BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780256|ref|YP_003064669.1| 50S ribosomal protein L22
[Candidatus Liberibacter asiaticus str. psy62]
         (131 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780256|ref|YP_003064669.1| 50S ribosomal protein L22 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 131

 Score =  261 bits (667), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 131/131 (100%), Positives = 131/131 (100%)

Query: 1   MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE 60
           MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE
Sbjct: 1   MSGKRSVSKRRMGDNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGE 60

Query: 61  VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI 120
           VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI
Sbjct: 61  VRKTLCSAVANAENNHDLDVDRLIVSEAYVGKSVFMKRFHCRGRQRIGRIVRPFSRLTVI 120

Query: 121 VREVSDEGKVV 131
           VREVSDEGKVV
Sbjct: 121 VREVSDEGKVV 131


>gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 144

 Score = 21.6 bits (44), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 7/16 (43%), Positives = 12/16 (75%)

Query: 60 EVRKTLCSAVANAENN 75
          +V  T+CS +++ ENN
Sbjct: 75 DVSPTVCSDISSEENN 90


>gi|254780642|ref|YP_003065055.1| hypothetical protein CLIBASIA_02645 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 66

 Score = 21.2 bits (43), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%)

Query: 14 DNEANAIASMLRVSPQKLNLVAAMIRGKRVSDALADLEFSRKRIAGEVRKTLCSAVANAE 73
          DN+ +A A   R S  K N     I   R++ +L +++ + K    E+ K+L   +   +
Sbjct: 4  DNQKSAKALHERWSQGKFNYDQDRIDIIRIASSLLEIQINTKMELTELEKSLSIVLHEKK 63

Query: 74 NN 75
           N
Sbjct: 64 EN 65


>gi|254780392|ref|YP_003064805.1| leucyl aminopeptidase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 494

 Score = 21.2 bits (43), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 105 QRIGRIVRPFSRLTVIVREVSDEGKVV 131
           QR G IVR  S  T+ V     EG+++
Sbjct: 322 QRPGDIVRSMSGQTIEVINTDAEGRLI 348


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.322    0.134    0.365 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 71,152
Number of Sequences: 1233
Number of extensions: 2405
Number of successful extensions: 8
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1
Number of HSP's gapped (non-prelim): 7
length of query: 131
length of database: 328,796
effective HSP length: 65
effective length of query: 66
effective length of database: 248,651
effective search space: 16410966
effective search space used: 16410966
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 34 (17.7 bits)