>cd00336 Ribosomal_L22 Ribosomal protein L22/L17e. L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit. It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper folding and stabilizing the conformation of 23S rRNA. L22 is the largest protein contributor to the surface of the polypeptide exit channel, the tunnel through which the polypeptide product passes. L22 is also one of six proteins located at the putative translocon binding site on the exterior surface of the ribosome.

Probab=100.00 E-value=7.2e-37 Score=238.06 Aligned_cols=105 Identities=43% Similarity=0.495 Sum_probs=103.0 Q ss_pred EEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEEEEEECCCCEE Q ss_conf 31121487508899999999847986999998886582024799999999999999840599823369999998898114 Q gi|254780256|r 17 ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFM 96 (131) Q Consensus 17 ~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L~I~~~~v~~G~~~ 96 (131) T Consensus 1 ~ka~~~~ir~S~kK~~~v~~~IrG~~v~~A~~~L~~~~~k~a~~i~k~l~sa~~nA~~~~~~d~~~L~I~~~~v~~G~~~ 80 (105) T cd00336 1 AKAKGRYLRISPKKARLVARLIRGMSVDEALAQLEFVPKKAAKIILKLLKSAEANAENNGLDDPDKLYIKHIQVNKGPTL 80 (105) T ss_pred CCCCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEEEEEEEECCCCC T ss_conf 92202776057899999999986991999999986688518999999999999989982699857849999999048715 Q ss_pred EEEEECCCCCCCCEECCCCEEEEEE Q ss_conf 2010256666372017850089999 Q gi|254780256|r 97 KRFHCRGRQRIGRIVRPFSRLTVIV 121 (131) Q Consensus 97 KR~~prarGRa~~i~k~~sHi~VvL 121 (131) T Consensus 81 kr~~~rarGR~~~~~k~~~hi~vvl 105 (105) T cd00336 81 KRRRPRARGRANPIRKRTCHITVVL 105 (105) T ss_pred CCCCCCCCCCCCCCCCCCCCEEEEC T ss_conf 6768777888888626850389969

HHsearch alignment for GI: 254780256 and conserved domain: cd00336