BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780254|ref|YP_003064667.1| 50S ribosomal protein L16 [Candidatus Liberibacter asiaticus str. psy62] (138 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780254|ref|YP_003064667.1| 50S ribosomal protein L16 [Candidatus Liberibacter asiaticus str. psy62] Length = 138 Score = 275 bits (702), Expect = 3e-76, Method: Compositional matrix adjust. Identities = 138/138 (100%), Positives = 138/138 (100%) Query: 1 MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60 MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK Sbjct: 1 MLRQPKNTKYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMK 60 Query: 61 RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120 RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR Sbjct: 61 RAGRVWICVFPDVPVTAKPTEVRMGKGKGNVEKWVCRVKPGRILFEIDGVSEEVARRAFR 120 Query: 121 LGAAKLSVVTKFIQRVVE 138 LGAAKLSVVTKFIQRVVE Sbjct: 121 LGAAKLSVVTKFIQRVVE 138 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 25.4 bits (54), Expect = 0.40, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 30 FGNFALKAQEANRIGSSEIEAARRAISRGMKRA 62 F N A + +E GS+ IE+ AIS+ M ++ Sbjct: 744 FSNNAKRMEELLHSGSANIESELSAISKAMNKS 776 >gi|254781065|ref|YP_003065478.1| L-lysine 2,3-aminomutase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 24.3 bits (51), Expect = 0.98, Method: Compositional matrix adjust. Identities = 14/62 (22%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Query: 9 KYPKQFKGRIKGVAKGGSRICFGNFALKAQEANRIGSSEIEAARRAISRGMKRAGRVWIC 68 +YP + ++ V R CF + +Q+ + S + EAA I + ++W Sbjct: 92 RYPDRILLKLLHVCPVYCRFCFRREMVGSQKGTVLSSKDTEAALAYI----QEKSQIWEV 147 Query: 69 VF 70 +F Sbjct: 148 IF 149 >gi|254781102|ref|YP_003065515.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 497 Score = 22.7 bits (47), Expect = 2.8, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 103 ILFEIDGVSEEVARRAFRLGAAKLSV 128 I++ D S+EV +RA G LSV Sbjct: 245 IIYADDAYSKEVMKRAHNAGCRVLSV 270 >gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Score = 22.3 bits (46), Expect = 3.0, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 45 SSEIEAARRAISRGMKRAGRVWICVFPDV 73 S E+ R+ + M R GR +C+ DV Sbjct: 275 SGELSQQERSNALQMMRDGRARVCIATDV 303 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.137 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,311 Number of Sequences: 1233 Number of extensions: 2734 Number of successful extensions: 10 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 7 length of query: 138 length of database: 328,796 effective HSP length: 66 effective length of query: 72 effective length of database: 247,418 effective search space: 17814096 effective search space used: 17814096 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 34 (17.7 bits)