HHsearch alignment for GI: 254780256 and conserved domain: PRK12279

>PRK12279 50S ribosomal protein L22/unknown domain fusion protein; Provisional.
Probab=100.00  E-value=2.8e-44  Score=281.72  Aligned_cols=115  Identities=23%  Similarity=0.339  Sum_probs=110.5

Q ss_pred             HEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH-CCCCCHHHEEEEEEEECCC
Q ss_conf             123112148750889999999984798699999888658202479999999999999984-0599823369999998898
Q gi|254780256|r   15 NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAEN-NHDLDVDRLIVSEAYVGKS   93 (131)
Q Consensus        15 ~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~-n~~ld~~~L~I~~~~v~~G   93 (131)
T Consensus         1 MEAKAiaRyVRISPrKARlV~DlIRGK~V~EAlaILkFTPKKAA~iV~KvLkSAiANAe~NN~glD~D~LyVkea~VDEG   80 (311)
T PRK12279          1 MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQHNSKDMDPSKLYIYKIVANQG   80 (311)
T ss_pred             CCCEEEECCCEECHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEEEEEECCC
T ss_conf             96054525534167899999998879979999999840843236999999999999998610389867849999997888


Q ss_pred             CEEEEEEECCCCCCCCEECCCCEEEEEEEECCCCCC
Q ss_conf             114201025666637201785008999985172332
Q gi|254780256|r   94 VFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEGK  129 (131)
Q Consensus        94 ~~~KR~~prarGRa~~i~k~~sHi~VvL~e~~~~~k  129 (131)
T Consensus        81 PTLKRfrPRArGRA~rIrKRTSHITIVLSDDvner~  116 (311)
T PRK12279         81 PTMKRTLPRAKGSADQLFKRTTHLEIVLSDDVNERE  116 (311)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHH
T ss_conf             720143703268634301566767999788865557