RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780257|ref|YP_003064670.1| SSU ribosomal protein S19P [Candidatus Liberibacter asiaticus str. psy62] (92 letters) >gnl|CDD|30534 COG0185, RpsS, Ribosomal protein S19 [Translation, ribosomal structure and biogenesis]. Length = 93 Score = 121 bits (304), Expect = 5e-29 Identities = 51/93 (54%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Query: 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60 M RS++KGPFV K LLKKV +A++SG + ++ W R I+P+ +GLT V+NG+K VPV Sbjct: 1 MRRSLKKGPFVDKHLLKKVRKAKESGKKKPIKTWSRRSTILPEMVGLTIAVHNGKKFVPV 60 Query: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDK-KAKRK 92 ++EEMVG KLG+FAPTR GHG+D KA R Sbjct: 61 EITEEMVGHKLGEFAPTRTFVGHGADGIKATRS 93 >gnl|CDD|176991 CHL00050, rps19, ribosomal protein S19. Length = 92 Score = 109 bits (275), Expect = 1e-25 Identities = 40/92 (43%), Positives = 62/92 (67%), Gaps = 1/92 (1%) Query: 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60 M RS++K PFV LLKK+ + + ++ W R I+P IG T V+NG++H+P+ Sbjct: 1 MTRSLKKNPFVANHLLKKIEKLNTKEEKEIIVTWSRASTIIPTMIGHTIAVHNGKEHIPI 60 Query: 61 SVSEEMVGFKLGDFAPTRHCPGHG-SDKKAKR 91 ++++MVG KLG+FAPTR+ GH +DKK++R Sbjct: 61 YITDQMVGHKLGEFAPTRNFRGHAKNDKKSRR 92 >gnl|CDD|143960 pfam00203, Ribosomal_S19, Ribosomal protein S19. Length = 79 Score = 98.9 bits (247), Expect = 2e-22 Identities = 36/77 (46%), Positives = 53/77 (68%) Query: 3 RSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSV 62 RS++KGPFV LL+K+ + + + V++ W R I+P+ +G T VYNG++ VPV + Sbjct: 1 RSLKKGPFVDLKLLRKIKKENTANEKEVIKTWSRRSTILPEMVGHTIAVYNGKEFVPVYI 60 Query: 63 SEEMVGFKLGDFAPTRH 79 + EMVG KLG+FAPTR Sbjct: 61 TPEMVGHKLGEFAPTRK 77 >gnl|CDD|36117 KOG0899, KOG0899, KOG0899, Mitochondrial/chloroplast ribosomal protein S19 [Translation, ribosomal structure and biogenesis]. Length = 93 Score = 89.0 bits (220), Expect = 3e-19 Identities = 42/87 (48%), Positives = 59/87 (67%), Gaps = 3/87 (3%) Query: 1 MARSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPV 60 M RSV KGPFV K LL+K+ + + G+ ++ W R I+P +G TF ++NG++HVPV Sbjct: 10 MTRSVWKGPFVVKFLLRKIEKLK---GKAPIKTWSRASTILPTMVGHTFAIHNGKEHVPV 66 Query: 61 SVSEEMVGFKLGDFAPTRHCPGHGSDK 87 ++E+MVG KLG+FAPTR GH K Sbjct: 67 KITEDMVGHKLGEFAPTRKFFGHAKTK 93 >gnl|CDD|36116 KOG0898, KOG0898, KOG0898, 40S ribosomal protein S15 [Translation, ribosomal structure and biogenesis]. Length = 152 Score = 53.8 bits (129), Expect = 1e-08 Identities = 28/79 (35%), Positives = 39/79 (49%) Query: 6 RKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSVSEE 65 RK + K L K +A VV+ RN I+P+ +G GVYNG+ V + E Sbjct: 58 RKPHSLIKKLRKAKKEAPPMEKPEVVKTHLRNMIIVPEMVGSMVGVYNGKTFNQVEIKPE 117 Query: 66 MVGFKLGDFAPTRHCPGHG 84 M+G LG+F+ T HG Sbjct: 118 MIGHYLGEFSITYKPVKHG 136 >gnl|CDD|37227 KOG2016, KOG2016, KOG2016, NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones]. Length = 523 Score = 25.7 bits (56), Expect = 2.8 Identities = 7/28 (25%), Positives = 17/28 (60%) Query: 12 TKSLLKKVSQARDSGGRGVVRVWCRNCD 39 + +LK + ++ DS V++++C+N Sbjct: 352 VQEVLKSLGRSPDSISDDVIKLFCKNAA 379 >gnl|CDD|109881 pfam00843, Arena_nucleocap, Arenavirus nucleocapsid protein. Length = 534 Score = 24.2 bits (53), Expect = 6.9 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 13 KSLLKKVSQARDSGGR-GVVRVW 34 +L+ V + GGR GVVRVW Sbjct: 135 SEILRLVGMRQPQGGRNGVVRVW 157 >gnl|CDD|163694 cd08063, MPN_CSN6, Mpr1p, Pad1p N-terminal (MPN) domains without catalytic isopeptidase activity, found in COP9 signalosome complex subunit 6. CSN6 (COP9 signalosome subunit 6; COP9 subunit 6; MOV34 homolog, 34 kD) is one of the eight subunits of COP9 signalosome, a highly conserved protein complex with diverse functions, including several important intracellular pathways such as the ubiquitin/proteasome system, DNA repair, cell cycle, developmental changes, and some aspects of immune responses. CSN6 is an MPN-domain protein that directly interacts with the MPN+-domain subunit CSN5. It is cleaved during apoptosis by activated caspases. CSN6 processing occurs in CSN/CRL (cullin-RING Ub ligase) complexes and is followed by the cleavage of Rbx1, the direct interaction partner of CSN6. CSN6 cleavage enhances CSN-mediated deneddylating activity (i.e. cleavage of ubiquitin-like protein Nedd8 (neural precursor cell expressed, developmentally downregulated 8)) in the cullin 1 in cells. The cleavage of Rbx1 and increased deneddylation of cullins inactivate CRLs and presumably stabilize pro-apoptotic factors for final apoptotic steps. While CSN6 shows a typical MPN metalloprotease fold, it lacks the canonical JAMM motif, and therefore does not show catalytic isopeptidase activity. Length = 288 Score = 24.5 bits (54), Expect = 7.0 Identities = 6/27 (22%), Positives = 13/27 (48%) Query: 30 VVRVWCRNCDIMPQFIGLTFGVYNGRK 56 + R ++ P+ +G G +GR+ Sbjct: 17 ITRHRAQSQSEPPRVVGALLGQQDGRE 43 >gnl|CDD|35856 KOG0637, KOG0637, KOG0637, Sucrose transporter and related proteins [Carbohydrate transport and metabolism]. Length = 498 Score = 24.1 bits (52), Expect = 8.0 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 45 IGLTFGVYNGRKHVPVSVSEEMVGFKLGDFA 75 IGL G + P ++ ++GF L D A Sbjct: 125 IGLLLGDNERKPVKPRAIVLFILGFWLLDVA 155 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.139 0.437 Gapped Lambda K H 0.267 0.0709 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,099,976 Number of extensions: 49501 Number of successful extensions: 93 Number of sequences better than 10.0: 1 Number of HSP's gapped: 92 Number of HSP's successfully gapped: 12 Length of query: 92 Length of database: 6,263,737 Length adjustment: 61 Effective length of query: 31 Effective length of database: 4,945,588 Effective search space: 153313228 Effective search space used: 153313228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (23.5 bits)