HHsearch results for GI: 254780256 and protein with PDBid: 3bbo_U

>3bbo_U Ribosomal protein L22; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1
Probab=100.00  E-value=5.8e-42  Score=266.83  Aligned_cols=115  Identities=29%  Similarity=0.379  Sum_probs=110.5

Q ss_pred             HHEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEEEEEECCC
Q ss_conf             11231121487508899999999847986999998886582024799999999999999840599823369999998898
Q gi|254780256|r   14 DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKS   93 (131)
Q Consensus        14 ~~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L~I~~~~v~~G   93 (131)
                      ..|+.|.++||++||+|+|+|+|+|||++|++|+.||+|+|+++|.+|.++|.||++||++|+|+|+|+|||++||||+|
T Consensus        29 ~~ev~a~~~~IriSpkK~R~VadlIRGk~V~eAl~~L~fspkKaA~~I~KlL~SAvaNA~~n~~ld~d~L~I~ea~V~~G  108 (199)
T 3bbo_U           29 CDEITTRGYSISMSVDKARRVIDQIRGRSYAETLMILELMPYRACYPIFKLIYSAAANASHNKQFNKANLIISKAEVNKG  108 (199)
T ss_dssp             -CCBCCCCSCCSSCSSSSSTTHHHHTTCBTTTTTTTGGGCCCTTHHHHHHHHHHHTTHHHHTSSCCSSSCEEEECCCCBC
T ss_pred             CCEEEEECCEEEECHHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCC
T ss_conf             71379987852048799999999986992999999974696768999999999999998730156644449999998899


Q ss_pred             CEEEEEEECCCCCCCCEECCCCEEEEEEEECCCCC
Q ss_conf             11420102566663720178500899998517233
Q gi|254780256|r   94 VFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDEG  128 (131)
Q Consensus        94 ~~~KR~~prarGRa~~i~k~~sHi~VvL~e~~~~~  128 (131)
                      |++||++||||||+++|++|+|||||||+|.+..+
T Consensus       109 p~lKR~rpRARGRa~~I~krtsHItIVL~E~s~~~  143 (199)
T 3bbo_U          109 ITLKKVKPRARGRSYMILRPTCHITIVLRDITHFD  143 (199)
T ss_dssp             CCCCCCCCSSSSCSCCCCCCCBCCCCEEECCCCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCHH
T ss_conf             74448798757888875688634899998677146