Query         gi|254780256|ref|YP_003064669.1| 50S ribosomal protein L22 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 131
No_of_seqs    114 out of 1450
Neff          5.6 
Searched_HMMs 13730
Date          Tue May 24 06:09:57 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780256.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d2zjrp1 d.55.1.1 (P:8-134) Rib 100.0   3E-43       0  273.0  10.8  124    4-127     4-127 (127)
  2 d1i4ja_ d.55.1.1 (A:) Ribosoma 100.0 1.7E-40 1.3E-44  256.7  11.8  110   15-127     1-110 (110)
  3 d1vqor1 d.55.1.1 (R:1-150) Rib 100.0   3E-37 2.2E-41  237.6   9.4  115    9-124     6-150 (150)
  4 d2gycq1 d.55.1.1 (Q:5-110) Rib 100.0 4.8E-41 2.8E-45  260.0 -10.5  106   19-124     1-106 (106)
  5 d1r9pa_ d.224.1.2 (A:) NifU-li  81.4     1.6 0.00012   20.9   5.6   67   16-82     55-131 (134)
  6 d1wfza_ d.224.1.2 (A:) Iron-su  48.7       8 0.00059   16.9   4.2   62   17-78     52-123 (130)
  7 d1fs1b1 a.157.1.1 (B:86-140) C  29.1      14   0.001   15.5   2.1   16   31-46     35-50  (55)
  8 d1xjsa_ d.224.1.2 (A:) NifU {B  20.1      25  0.0018   13.9   3.2   57   17-73     59-144 (147)
  9 d1wwia1 a.22.1.4 (A:1-148) Hyp  14.8      34  0.0025   13.2   3.7   47   28-79      5-53  (148)
 10 d1nexa1 a.157.1.1 (A:116-185)   14.2      35  0.0025   13.1   2.1   21   31-51     36-56  (70)

No 1  
>d2zjrp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]}
Probab=100.00  E-value=3e-43  Score=272.97  Aligned_cols=124  Identities=36%  Similarity=0.437  Sum_probs=116.3

Q ss_pred             CHHHHHHHHHHHEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHE
Q ss_conf             03576742101123112148750889999999984798699999888658202479999999999999984059982336
Q gi|254780256|r    4 KRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRL   83 (131)
Q Consensus         4 ~~~~~~~~~~~~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L   83 (131)
                      ++...+.....+++.|+++|+|+||+|+++|+++|||++|+||+.||+|+|+++|.+|.|+|+||++||++++|+|+|+|
T Consensus         4 kk~~~~~~~~~~~~~A~~k~ir~Sp~K~r~v~~~IrG~~v~eAl~~L~f~~kkaa~~v~k~l~sA~aNA~~~~~~d~~~L   83 (127)
T d2zjrp1           4 KKQRKQQVKLRKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEMLEDRL   83 (127)
T ss_dssp             HHHHHHHCCCCCTTEEEEEEESSCHHHHHHHHHHSTTSBHHHHHHHHHHCCCTTHHHHHHHHTTTHHHHTTTTCCCGGGE
T ss_pred             HHHHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             67788766110414330063615889999999998699199999998648715566199999999999986046761045


Q ss_pred             EEEEEEECCCCEEEEEEECCCCCCCCEECCCCEEEEEEEECCCC
Q ss_conf             99999988981142010256666372017850089999851723
Q gi|254780256|r   84 IVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE  127 (131)
Q Consensus        84 ~I~~~~v~~G~~~KR~~prarGRa~~i~k~~sHi~VvL~e~~~~  127 (131)
                      ||+++|||+||++|||+||||||+++|++|+|||+|+|+|.+++
T Consensus        84 ~I~~~~v~~G~~~KR~~prArGRa~~i~k~~sHi~VvL~e~~~k  127 (127)
T d2zjrp1          84 FVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVAEKGNK  127 (127)
T ss_dssp             EEEEEEEEECCCEEEEEECSTTCEEEEEECCEEEEEEEEECCCC
T ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCC
T ss_conf             99899989998255779874788876348863489999746889


No 2  
>d1i4ja_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]}
Probab=100.00  E-value=1.7e-40  Score=256.70  Aligned_cols=110  Identities=44%  Similarity=0.494  Sum_probs=106.2

Q ss_pred             HEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEEEEEECCCC
Q ss_conf             12311214875088999999998479869999988865820247999999999999998405998233699999988981
Q gi|254780256|r   15 NEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSV   94 (131)
Q Consensus        15 ~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L~I~~~~v~~G~   94 (131)
                      +|++|.+||+|+||+|+|+|+++|||++|++|+.||+|+|+++|++|+|+|+||++||++++|+|+|+|||+++|||+||
T Consensus         1 Me~~A~~k~ir~Sp~K~r~va~~IrG~~v~~Al~~L~f~~~kaa~~i~k~l~SA~aNA~~~~~~d~~~L~I~~~~v~~G~   80 (110)
T d1i4ja_           1 MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDALEDRLYVKAAYVDEGP   80 (110)
T ss_dssp             CCEEEEEEEESSCHHHHHHHHHHHTTCBHHHHHHHHHHCCCTTHHHHHHHHHHHHHHHHHTSCCCGGGEEEEEEEEEEEE
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCC
T ss_conf             90798808663488999999999869919999999702861027899999999999998634977203489999988996


Q ss_pred             EEEEEEECCCCCCCCEECCCCEEEEEEEECCCC
Q ss_conf             142010256666372017850089999851723
Q gi|254780256|r   95 FMKRFHCRGRQRIGRIVRPFSRLTVIVREVSDE  127 (131)
Q Consensus        95 ~~KR~~prarGRa~~i~k~~sHi~VvL~e~~~~  127 (131)
                      ++|   ||||||+++|+||+|||+|+|+|.+.+
T Consensus        81 ~~k---~rarGRa~~i~k~~sHi~vvL~e~~~k  110 (110)
T d1i4ja_          81 AVL---PRARGRADIIKKRTSHITVILGEKHGK  110 (110)
T ss_dssp             EEC---SCSSSCCCSCCEEEEEEEEEEEESSCC
T ss_pred             EEC---HHHCCCCCCCCCCCCCEEEEEEECCCC
T ss_conf             577---111367786347766689999406789


No 3  
>d1vqor1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
Probab=100.00  E-value=3e-37  Score=237.58  Aligned_cols=115  Identities=20%  Similarity=0.177  Sum_probs=108.8

Q ss_pred             HHHHHHHEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHH------------------------------HCCCHHH
Q ss_conf             7421011231121487508899999999847986999998886------------------------------5820247
Q gi|254780256|r    9 KRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLE------------------------------FSRKRIA   58 (131)
Q Consensus         9 ~~~~~~~e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~------------------------------f~~kk~A   58 (131)
                      -...++++++|.++++++||+|+++|+++||||+|++|+.||+                              |+|+++|
T Consensus         6 ~~~~~~~~~kA~~~~~riS~kK~~~va~~IrGk~v~~A~~~L~~v~~kk~avp~~~~~~~v~~~~~~~~~~~g~~p~kaa   85 (150)
T d1vqor1           6 VEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKAS   85 (150)
T ss_dssp             SCCCTTTEEEEEEEEECSCHHHHHHHHHHHTTSBHHHHHHHHHHHHHTSSCEECSSSCTTCCBCTTCSSCSBEECCHHHH
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             25899835999857885768999999999859879999999999888677889998612220133105777566817889


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHEEEEEEEECCCCEEEEEEECCCCCCCCEECCCCEEEEEEEEC
Q ss_conf             999999999999998405998233699999988981142010256666372017850089999851
Q gi|254780256|r   59 GEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVIVREV  124 (131)
Q Consensus        59 ~~i~k~L~SA~aNA~~n~~ld~~~L~I~~~~v~~G~~~KR~~prarGRa~~i~k~~sHi~VvL~e~  124 (131)
                      .+|.|+|+||.+||+++ ++|+|+|||+++|||+|+++||++||||||++++++++|||+|||+|-
T Consensus        86 ~~i~kll~sa~aNA~~~-~~d~~~L~I~~~~v~kG~~~KR~~prArGRa~~i~k~~~hi~vvL~E~  150 (150)
T d1vqor1          86 KAFLDLLENAVGNADHQ-GFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEP  150 (150)
T ss_dssp             HHHHHHHHHHHHHHHHT-TSCGGGSEEEEEEEEEEEEECCEEECGGGCEEECCEEEEEEEEEEECC
T ss_pred             HHHHHHHHHHHHHHHHC-CCCHHHEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECC
T ss_conf             99999999999988753-777137189999988786056768065788887028970089999378


No 4  
>d2gycq1 d.55.1.1 (Q:5-110) Ribosomal protein L22 {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=4.8e-41  Score=260.02  Aligned_cols=106  Identities=42%  Similarity=0.546  Sum_probs=104.1

Q ss_pred             EECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHEEEEEEEECCCCEEEE
Q ss_conf             12148750889999999984798699999888658202479999999999999984059982336999999889811420
Q gi|254780256|r   19 AIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKR   98 (131)
Q Consensus        19 A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~L~I~~~~v~~G~~~KR   98 (131)
                      |.+||+|+||+|+++|+++|||++|+||+.||+|+|+++|.+|.|+|+||++||++++|+|+|+|||+++|||+||++||
T Consensus         1 A~~k~ir~Sp~K~r~va~~IrG~~v~~A~~~L~f~~kkaa~~i~k~l~sA~aNA~~~~~~d~~~L~I~~~~v~~G~~~KR   80 (106)
T d2gycq1           1 AKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKR   80 (106)
T ss_dssp             CCCCCCCCCSSSSCSSSSSSSSSCSHHHHSSSSSCCSSTTSSTTTSSSSSSTTTSTTTTCCTTTEEECCCCCCCCCBCCC
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHEEEEEEECCCCCCCC
T ss_conf             98674615879999999998699199999997359951144899999999999997259997993888999899872457


Q ss_pred             EEECCCCCCCCEECCCCEEEEEEEEC
Q ss_conf             10256666372017850089999851
Q gi|254780256|r   99 FHCRGRQRIGRIVRPFSRLTVIVREV  124 (131)
Q Consensus        99 ~~prarGRa~~i~k~~sHi~VvL~e~  124 (131)
                      |+||||||+++|++|+|||+|+|+|.
T Consensus        81 ~~~rarGRa~~i~k~~sHi~vvL~Ek  106 (106)
T d2gycq1          81 IMPRAKGRADRILKRTSHITVVVSDR  106 (106)
T ss_dssp             BCCCTTTCCCBCCCBCCCCCCCEEEC
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEECC
T ss_conf             59762677776337874589998169


No 5  
>d1r9pa_ d.224.1.2 (A:) NifU-like protein HI0377 {Haemophilus influenzae [TaxId: 727]}
Probab=81.38  E-value=1.6  Score=20.94  Aligned_cols=67  Identities=13%  Similarity=0.109  Sum_probs=52.2

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHH----------HCCCHHHHHHHHHHHHHHHHHHHCCCCCHHH
Q ss_conf             231121487508899999999847986999998886----------5820247999999999999998405998233
Q gi|254780256|r   16 EANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLE----------FSRKRIAGEVRKTLCSAVANAENNHDLDVDR   82 (131)
Q Consensus        16 e~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~----------f~~kk~A~~i~k~L~SA~aNA~~n~~ld~~~   82 (131)
                      +++-.+..--+|-==+-.++++|.|++++||...-.          -+..+.|.+..++|+.|+.+.+.+.|.+..+
T Consensus        55 di~f~~~GCais~Asas~~~e~i~Gkt~~ea~~i~~~~i~e~l~~~p~r~~Ca~L~~~al~~al~~y~~k~g~~~~~  131 (134)
T d1r9pa_          55 DAKFKTYGCGSAIASSSLITEWVKGKSLEEAGAIKNSQIAEELELPPVKVHCSILAEDAIKAAIADYKAKQGLEHHH  131 (134)
T ss_dssp             EEEEEEESSSSHHHHHHHHHHHSSSSBHHHHTTSHHHHHHHHHTCCSTTHHHHHHHHHHHHHHHHHHHHTTTCCCSC
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHCCHHHHHHHCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCHHH
T ss_conf             78898306860076999999999727898999850367888623787204999999999999999999853995210


No 6  
>d1wfza_ d.224.1.2 (A:) Iron-sulfur cluster protein U (IscU) {Mouse (Mus musculus), mitochondrial [TaxId: 10090]}
Probab=48.73  E-value=8  Score=16.85  Aligned_cols=62  Identities=15%  Similarity=0.056  Sum_probs=44.5

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHH--------H--HCCCHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             3112148750889999999984798699999888--------6--582024799999999999999840599
Q gi|254780256|r   17 ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADL--------E--FSRKRIAGEVRKTLCSAVANAENNHDL   78 (131)
Q Consensus        17 ~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L--------~--f~~kk~A~~i~k~L~SA~aNA~~n~~l   78 (131)
                      ++-.+..--+|-==.-.++.++.|++++||..+-        .  =+..+.|.+-.++|+.|+.+.+.+...
T Consensus        52 i~F~~~GC~is~AsaS~~tel~~Gkt~~ea~~i~~~~i~~~l~l~p~R~~CA~La~~aL~~Al~~y~~k~~~  123 (130)
T d1wfza_          52 ARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQES  123 (130)
T ss_dssp             EEEECCSCHHHHHHHHHHHHHHTTSBHHHHHHCCHHHHHHHHTCCGGGHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             EEEEEECCCHHHHHHHHHHHHHHCCCHHHHHHCCCHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             999842783547799999999861688998731739999872799621359999999999999999974527


No 7  
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
Probab=29.08  E-value=14  Score=15.46  Aligned_cols=16  Identities=38%  Similarity=0.509  Sum_probs=11.6

Q ss_pred             HHHHHHHHCCCCHHHH
Q ss_conf             9999998479869999
Q gi|254780256|r   31 LNLVAAMIRGKRVSDA   46 (131)
Q Consensus        31 ~r~va~~IrG~~v~eA   46 (131)
                      ...||++|+|++++|=
T Consensus        35 c~~vA~~ikgKt~eei   50 (55)
T d1fs1b1          35 CKTVANMIKGKTPEEI   50 (55)
T ss_dssp             HHHHHHHHTTCCHHHH
T ss_pred             HHHHHHHHCCCCHHHH
T ss_conf             9999998869999999


No 8  
>d1xjsa_ d.224.1.2 (A:) NifU {Bacillus subtilis [TaxId: 1423]}
Probab=20.10  E-value=25  Score=13.95  Aligned_cols=57  Identities=25%  Similarity=0.243  Sum_probs=37.5

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHH-----------------------------CCCHHHHHHHHHHHH
Q ss_conf             311214875088999999998479869999988865-----------------------------820247999999999
Q gi|254780256|r   17 ANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEF-----------------------------SRKRIAGEVRKTLCS   67 (131)
Q Consensus        17 ~~A~~k~ir~Sp~K~r~va~~IrG~~v~eAl~~L~f-----------------------------~~kk~A~~i~k~L~S   67 (131)
                      ++-.++.--+|-==+-.+++.+.|+++++|......                             +..+.|..-.++|+.
T Consensus        59 ~~f~~~GCai~~ASasil~e~~~gk~~~~a~~l~~~~~~~l~~~~~~~~~~~~~l~~l~~v~~~p~R~~Ca~L~~~Al~~  138 (147)
T d1xjsa_          59 AKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEK  138 (147)
T ss_dssp             EEEEEESSHHHHHHHHHHHHHHTTSBHHHHHHHHHHHHHHHHHCSCCSSCCCHHHHHHHHHTTSTTTHHHHHHHHHHHHH
T ss_pred             EEEEECCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHH
T ss_conf             77664245788889999999982898999999999999998367877422256788730767686313899889999999


Q ss_pred             HHHHHH
Q ss_conf             999998
Q gi|254780256|r   68 AVANAE   73 (131)
Q Consensus        68 A~aNA~   73 (131)
                      |+++.+
T Consensus       139 al~~~~  144 (147)
T d1xjsa_         139 GVAKEE  144 (147)
T ss_dssp             HSCSTT
T ss_pred             HHHHHH
T ss_conf             999851


No 9  
>d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]}
Probab=14.76  E-value=34  Score=13.18  Aligned_cols=47  Identities=23%  Similarity=0.222  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHHCCCCHH--HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             89999999984798699--99988865820247999999999999998405998
Q gi|254780256|r   28 PQKLNLVAAMIRGKRVS--DALADLEFSRKRIAGEVRKTLCSAVANAENNHDLD   79 (131)
Q Consensus        28 p~K~r~va~~IrG~~v~--eAl~~L~f~~kk~A~~i~k~L~SA~aNA~~n~~ld   79 (131)
                      .-|.-.+.+.--|..|+  ++-.+..|..+|    ++.+|..|++||..| |-|
T Consensus         5 ~~k~e~~FR~aa~LdvdK~d~~r~~d~V~~K----l~DLllva~~~A~~n-~Rd   53 (148)
T d1wwia1           5 VAEFERLFRQAAGLDVDKNDLKRVSDFLRNK----LYDLLAVAERNAKYN-GRD   53 (148)
T ss_dssp             HHHHHHHHHHHHCCCCCGGGHHHHHHHHHHH----HHHHHHHHHHHHHHT-TCS
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH----HHHHHHHHHHHHHHC-CCC
T ss_conf             7999999999746687678899999999999----999999999988761-788


No 10 
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=14.17  E-value=35  Score=13.08  Aligned_cols=21  Identities=29%  Similarity=0.468  Sum_probs=14.7

Q ss_pred             HHHHHHHHCCCCHHHHHHHHH
Q ss_conf             999999847986999998886
Q gi|254780256|r   31 LNLVAAMIRGKRVSDALADLE   51 (131)
Q Consensus        31 ~r~va~~IrG~~v~eAl~~L~   51 (131)
                      ...||++|+|++.+|=-..+.
T Consensus        36 c~~vA~~ikgkt~eeiR~~f~   56 (70)
T d1nexa1          36 CKVVAEMIRGRSPEEIRRTFN   56 (70)
T ss_dssp             HHHHHHHHTTCCHHHHHHHHT
T ss_pred             HHHHHHHHCCCCHHHHHHHHC
T ss_conf             999999982599999999959


Done!