHHHHCCC-----CCEEEEEECCCCEEEEECCCC---------CCCCCCCCCCEEEEEE Q ss_conf 03274053132599999999999974267-----846898754986078621544---------0014478811069983 Q gi|254780254|r 33 FALKAQEANRIGSSEIEAARRAISRGMKR-----AGRVWICVFPDVPVTAKPTEV---------RMGKGKGNVEKWVCRV 98 (138) Q Consensus 33 yGL~a~e~g~it~~qiEaaR~~i~R~lkk-----~gkiwirv~P~~pvTkKp~e~---------RMGkGKG~~~~wv~~V 98 (138) ..|.+.+...++++.+|++|.+.++++.+ +.++.+++||+..+...+..+ .|-..-|.+...+++| T Consensus 50 ~~~~~~~~~~~~~~~l~~~~~~~~~y~~~~~g~~~~~~~~~~~p~~~~~~~~~~~~~g~d~~~~g~~~~~g~p~g~~~~~ 129 (183) T TIGR00279 50 LSLVAKEPVQLRHNALEAARVAANKYLTRRAGRDGYHLKLRVYPHHILRENKMATGAGADRLSDGMRGAFGKPVGTAARV 129 (183) T ss_pred EEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHCCHHCCCCHHHHHHHHHHHCCCCCCCEEEE T ss_conf 20011102454455566677665444443302233224676321233221000000340234433443215642310000 Q ss_pred CCCEEEEEECC--CCHHHHHHHHHHHHHHCCCEEEEEEEE Q ss_conf 21508999749--799999999999854389517999986 Q gi|254780254|r 99 KPGRILFEIDG--VSEEVARRAFRLGAAKLSVVTKFIQRV 136 (138) Q Consensus 99 k~G~ilfEi~g--i~~~~a~~al~~a~~KLP~k~k~i~k~ 136 (138) ++|+.+|.+.. .+.+.++++|+.++.++|.+|++|... T Consensus 130 ~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~p~p~~~~~~~ 169 (183) T TIGR00279 130 KPGQKILSVWTKPENFDVAKEALRRAAMKFPGPCKIVLEK 169 (183) T ss_pred CCCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEEC T ss_conf 2572578886555311368888876554078631578743 No 11 >KOG0857 consensus Probab=98.24 E-value=1e-06 Score=59.06 Aligned_cols=100 Identities=22% Similarity=0.284 Sum_probs=82.6 Q ss_pred CEEECCCEEECHHHHHHHHHHHHHHCC-----CCCEEEEEECC-------CCEEEEECC---CCCCCCCCCCCCEEEEEE Q ss_conf 327405313259999999999997426-----78468987549-------860786215---440014478811069983 Q gi|254780254|r 34 ALKAQEANRIGSSEIEAARRAISRGMK-----RAGRVWICVFP-------DVPVTAKPT---EVRMGKGKGNVEKWVCRV 98 (138) Q Consensus 34 GL~a~e~g~it~~qiEaaR~~i~R~lk-----k~gkiwirv~P-------~~pvTkKp~---e~RMGkGKG~~~~wv~~V 98 (138) -+.+.+.-.++++++||+|...++++- ..+.+-+|++| ++.+|..|. +|.|-.--|++..-|++| T Consensus 51 ~~~~~~~~~l~~~~~eA~ri~~~~~~~~~~~~d~~~~r~~~~~~fhv~~i~k~ls~~~~~RLQtgmrga~gkp~G~varV 130 (212) T KOG0857 51 HLVSNEIEQLSSEALEAARICANKPMVKSKGKDAFHLRVRVHPNFHVLRINKMLSCAGADRLQTGMRGAFGKPQGTVARV 130 (212) T ss_pred HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHCCCCCCCCCCCEEEEE T ss_conf 56667787678999998542256753022455405666640541547888665424643554311411236766427899 Q ss_pred CCCEEEEEECC--CCHHHHHHHHHHHHHHCCCEEEEE Q ss_conf 21508999749--799999999999854389517999 Q gi|254780254|r 99 KPGRILFEIDG--VSEEVARRAFRLGAAKLSVVTKFI 133 (138) Q Consensus 99 k~G~ilfEi~g--i~~~~a~~al~~a~~KLP~k~k~i 133 (138) ..|+++|.+.. -+.+.++++|+.+.+|+|...+++ T Consensus 131 ~iGqvi~Svrtk~~nkeh~ieal~rak~kfpG~qki~ 167 (212) T KOG0857 131 HIGQVIMSVRTKLQNKEHVIEALRRAKFKFPGRQKIV 167 (212) T ss_pred ECCCEEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEE T ss_conf 7173478763375258999999874446678823688 No 12 >pfam05963 Cytomega_US3 Cytomegalovirus US3 protein. US3 of human cytomegalovirus is an endoplasmic reticulum resident transmembrane glycoprotein that binds to major histocompatibility complex class I molecules and prevents their departure. The endoplasmic reticulum retention signal of the US3 protein is contained in the luminal domain of the protein. Probab=70.50 E-value=3.9 Score=21.44 Aligned_cols=82 Identities=17% Similarity=0.316 Sum_probs=55.7 Q ss_pred CCCCCCCCCCCCCCCCHHHCCEEE---CCCEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCCCCCCCC Q ss_conf 898972347787531213103274---05313259999999999997426784689875498607862154400144788 Q gi|254780254|r 14 FKGRIKGVAKGGSRICFGNFALKA---QEANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTEVRMGKGKGN 90 (138) Q Consensus 14 ~kgr~~g~~~~~~~l~fG~yGL~a---~e~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e~RMGkGKG~ 90 (138) ++|++.|+ -++-.|-|||+++ .|+-+++++|.|- +....--|-.-..+.+-|---.++||--+.|. T Consensus 55 ~rG~isGN---~t~~~Fv~~giv~~sy~enL~v~~~d~~~--------~~g~~lewnv~~~~V~ptv~~VdvRlsl~~Gd 123 (187) T pfam05963 55 FRGSVSGN---FTTFHFVDYGIVSQSYMDNLAVRAEQVEF--------IAGEYFEWNVQGANVLPLVDRVDVRLSLNWGD 123 (187) T ss_pred EEEEEECC---EEEEEEEEEEEEECCCCCCEEEEHHHHHC--------CCCCEEEEECCCCCCCCCEEEEEEEEECCCCC T ss_conf 97688254---10589899987840432222887655310--------55755899526644687126999999836898 Q ss_pred CCEEEEEECCCEEEEE Q ss_conf 1106998321508999 Q gi|254780254|r 91 VEKWVCRVKPGRILFE 106 (138) Q Consensus 91 ~~~wv~~Vk~G~ilfE 106 (138) +.-|++.|+.=|+=|. T Consensus 124 pk~w~tCvPeVrvDy~ 139 (187) T pfam05963 124 PKKWATCVPQVRVDYT 139 (187) T ss_pred CEEEEEECCCEEEEEE T ss_conf 4479994472243001 No 13 >KOG2778 consensus Probab=65.01 E-value=5.4 Score=20.62 Aligned_cols=35 Identities=29% Similarity=0.486 Sum_probs=27.8 Q ss_pred EECCCCCCCCC--CCCCCEEEEEECCCEEEEEECCCC Q ss_conf 62154400144--788110699832150899974979 Q gi|254780254|r 77 AKPTEVRMGKG--KGNVEKWVCRVKPGRILFEIDGVS 111 (138) Q Consensus 77 kKp~e~RMGkG--KG~~~~wv~~Vk~G~ilfEi~gi~ 111 (138) -.|-|++-+-+ -+.+.|+|+.|+.+-.|||++|+. T Consensus 143 ~~~~e~~a~~~~~~dd~yHFVsyvPI~g~lyELDGLk 179 (328) T KOG2778 143 FRPEEVDAATSAKEDDVYHFVSYVPINGRLYELDGLK 179 (328) T ss_pred CCHHHHHCCCCCCCCCCEEEEEEEEECCEEEECCCCC T ss_conf 6316664123656564135788875088788616874 No 14 >KOG0107 consensus Probab=52.02 E-value=15 Score=18.01 Aligned_cols=46 Identities=26% Similarity=0.289 Sum_probs=30.1 Q ss_pred EEEECCCCCCCCCCCCCCEEEEEECCCEEEEEECC-CCHHHHHHHHH Q ss_conf 78621544001447881106998321508999749-79999999999 Q gi|254780254|r 75 VTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG-VSEEVARRAFR 120 (138) Q Consensus 75 vTkKp~e~RMGkGKG~~~~wv~~Vk~G~ilfEi~g-i~~~~a~~al~ 120 (138) .|+.-+|.--++.=---.-|||+.+||-...|++. .+.+-|..+|. T Consensus 22 a~k~eLE~~F~~yG~lrsvWvArnPPGfAFVEFed~RDA~DAvr~LD 68 (195) T KOG0107 22 ATKRELERAFSKYGPLRSVWVARNPPGFAFVEFEDPRDAEDAVRYLD 68 (195) T ss_pred CCHHHHHHHHHHCCCCCEEEEEECCCCCEEEECCCCCCHHHHHHHCC T ss_conf 32788999997437420168872489846776168523888886417 No 15 >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Probab=47.61 E-value=22 Score=17.11 Aligned_cols=24 Identities=33% Similarity=0.369 Sum_probs=14.4 Q ss_pred EECCCEEEEEECCCCHHHHHHHHH Q ss_conf 832150899974979999999999 Q gi|254780254|r 97 RVKPGRILFEIDGVSEEVARRAFR 120 (138) Q Consensus 97 ~Vk~G~ilfEi~gi~~~~a~~al~ 120 (138) .|+.|++||+|+..++..+.+.++ T Consensus 74 ~Vk~Gd~L~~iD~~~y~~al~qAe 97 (352) T COG1566 74 LVKKGDVLFRIDPRDYRAALEQAE 97 (352) T ss_pred EECCCCEEEEECCHHHHHHHHHHH T ss_conf 851897689989578999999999 No 16 >PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Probab=44.63 E-value=26 Score=16.73 Aligned_cols=13 Identities=15% Similarity=0.023 Sum_probs=5.0 Q ss_pred CEEECCCEEECHH Q ss_conf 3274053132599 Q gi|254780254|r 34 ALKAQEANRIGSS 46 (138) Q Consensus 34 GL~a~e~g~it~~ 46 (138) .|...+.-|+.++ T Consensus 184 slV~~~~~wV~AN 196 (310) T PRK10559 184 ALVKKNSFYVLAY 196 (310) T ss_pred EEEECCCEEEEEE T ss_conf 9996896699997 No 17 >pfam12053 DUF3534 Domain of unknown function (DUF3534). This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 150 amino acids in length. This domain is found associated with pfam00595. This domain has a conserved GILD sequence motif. Probab=39.20 E-value=29 Score=16.43 Aligned_cols=78 Identities=17% Similarity=0.310 Sum_probs=50.0 Q ss_pred CCCHHHCCEE-ECCCEEECHHHHHHHHHHHHHHCCCCCE---EEEEECCCC------------------------EEEEE Q ss_conf 3121310327-4053132599999999999974267846---898754986------------------------07862 Q gi|254780254|r 27 RICFGNFALK-AQEANRIGSSEIEAARRAISRGMKRAGR---VWICVFPDV------------------------PVTAK 78 (138) Q Consensus 27 ~l~fG~yGL~-a~e~g~it~~qiEaaR~~i~R~lkk~gk---iwirv~P~~------------------------pvTkK 78 (138) ++.||.-++. -|..|.++-++| +..++.||.|-.++ .|++|+.-- .+..- T Consensus 4 TVcFG~~~vvVPc~~g~~~V~dL--~~~a~~RY~ka~~k~~~~wv~vh~le~~dgGILD~DD~l~DV~dDrd~iiA~~de 81 (145) T pfam12053 4 TVCFGRTGIVVPCKDGQLTVREL--IQQAAQRYKKARGKDPGYWVQVHHLEHTDGGILDPDDVLADVADDKDQILAVFDE 81 (145) T ss_pred EEEECCEEEEEECCCCCEEHHHH--HHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHCCHHHHHEECCC T ss_conf 99957758998758887639999--9999999998653599863999887226886258788677865078775112145 Q ss_pred CCCC-------CCCCCCCCCCEEEEEECCCEEEEE Q ss_conf 1544-------001447881106998321508999 Q gi|254780254|r 79 PTEV-------RMGKGKGNVEKWVCRVKPGRILFE 106 (138) Q Consensus 79 p~e~-------RMGkGKG~~~~wv~~Vk~G~ilfE 106 (138) .... -+--|-++||-|.+.+..+.-.|. T Consensus 82 ~~~~~~gdg~s~ss~gt~SPd~f~~~~~~~~~~f~ 116 (145) T pfam12053 82 QEPHNGGDGTSASSTGTQSPDPFEAELSAQLSAFQ 116 (145) T ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC T ss_conf 56767887876555788899744575333563346 No 18 >PRK10476 multidrug resistance protein MdtN; Provisional Probab=36.66 E-value=33 Score=16.10 Aligned_cols=16 Identities=44% Similarity=0.598 Sum_probs=8.4 Q ss_pred EECCCEEEEEECCCCH Q ss_conf 8321508999749799 Q gi|254780254|r 97 RVKPGRILFEIDGVSE 112 (138) Q Consensus 97 ~Vk~G~ilfEi~gi~~ 112 (138) .|+.|++||+|+..+. T Consensus 71 ~VkkGq~L~~LD~~~~ 86 (348) T PRK10476 71 AVKKGDLLFRIDPRPY 86 (348) T ss_pred EECCCCEEEEECCHHH T ss_conf 8648978999776899 No 19 >TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds. EmrB encodes a highly hydrophobic 56.2-kDa peptide, with 14 potential alpha-helices to span the inner membrane. EmrA encodes a putative 42.7-kDa peptide containing a single hydrophobic domain and a large C-terminal hydrophilic domain.; GO: 0015238 drug transporter activity, 0006855 multidrug transport, 0009276 1-2nm peptidoglycan-based cell wall. Probab=34.14 E-value=40 Score=15.62 Aligned_cols=21 Identities=33% Similarity=0.476 Sum_probs=13.3 Q ss_pred EECCCEEEEEECCCCHHHHHH Q ss_conf 832150899974979999999 Q gi|254780254|r 97 RVKPGRILFEIDGVSEEVARR 117 (138) Q Consensus 97 ~Vk~G~ilfEi~gi~~~~a~~ 117 (138) .||.|.|||++|.-+.+++.+ T Consensus 64 ~Vk~GD~Lv~LD~t~a~~~~~ 84 (379) T TIGR00998 64 YVKQGDVLVRLDPTDAELALA 84 (379) T ss_pred CCEECCEEEEECCCHHHHHHH T ss_conf 420311566767716899999 No 20 >TIGR02062 RNase_B exoribonuclease II; InterPro: IPR011804 This family consists of exoribonuclease II (RNase II), the product of the rnb gene, as found in a number of gamma proteobacteria. In Escherichia coli, it is one of eight different exoribonucleases. It is involved in mRNA degradation and tRNA precursor end processing.; GO: 0003723 RNA binding, 0008859 exoribonuclease II activity, 0006401 RNA catabolic process. Probab=33.93 E-value=19 Score=17.49 Aligned_cols=63 Identities=19% Similarity=0.245 Sum_probs=48.6 Q ss_pred CCCCHHH--CCEEECCCEEECHHHHHHHHHHHHHHCCC--C-CEEEEEECCCCEEEEEC-CCCCCCCCC Q ss_conf 5312131--03274053132599999999999974267--8-46898754986078621-544001447 Q gi|254780254|r 26 SRICFGN--FALKAQEANRIGSSEIEAARRAISRGMKR--A-GRVWICVFPDVPVTAKP-TEVRMGKGK 88 (138) Q Consensus 26 ~~l~fG~--yGL~a~e~g~it~~qiEaaR~~i~R~lkk--~-gkiwirv~P~~pvTkKp-~e~RMGkGK 88 (138) .++.+|| -+.+-.|..|=.|+==|-....++|++.| . ..=.+.|+||+|.=+++ +..|--||= T Consensus 52 KkvMHGDki~A~i~~e~drE~AEPe~LiEp~LtRFvgkv~~nk~~kL~v~pDhP~Lk~~si~a~~~ks~ 120 (664) T TIGR02062 52 KKVMHGDKIVAVIKKEKDREVAEPEELIEPFLTRFVGKVKLNKDDKLAVLPDHPLLKDLSIKARAKKSL 120 (664) T ss_pred CCCCCCCEEEEEEEECCCCCCCCCHHHHHHHHCCEEEEEEECCCCCCEEEECCCCCCCCCCHHHHCCCC T ss_conf 841348827999973587121484343102112347778730378514750885312456011304786 No 21 >pfam01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1. Probab=32.13 E-value=36 Score=15.91 Aligned_cols=22 Identities=23% Similarity=0.335 Sum_probs=19.6 Q ss_pred CCCCEEEEEECCCEEEEEECCC Q ss_conf 8811069983215089997497 Q gi|254780254|r 89 GNVEKWVCRVKPGRILFEIDGV 110 (138) Q Consensus 89 G~~~~wv~~Vk~G~ilfEi~gi 110 (138) ..-.|+||.|+.+-.|+|++|. T Consensus 160 ~~~~HFI~fV~~~G~lyELDG~ 181 (211) T pfam01088 160 DVDFHFIAFVPVDGRLYELDGL 181 (211) T ss_pred CCCEEEEEEEECCCEEEECCCC T ss_conf 6442589998239969987799 No 22 >pfam06183 DinI DinI-like family. This family of short proteins includes DNA-damage-inducible protein I (DinI) and related proteins. The SOS response, a set of cellular phenomena exhibited by eubacteria, is initiated by various causes that include DNA damage-induced replication arrest, and is positively regulated by the co- protease activity of RecA. Escherichia coli DinI, a LexA-regulated SOS gene product, shuts off the initiation of the SOS response when overexpressed in vivo. Biochemical and genetic studies indicated that DinI physically interacts with RecA to inhibit its co-protease activity. The structure of DinI is known. Probab=29.27 E-value=45 Score=15.34 Aligned_cols=32 Identities=16% Similarity=0.453 Sum_probs=24.7 Q ss_pred CHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCC Q ss_conf 599999999999974267846898754986078621544 Q gi|254780254|r 44 GSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTEV 82 (138) Q Consensus 44 t~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e~ 82 (138) .+..++|...-++|++. +.|||.-|+.|+... T Consensus 2 P~ga~~al~~EL~kRl~-------~~fPd~~V~Vr~~s~ 33 (65) T pfam06183 2 PAGAIDALQNELTKRIQ-------SLYPDTVVSVRKGSA 33 (65) T ss_pred CCCHHHHHHHHHHHHHH-------HHCCCCEEEEEECCC T ss_conf 98689999999999865-------338995798710567 No 23 >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Type I secretion is an ABC transporter that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C terminus of the transported protein. This entry represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This entry selects a group of sequences closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.; GO: 0015031 protein transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane. Probab=25.97 E-value=56 Score=14.82 Aligned_cols=18 Identities=50% Similarity=0.787 Sum_probs=14.2 Q ss_pred EECCCEEEEEECCCCHHH Q ss_conf 832150899974979999 Q gi|254780254|r 97 RVKPGRILFEIDGVSEEV 114 (138) Q Consensus 97 ~Vk~G~ilfEi~gi~~~~ 114 (138) +|+.|++|++++.+...- T Consensus 64 ~V~~Gq~L~~Ld~t~~~A 81 (434) T TIGR01843 64 RVKAGQVLVELDATSVEA 81 (434) T ss_pred EECCCCCCEEECHHHHHH T ss_conf 420377013541357899 No 24 >pfam02505 MCR_D Methyl-coenzyme M reductase operon protein D. Methyl coenzyme M reductase (MCR) catalyses the final step in methanogenesis. MCR is composed of three subunits, alpha (pfam02249), beta (pfam02241) and gamma (pfam02240). Genes encoding the beta (mcrB) and gamma (mcrG) subunits are separated by two open reading frames coding for two proteins C and D. The function of proteins C and D (this family) is unknown. Probab=25.30 E-value=58 Score=14.72 Aligned_cols=78 Identities=18% Similarity=0.239 Sum_probs=48.8 Q ss_pred HHHHHHHHHHHCCCCCEEEEEEC-CCCEEEEECCCCCCCCCCCCCC-------------EEEEEECCCEEEEEECCCCHH Q ss_conf 99999999974267846898754-9860786215440014478811-------------069983215089997497999 Q gi|254780254|r 48 IEAARRAISRGMKRAGRVWICVF-PDVPVTAKPTEVRMGKGKGNVE-------------KWVCRVKPGRILFEIDGVSEE 113 (138) Q Consensus 48 iEaaR~~i~R~lkk~gkiwirv~-P~~pvTkKp~e~RMGkGKG~~~-------------~wv~~Vk~G~ilfEi~gi~~~ 113 (138) -|++...+|+-..=.|-..+.|+ |..|- .+-.|-++|.+. -..-.|+.|+|+.|+.+.. T Consensus 13 ~eTtEklLN~l~~i~gI~R~vihGp~LPk-----~VpyGPa~G~~v~h~~Rk~I~V~g~~veL~V~VGrI~veled~~-- 85 (153) T pfam02505 13 AETTEKLLNEIYDLEGVVRVVIHGQSLPK-----RVPYGPARGTPVNHPDRKVITVKGEEVELKVKVGRIIVELEDDE-- 85 (153) T ss_pred HHHHHHHHHHHHCCCCEEEEEEECCCCCC-----CCCCCCCCCCCCCCCCCEEEEECCEEEEEEEEEEEEEEEECCHH-- T ss_conf 78899999987452777999987899997-----77888667887888753579989998999999828999972668-- Q ss_pred HHHHHHHHHH-HHCCCEEEE Q ss_conf 9999999985-438951799 Q gi|254780254|r 114 VARRAFRLGA-AKLSVVTKF 132 (138) Q Consensus 114 ~a~~al~~a~-~KLP~k~k~ 132 (138) ...+..+.++ .-|||...+ T Consensus 86 ~~i~~I~eiC~e~~pf~y~i 105 (153) T pfam02505 86 EEIEKIEEICKELLPFGYEV 105 (153) T ss_pred HHHHHHHHHHHHHCCCCEEE T ss_conf 88999999999757985574 No 25 >PRK05783 hypothetical protein; Provisional Probab=22.25 E-value=67 Score=14.37 Aligned_cols=43 Identities=28% Similarity=0.453 Sum_probs=34.0 Q ss_pred EEEEECCCE-EEEEECCCCHHHHHHHHHHHHHHC----CCEEEEEEEE Q ss_conf 699832150-899974979999999999985438----9517999986 Q gi|254780254|r 94 WVCRVKPGR-ILFEIDGVSEEVARRAFRLGAAKL----SVVTKFIQRV 136 (138) Q Consensus 94 wv~~Vk~G~-ilfEi~gi~~~~a~~al~~a~~KL----P~k~k~i~k~ 136 (138) ++..|+.|+ +.|++..-+++.|++.....+.+| |+=-++.-++ T Consensus 34 ~v~~vR~GK~l~~~iea~s~eeA~~~v~~ic~~lrL~NPvI~~~~i~v 81 (84) T PRK05783 34 YSIEVRAGKCLVFRIEASSPEEAQELALKLAKEMRLGNPIVHKIVVRV 81 (84) T ss_pred CEEEEEEEEEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEE T ss_conf 648987104999999479989999999999986203498528999999 No 26 >COG4055 McrD Methyl coenzyme M reductase, subunit D [Coenzyme metabolism] Probab=21.97 E-value=68 Score=14.34 Aligned_cols=78 Identities=23% Similarity=0.352 Sum_probs=43.2 Q ss_pred HHHHHHHHHHCCCCCEEEEEEC-CCCEEEEECCCCCCCCCCCCC-------------CEEEEEECCCEEEEEECCCCHHH Q ss_conf 9999999974267846898754-986078621544001447881-------------10699832150899974979999 Q gi|254780254|r 49 EAARRAISRGMKRAGRVWICVF-PDVPVTAKPTEVRMGKGKGNV-------------EKWVCRVKPGRILFEIDGVSEEV 114 (138) Q Consensus 49 EaaR~~i~R~lkk~gkiwirv~-P~~pvTkKp~e~RMGkGKG~~-------------~~wv~~Vk~G~ilfEi~gi~~~~ 114 (138) |++...+|+.-.=.|-..+.|+ |-.|-+ +--|-+-|.+ +-.--+|+.|+|+.|+.+-.+ . T Consensus 22 eTtEKlLn~lydl~gI~RvvihG~~LPk~-----V~~GParG~pv~H~dRr~I~V~g~~~eL~VkvGri~~eie~e~~-~ 95 (165) T COG4055 22 ETTEKLLNELYDLDGIVRVVIHGPRLPKR-----VPYGPARGLPVNHPDRRPIQVKGEEIELKVKVGRIILEIEDEDE-T 95 (165) T ss_pred HHHHHHHHHHHHHCCEEEEEEECCCCCCC-----CCCCCCCCCCCCCCCCCEEEECCEEEEEEEEEEEEEEEECCCHH-H T ss_conf 56999999886323768999868999865-----23688878746786554067768889999986079999647176-7 Q ss_pred HHHHHHHHHHHCCCEEEE Q ss_conf 999999985438951799 Q gi|254780254|r 115 ARRAFRLGAAKLSVVTKF 132 (138) Q Consensus 115 a~~al~~a~~KLP~k~k~ 132 (138) .-..=+-.-.-|||...+ T Consensus 96 ~e~ie~ic~e~lPf~y~v 113 (165) T COG4055 96 MEKIEEICDEMLPFGYEV 113 (165) T ss_pred HHHHHHHHHHHCCCCEEE T ss_conf 999999999758985565 No 27 >KOG3093 consensus Probab=21.56 E-value=24 Score=16.86 Aligned_cols=58 Identities=21% Similarity=0.218 Sum_probs=31.3 Q ss_pred EEEEECCCCEEEEECCCCCCCCCCCCCCEEEEEECCCEEEEEECC-CCHHHHHHHHHHHHHHCCCE Q ss_conf 898754986078621544001447881106998321508999749-79999999999985438951 Q gi|254780254|r 65 VWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDG-VSEEVARRAFRLGAAKLSVV 129 (138) Q Consensus 65 iwirv~P~~pvTkKp~e~RMGkGKG~~~~wv~~Vk~G~ilfEi~g-i~~~~a~~al~~a~~KLP~k 129 (138) +=.-+.|-...+.++ .|||-|||--|.|. +.=+..+ .. -+..++.-.-.++..-+|+. T Consensus 129 lDLiivPGvAFd~~g--~RlGhGkGYYD~fl---kry~~~~--~~~kp~~vgL~l~EQI~~~IPv~ 187 (200) T KOG3093 129 LDLIIVPGVAFDRKG--ARLGHGKGYYDDFL---KRYQIHA--PEQKPLLVGLCLKEQILSEIPVE 187 (200) T ss_pred CEEEEECCCCCCHHH--HHCCCCCCHHHHHH---HHHHHHC--CCCCCHHHHHHHHHHHCCCCCCC T ss_conf 028983662213320--21268865188999---9999865--55683145445467653667888 No 28 >TIGR02166 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family; InterPro: IPR011888 Many bacterial species are capable of anaerobic growth by using dimethylsulphoxide (DMSO) as the terminal electron acceptor, with DMSO reductase as the terminal elctron transfer enzyme. In Escherichia coli and many other Gram-negative bacteria DMSO reductase is a membrane-bound enzyme composed of three subunits; a catalytic molybdenum-containing subunit (DmsA), an electron transfer subunit containing a [4Fe-4S] cluster (DmsB), and a hydrophobic membrane-spanning anchor subunit which attaches the enzyme to the cytoplasmic membrane (DmsC) , . It is generally thought now that DmsAB faces the periplasm, contradicting previous results suggesting a cytoplasmic location. The N-terminal region of DmsA contains a "twin-arginine" signal sequence, suggesting export to the periplasm occurs via the TAT secretion pathway. This entry represents known and predicted bacterial DmsA polypeptides. Several species contain one or more paralogs of DmsA. In E. coli, the two paralogs of DmsA, YnfE and YnfF, are encoded within the ynfEFGHI operon . YnfE and YnfF cannot form a functional complex with DmsBC, but YnfFGH can restore growth on DMSO when DmABC is deleted. The function of YnfE is not known and it appears to prevent formation of the YnfFGH complex if present.; GO: 0009389 dimethyl sulfoxide reductase activity, 0030151 molybdenum ion binding, 0051539 4 iron 4 sulfur cluster binding. Probab=21.04 E-value=29 Score=16.41 Aligned_cols=16 Identities=38% Similarity=0.634 Sum_probs=10.2 Q ss_pred EEEEECCCCCC-CCCCC Q ss_conf 07862154400-14478 Q gi|254780254|r 74 PVTAKPTEVRM-GKGKG 89 (138) Q Consensus 74 pvTkKp~e~RM-GkGKG 89 (138) ..=-.|.|||| |.|.+ T Consensus 226 ~fG~NP~ETRmSGGG~~ 242 (849) T TIGR02166 226 MFGNNPAETRMSGGGQT 242 (849) T ss_pred EECCCCHHEEECCCCCH T ss_conf 81578102032278604 No 29 >TIGR03260 met_CoM_red_D methyl-coenzyme M reductase operon protein D. Members of this protein family are protein D, a non-structural protein, of the operon for methyl coenzyme M reductase, also called coenzyme-B sulfoethylthiotransferase (EC 2.8.4.1). That enzyme, with alpha, beta, and gamma subunits, catalyzes the last step in methanogenesis; it has several modified sites, so accessory proteins are expected. Several methanogens have encode two such enzymes, designated I and II; this model does not separate the isozymes. Proteins in this family are expressed at much lower levels than the methyl-coenzyme M reductase itself and associate and have been shown to form at least transient associations. The precise function is unknown. Probab=20.52 E-value=73 Score=14.16 Aligned_cols=77 Identities=17% Similarity=0.251 Sum_probs=48.1 Q ss_pred HHHHHHHHHHHCCCCCEEEEEEC-CCCEEEEECCCCCCCCCCCCCC-E------------EEEEECCCEEEEEECCCCHH Q ss_conf 99999999974267846898754-9860786215440014478811-0------------69983215089997497999 Q gi|254780254|r 48 IEAARRAISRGMKRAGRVWICVF-PDVPVTAKPTEVRMGKGKGNVE-K------------WVCRVKPGRILFEIDGVSEE 113 (138) Q Consensus 48 iEaaR~~i~R~lkk~gkiwirv~-P~~pvTkKp~e~RMGkGKG~~~-~------------wv~~Vk~G~ilfEi~gi~~~ 113 (138) -|++...+|+-..=.|-..+.|+ |..| ..+-.|-++|.+. | ..-.|+.|+|+.|+.+-+. T Consensus 12 ~eTtEklLN~l~~i~gI~R~vihGp~LP-----k~VpyGPa~G~pv~h~~Rk~I~V~g~~veL~V~VGrI~veled~~~- 85 (150) T TIGR03260 12 AETTEKLLNKLYDLDGILRVVIHGQRLP-----KKVPYGPARGLPVNHPDRKTIRVKGEDVELRVQVGRIILELEDEDI- 85 (150) T ss_pred HHHHHHHHHHHHCCCCEEEEEEECCCCC-----CCCCCCCCCCCCCCCCCCEEEEECCEEEEEEEEEEEEEEEECCHHH- T ss_conf 8889999998745178899998789999-----7788886668878886434799899989999998389999727668- Q ss_pred HHHHHHHHHH-HHCCCEEEE Q ss_conf 9999999985-438951799 Q gi|254780254|r 114 VARRAFRLGA-AKLSVVTKF 132 (138) Q Consensus 114 ~a~~al~~a~-~KLP~k~k~ 132 (138) .+..+.++ .-|||...+ T Consensus 86 --i~~I~eiC~e~~pf~y~i 103 (150) T TIGR03260 86 --VEEIEEICKEMLPFGYEV 103 (150) T ss_pred --HHHHHHHHHHHCCCCEEE T ss_conf --999999999757985563 No 30 >COG4725 IME4 Transcriptional activator, adenine-specific DNA methyltransferase [Signal transduction mechanisms / Transcription] Probab=20.06 E-value=74 Score=14.10 Aligned_cols=45 Identities=18% Similarity=0.147 Sum_probs=35.1 Q ss_pred CEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEECCCCCCCCCC Q ss_conf 3132599999999999974267846898754986078621544001447 Q gi|254780254|r 40 ANRIGSSEIEAARRAISRGMKRAGRVWICVFPDVPVTAKPTEVRMGKGK 88 (138) Q Consensus 40 ~g~it~~qiEaaR~~i~R~lkk~gkiwirv~P~~pvTkKp~e~RMGkGK 88 (138) .-|.|+++|+.+-.++++- |.=++.+..+.-+|+-+.-+|||-|- T Consensus 60 ~lw~T~~hl~~~~ecL~~W----Gf~~ks~~~W~Ktt~~G~kv~~GtGh 104 (198) T COG4725 60 YLWATAPHLAFTVECLKAW----GFEYKSFMAWRKTTAAGRKVRMGTGH 104 (198) T ss_pred EEEECCHHHHHHHHHHHHH----CCCEEEEEEEEEECCCCCEEEEECCE T ss_conf 9994374889999999871----83305788776532567368840224 Done!